How To Write A Summary Summary Writing, Essay Wr

How To Write A Summary |
Summary Writing, Essay Wr
1. Step
To get started, you must first create an account on site HelpWriting.net.
The registration process is quick and simple, taking just a few moments.
During this process, you will need to provide a password and a valid email
address.
2. Step
In order to create a "Write My Paper For Me" request, simply complete the
10-minute order form. Provide the necessary instructions, preferred
sources, and deadline. If you want the writer to imitate your writing style,
attach a sample of your previous work.
3. Step
When seeking assignment writing help from HelpWriting.net, our
platform utilizes a bidding system. Review bids from our writers for your
request, choose one of them based on qualifications, order history, and
feedback, then place a deposit to start the assignment writing.
4. Step
After receiving your paper, take a few moments to ensure it meets your
expectations. If you're pleased with the result, authorize payment for the
writer. Don't forget that we provide free revisions for our writing services.
5. Step
When you opt to write an assignment online with us, you can request
multiple revisions to ensure your satisfaction. We stand by our promise to
provide original, high-quality content - if plagiarized, we offer a full
refund. Choose us confidently, knowing that your needs will be fully met.
How To Write A Summary | Summary Writing, Essay Wr How To Write A Summary | Summary Writing, Essay Wr

Xenia Daily Gazette Case Study
Demographic Background (Kathryn) I think this would be a good section to open the paper with
because it provides background information...we could title it Executive Summary if we wanted and
include it before the solutions? What do you think?
The Xenia Daily Gazette staff is responsible for three news outlets throughout the Greene County
region: Xenia Daily Gazette, Fairborn Daily Herald and Beavercreek News Current (Xenia Gazette
About Page). As of 2015, Greene County has a population of 164, 045. Of this population, there are
22,219 individuals in the age range of 10 19 and 25,566 individuals in the age range of 20 29 (Greene
County Data). Of the three news outlets, only 11,642 newspapers are delivered to this county, which is
only a small portion of the ... Show more content on Helpwriting.net ...
This can be done by generating more Facebook likes. According to The Function of Newspapers in
Society: A Global Perspective, college students stay in touch with their hometowns via the web
version of the hometown paper. The younger demographics are going digital for how they receive
their news, so the Xenia Gazette must also go digital.
Here are the suggested steps and tips to increasing the traffic to the Xenia Gazette Facebook page:
Facebook users have the option to like pages or like statuses of friends. Liking a page means that users
are connected to the page. This means the user will see stories or updates that the page posts in their
news feed. (Facebook source)
2. Information on the Xenia Daily Gazette Facebook Page: The Xenia Daily Gazette s Facebook page
currently has 2,337 likes. Majority of their visitors: are women, come from Xenia and view their
Facebook page on their mobile devices, as opposed to viewing content on computers. Gaining more
Facebook likes would generate more traffic to the Xenia Daily Gazette Facebook
... Get more on HelpWriting.net ...

Last of the Mohicans Movie Review Essay example
The last of the Mohicans review The last of the Mohicans was a movie that really appealed to me from
the beginning because of the heroism and the action into it. The main characters in this movie were
Daniel day Lewis as Nathanial Poe (Hawkeye) and Madeline Stowe as Cora Munro. The movie could
be described as a romantic action like a Spiderman or a superman movie always needs the girl to give
motivation to the main character but it is a historical drama. The movie was 112 minutes long, it
contains three languages English, French and Mohawk, it was filmed in the USA, it was released in
September 1992 and its tagline was the first American hero, it is also based on the novel of James
Fennimore cooper. It is about the French and British ... Show more content on Helpwriting.net ...
Natives in this movie are seen as weaklings and they were only used for their cunning fighting
strategies and also their resources like food and homes, the French and British did not care about the
natives they only cared about how they could get more land and more powerful, although the natives
allied with the French or the British they still disliked them for what they were doing to their homes
and culture. The movie does not harm the native s picture to the world because they were the ones
who were weak and hurt in the movie it gave people something to think about like how the English
and French could do this to the natives and what are the consequences of the actions that were taken
by the French or the British. The movie also gives the feeling of sympathy towards the natives and
fills you up with hatred towards the Europeans who invaded the natives land. The movie also shows
us the way the natives dressed which were just long pieces of cloths and leather pants which were cut
off at the crouch for a relaxed fit, also the way they ate which was hunting deer and elk and gathering
berries and vegetables, it also showed their language and a little spiritual scenes when they shot an elk.
It gave me anal

Comparing Hosseini And Sophocles
Next, both Hosseini and Sophocles used the theme to fascinate the readers. Amir s choice ultimately
caused him nothing but tragedy, for his friendship with Hassan is fading and his lust for punishment
has led him to hit him [Hassan] with [a] pomegranate , so that in turn Hassan would punish him, so
that he may finally sleep at night , yet Amir s selfishness still overpowers his life, which magnifies the
reader s interest (Hosseini 92). Amir s need to destroy himself is not only heartrending but painful. His
need at self destruction absorbs the reader s full attention and makes them crave more. Sophocles used
the theme for the exact same purpose, yet he wanted to emphasize it for greater interest. Oedipus s
choice to discover his birth has

The Use Of Propaganda And Its Effects On The World War
World War II was first initiated in 1939. Although most of the war was fought on the European
theatre, the war reached the Homefront of the United States. With World War II being one of the most
grueling wars the world has experienced with events such as the holocaust, it will take the effort of an
entire nation to help bring the war to a victorious end. Propaganda was a major tool to help engage
citizens in aiding with the war efforts. Without the use of war time propaganda, the war would most
likely have a completely different outcome. The definition of propaganda is the use of mass media to
call an audience to action (Smith 1). That is exactly what nations like the United States and Britain
used to educate their citizens on what was going on with the war. The use of propaganda in these
nations had a major impact on the war. These nations used media types such as radio, posters, leaflets,
comic books, books, movies, magazines, and newspapers to inform/educate the public on the war.
These media outlets helped bring attention to the war and motivate citizens to act. Some common
actions citizens performed to aid in the war efforts include the investment in war time bonds, women
taking men s jobs while they are in the war, and joining the military to help fight. Propaganda is used
worldwide, however, the use of propaganda varies from nation to nation. The United States and
Britain both used propaganda as a tool to inform their citizens. Although these nations share some

Gateway Drug Definition
Is marijuana a gateway drug? This question has been asked throughout today s society many times.
When you ask this question you first must define what a drug is, then ask what is a gateway drug and
what characteristics does a drug must have, to be qualified as one. Then you must go on and look at
what exactly marijuana is and its characteristics. This argument over whether it is or not is very
important. Since people think it s a gateway drug people are against it, when it is very useful in
medical conditions. Marijuana is not a gateway drug, in fact it may be a gateway out of hardcore
drugs. A drug is typically a medicine but can be other substances that can be harmful for your body.
Businessdictionary.com tells us the definition for a drug is Natural or synthetic substance which (when
taken into a living body) affects its functioning or structure, and is used in the diagnosis, mitigation,
treatment, or prevention of a disease or relief of discomfort. ... Show more content on Helpwriting.net
...
A legal or medicinal drug (such as amphetamines), however, can be harmful and addictive if misused.
( Read the Full Definition ). So, if that s what a drug is then what s is a gateway drug? Merriam
Webster is a website that has many definitions. Merriam Webster states, that the definition for a
gateway drug is a drug whose use is thought to lead to the use of and dependence on a harder drug. (
Gateway Drug ). What that means is that you do a drug a couple of times, and it then leads you to do
more harmful drugs that are more addicting and worse for you. Some of the harmful drugs it may lead
to is heroin, cocaine, meth, and bath salts. You get hooked on a minor drug such as nicotine or alcohol
and then you go for a cheaper or harder drug to maximize the feeling. Another website that has
definitions is Dictionary.com. Dictionary.com tells us the definition for gateway drug is Any mood
altering drug, as a stimulant or tranquilizer, that does not

Dodge Rentals Research Paper
2016 Dodge Viper The American designed and manufactured 2016 Dodge Viper is a sight to be seen.
Even parked, it looks fast and ready to jump into action. There are five distinct models in the 2016
series: The Viper SRT, GT, GTS, GTC, and ARC. With the pricing starting from $87,895 to $118,795
depending on the model, the 2016 Dodge Viper is a work of automotive art. What s Under the Hood?
The 645 horsepower that comes from the 8.4L V10 all aluminum engine will take you from 0 to 60 in
about 3 seconds and has a top speed of 193 MPH. The six speed manual transmission puts out 600
pound feet of torque. It gets 12 mpg in the city and 21 mpg on the highway. Stock, the Dodge Viper
has a single mode high performance suspension, but a driver selectable ... Show more content on
Helpwriting.net ...
Designed for high speed balance and aerodynamic efficiency not only helps in the overall performance
but will turn heads anywhere you drive. The exhaust systems get its inspiration from race cars. The
aggressive sound that comes from it is backed up by the power under the hood. When it comes time to
choose how your Viper is going to look, there are 11 different rims to choose from, 15 leather and
suede colors and 8 exterior colors (9 on the ARG model). Additionally, there is a wide variety of
striping and other decorative details, like pin striping, that are optional but give the Dodge Viper that
distinct look that is associated with the Viper. Inside Tech A 8.4 inch touchscreen gives you GPS
navigation, HD radio, voice command, hands free calling, performance updates, and allows for
Bluetooth streaming of audio in Dodge s Uconnect system. Uconnect Access and Wi Fi Hotspot are
additional options that can be added to any 2016 Dodge Viper model. Speed and power are key
features to the 2016 Dodge Viper. Designed to go fast, you will look good doing it. There is a balance
between speed and luxury in this Detroit made car. Leather and suede interior, powerful engine,
performance braking system are all part of what makes the Dodge Viper a unique car to

Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been utilized for tumor
targeting. Anti epidermal growth factor receptor (EGFR) Affibody protein (e.g., Ac Cys ZEGFR:1907,
amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK
NH2) is used to target EGFR that is overexpressed in a wide variety of human tumors. Cheng and co
workers used anti EGFR Affibody protein as tumor targeting ligand on 64Cu Au IO nanoparticles
(PET component: 64Cu, MRI component: iron oxide, specific for EGFR) surface.[63] In their work,
A431 tumor cells were subcutaneously implanted in the right shoulders of nude mice; and 64Cu
NOTAAu IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive A431 (human
epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after injection, significantly higher
than that obtained from the blocking experiment (1.9% ID/g) indicating the specificity of the probe.
This difference in % ID/g values corroborated with 44% drop in MRI signal intensity that was
observed for the tumor. In this study, the use of an Affibody protein as ligand for EGFR expressing
tumor in small animals was demonstrated to be successful; however, the benefit of multimodality was
not demonstrated. The unique chemistry of this dumbbell shaped Au IO nanoprobe could pave the
way for targeted drug delivery into EGFR expressing tumors

Markthal Rotterdam And Port City Urban Design
Markthal Rotterdam and Port City Urban Design Rotterdam is known as the Netherlands number one
city for architecture (Groenendijk, 2015, p. 114). It is easy to see why when one considers the
overwhelming number of iconic buildings in the city, and how those individual buildings, while
creating a cohesive city, have managed to and continue to transform Rotterdam. Markthal Rotterdam,
one of the iconic buildings, is an award winning combination of open air market, department store,
shopping centre and residential building. It won the 2016 Rotterdam Architecture Award and the
German Council of Shopping Centres award for European Innovation ( Rotterdamer architekturpreis
für die Markthal, 2016, 126). Markthal Rotterdam was designed by ... Show more content on
Helpwriting.net ...
8). The idea of completely reconstructing the historical city centre to its previous splendor was
discarded by van Traa and a new spatial layout designed to separate functions and accommodate
traffic was developed (Groenendijk, 2015, p. 8). Nonetheless, the fire line of the German bombing is
still visible due to the difference between the old, nineteenth century buildings and the new, post war
construction (Groenendijk, 2015, p. 18). The Basic Plan for Reconstruction implemented an efficient
traffic plan on an orthogonal grid and the separation of functions was influenced by modernist urban
planning ides. However, the Basic Plan only governed urban planning in Rotterdam until the 1970s
when criticism of the emptiness, lack of housing, and lack of warmth was overwhelming
(Groenendijk, 2015, p. 19). For example, in the book De binnenstadsbeleving en Rotterdam (The
Inner City Experience and Rotterdam), R. Wenholt criticized the reconstruction of Rotterdam in the
late 1960s stating that the inner city failed at providing a vibrant, varied, convivial, pleasant, intimate
city (Meyer, 1999, p.328). The Markthal Rotterdam addresses the criticism of the Basic Plan, although
the outdated Basic Plan didn t directly influence its design, by creating a vibrant welcoming public
square

Essay on The Massachusetts and Chesapeake Colonies
America, one of the youngest countries in the world, partly owes its success to the events that took
place in the northeastern coast in the 1600s. It was great risk for English to colonize in America, a
foreign and faraway land, from which they did not know what to expect. At that time, America was
dominated by Dutch and French traders and a native population not so friendly with most of the
settlers. The colonies in Massachusetts and Chesapeake, located at the main crossroads of English,
Dutch, and French settlers and natives, play a significant role in the development of the future world
power. Although today the east coast enjoys a harmonious and successful lifestyle, in the early days of
our Nation s birth, the Massachusetts and ... Show more content on Helpwriting.net ...
John Rolfe was responsible for finding the perfect blend of tobacco that made the cash crop so
successful. The climate of the Chesapeake was good for farming because of the long growing season
and its flat land. In 1619, African slaves were introduced to Chesapeake society. This caused a
significant increase in the demand for workers. Also in 1619, the House of Burgess was established to
elect representatives for office. The settlers who established on the northern east coast were strictly
searching for a land with religious freedom. The Puritans, followers of John Calvin, settled in the
Massachusetts Bay Colony. In England, they wished to purify the Anglican Church but were
persecuted by King James I. The Puritans believed in well ordered communities and families. They
stressed education and the specific roles for males and females. The Pilgrims, or Separatists, founded
Plymouth Colony and wrote the Mayflower Compact as a self government document by taking
advantage of a loophole in their charter. This was the first self government treaty in North America.
They believed that the English church was so corrupt that they had to establish their own independent
congregations. As time passed, the New England settlements grew in population and diversity and
split into different colonies such as Massachusetts, Maine, New Hampshire, Rhode Island, and

Summary Of Ernest Hemingway s A Raisin In The Sun
Han takes another swig of his drink, the mug warping the sound of his own laughter as he does. ❝Talk
about goin for the jugular,❞ he says loudly, wiping his mouth and hazily aware of the fresh buddings
of anger churning his gut, contracting tightly with something a lot less clear. (icon image) Lingering
indignation from their words quells only when he imagines what it d be like if Ben were here; he d
probably be smiling warmly, bumping his shoulder, telling him to get a load of this guy over here. Han
s sure, it d be in the instant, Ben would recognize what the thinning of Han s lip meant, note the
riptide fury, and too caustic impulse to make em take back what they d said about Ben, force em to see
how Han sees Ben, a loving son who s had a few hiccups like his father, yet made something of
himself, even if it d been a struggle. ... Show more content on Helpwriting.net ...
Imagining his son here, grown up and seated beside him, ready to take a toast celebrating a day s work
done well until this chumani rears their ugly mug and their sharp words nobody d asked for, Ben s
exasperation to his father s temper surfacing at full tilt, reminding Han how it s so much like Leia s
until Ben s quick but pointed sideglance snaps him out of it, conveying everything from dampen down
your power core, hotshot to Dad, stop; it s okay, I

Mesoamerica Research Paper
Surname
Instructor
Course
Date
What it is
It is among the earliest and oldest sports played in America. It specifically originated in Central
America with the Mexicans in the Southern part of Mexico. Different towns thrived in this game
which was to them more than a sport. It was both a sport, a religious activity and it was also political.
It was also social because it brought the people in towns together.
The sport part of Mesoamerican ballgame involved getting a ball made of rubber into one among
many rings. The ball was solid and would weigh up to three kilograms. While playing to put the ball
through a ring, players were not to use their hands but were to use their thighs, shoulders, elbows and
even knees to pass this ball. The game was only played by men. It was significantly played by
warriors who were to prove their strength or get rewarded. While in other towns and Kingdoms,
captives of wars were ... Show more content on Helpwriting.net ...
They could be as many as twenty in a town. It is said that Mesoamerica had up to thirteen hundred ball
courts. They were built inside with walls that were either bent towards the centre or vertical. There
was an enclosing in the courts where the player only played. This is because as was in the ancient
days, the sport was observed as a matter of life and death for the winner and losers. The ball courts
were built mythically orienting themselves to the North and South of the compass.
The ball courts were built such that, they had markers on them, more so on the lengths of the courts,
mostly three. This markers were also symbolic in that, they represented the movements of the moon
and the sun in relation to the ground.
When ball gaming became widespread, it became part of North America too where they built courts or
the same. The sport thrived in many countries and cities and became with time an architectural and
social activity than a culture.
The cultural and Mythological importance of Mesoamerican

Theme Of Accountability In Staying Fat For Sarah Byrnes
The theme of accountability is exhibited throughout the novel, Staying Fat for Sarah Byrnes, in
multiple ways. The following paragraphs will provide some of the details that describe this theme in
the book.
There are multiple instances that depict the theme of accountability in Staying Fat for Sarah Byrnes.
For example, at the beginning of the novel, Moby recalls when Dale Thornton had bullied him and
Sarah Byrnes in junior high. He recalls how Sarah stood up for them and how they wrote a newspaper
called Crispy Pork Rinds to get back at bullies (Crutcher 28). To further illustrate, on page 210 and
211 Jody, Mark Brittain s ex girlfriend, confesses to the class that she had aborted Mark s six week old
fetus (Crutcher 210). She said that

Buck s Influence In The Call Of The Wild
Your circle of influence dictates your path. John Bielecki. Influence others have can guide your life. In
the book Call of the Wild , Jack London uses the influence of masters. Buck is a pampered prince in
Santa Clara Valley, in Judge Miller s house. One day, he is kidnapped and sold to be a sled dog. Buck
met several masters, the man in the red sweater, Francois and Perrault, and John Thornton. All of them
played a great role for Buck s rapid growth. Under the harsh environment of toiling, Buck gradually
grew into an undefeatable, wild beast. Among his masters, Buck felt passionate love for him and
Thornton. After Thornton s death Buck returns to the wild, but the trace of civilization left him brings
him to the place where Thornton ... Show more content on Helpwriting.net ...
Buck answered the call of the wild after Thornton s death. He ran and howled with the wolves. The
Indians called him a ghost dog because he was a powerful wolf who came to the place where Thornton
died every year. This was because Buck felt the passionate love for him and Thornton. Buck saved
Thornton, risking his life. Love. Genuine, passionate love, was his first time. (pg 73). What the
influence of love Thornton had for Buck was unbreakable. Thornton s influence allowed Buck to grow
more

Susie Harvey s The Lovely Bones
In the book The Lovely Bones, Susie Salmon a fourteen year old girl gets raped and murdered in a
cornfield and in a sink hole, her murder Mr.Harvey, her neighbor had built. He dismembered her body
parts and took her charm bracelet. Susie s father tried to find her murderer with the case detective Len.
When Jack, Susie s father helps Mr. Harvey build a tent out of sticks he gets a suspicious feeling Mr.
Harvey murdered her daughter and Mr. Harvey noticed so he told him it s time for him to leave. His
other daughter, Lindsey breaks into Mr. Harvey s house and rips out a page of his journal. The Lovely
Bones in the movie and book had many similarities but had huge differences. For instance, in the
book, Susie Salmon and Ray had kissed in the

Looking At Commercial Real Estate
Is it better for an investor to rent or buy commercial real estate in 2016?
Investors looking at commercial real estate (CRE) this year and wondering whether to lease or buy
should consider a few factors first.
And then, if they have the access to adequate capital, they should buy.
We ll look at the reasons why in a bit, but first let s look at why not to lease.
Little Upside to Leasing
Leasing in 2016 will be less attractive than in recent years. Vacancy rates for office,
warehouse/industrial and retail space will stay low or drop this year, signifying a more competitive
marketplace for commercial renters. Meanwhile, rental rates are expected to continue increasing,
albeit at slower rates than in 2015, with the current year showing ... Show more content on
Helpwriting.net ...
Moreover, by purchasing commercial property, an investor gains an asset that will continue to increase
in value rather better than a lease dragging on the bottom line. The Price is Right
In good news to potential buyers, economists expect real estate prices to, after a three year period of
extreme growth, slow down substantially beginning in 2016. For the first time since 2009 the Moody
s/RCA Commercial Property Price Index (CPPI) is dropping below the long term average growth rate
of 5.8 %. The CPPI will continue to grow at very subdued and slowing rates : 5 percent in 2016 (down
from 12.7 percent in 2015), 2.7 percent in 2017, and 3 percent in 2018.
What this data shows is that not only is the moment ripe for buying CRE, but also that properties will
continue to increase in value over the next couple of years, just more slowly. For an investor looking
at a secure product with long term potential, CRE is a vehicle with promise.
However, there are some reasons for investors to be cautious about purchasing.
Less Available Cash
Paralleling the drop in price growth, this year marks the first time since 2009 that the issuance of
commercial mortgage backed securities (CMBS), a key source of funding for commercial real estate,
is decreasing, from $101 billion in 2015 sharply to $85 billion. However, the drop is only temporary,
with issuance

Character Analysis Of Ma Joad In The Grapes Of Wrath
The Grapes of Wrath, by John Steinbeck, a novel which follows the journeys of migrants, eagerly
searching for the promise land, also known as California. However, these migrants are adapting to the
surroundings along their adventure, changing the way they critically think and behave. Nevertheless,
human nature is how the character behaves, thinks, feels, and their reaction to different situations.
Characters vary in human nature due to the environment around them. Focusing on Ma Joad, she can
be described as a loyal leader, a brave soul, and a persistent mother. Throughout out the novel, Ma
Joad receives her characteristics as she endures her time in California, Route 66, and the Great
Depression. These settings are the main surroundings that impacted Ma Joad the most. ... Show more
content on Helpwriting.net ...
Eventually, Ma got over the death of Granma Joad, at this point Ma Joad steps up to take the role of a
leader. Route 66 s trauma immensely shaped Ma s human nature into a leader. Being a leader requires
loyalty to the group. In California, the family starts breaking apart, many members decided to go their
own way. It is Ma s job to keep the family together, but as they split, Ma perseveres to stay and take
care of the other family members. As the Great Depression strains the Joad s economically, Ma s
character becomes determined, she is determined to get her family back on their feet to find a stable
job. As Ma gains determination, loyalty, and bravery throughout her travels, she has adapted the
characteristics of a great

The Effects Of Xenophobia In South Africa
Introduction
I have often wondered whether I made the right choice. From time to time I have been met with open
hostility from black South Africans who clearly do not want people from other countries around. I
believe this form of xenophobia to be unique to South Africa. To my knowledge it is not something to
be found elsewhere in Africa.
(Tegegne, 2001: 94)
The deep hatred and dislike of African foreign nationals by some locals emanates largely from the
perception that foreigners are here to take jobs from locals, rendering most of the less educated South
Africans unable to acquire employment (Moatshe, 2014)
Nationalism by a section of eminent South Africans (e.g. King Goodwill Zwelithini on 21 March 2015
(Mwanza, 2015) and Edward, son of president Jacob Zuma on 14 April 2015 (Khoza, 2015)) ... Show
more content on Helpwriting.net ...
Prior to 1994 the common enemy was apartheid. It was the glue that held together the resistance. A
fatalistic mentally, amongst a large sector of the South African population, was created which still
persists 22 years after democracy.
The tenets of citizenship and the nation have been reconstructed on a narrow, privileged, and
nationalistic basis, with a pernicious atmosphere being created, particularly through immigration
policies and the enforcement of an exclusive South Africa, creating the conditions for xenophobia to
take root. State institutions have been centrally involved in the abuse of foreign migrants, from illegal
arrests, renditions, torture, racial profiling, destruction of immigration documents and general abuse
(Amandla.org.za, 2015)
According to Lucien van der Walt, professor of Sociology at Rhodes University (Mwanza, 2015) the
enemy in post 1994 South Africa, has become the foreign nationals who present as soft targets due to
their much smaller numbers and lack of homogeneity. Most of the xenophobic attacks erupt in poor
and marginalised

My Family Is Not The Typical Caucasian Family Dynamic
As with any family, ours is not the typical Caucasian family dynamic. We began with my husband as
the traditional breadwinner while I was finishing my college education. It was planned that we both
would be working in careers before we discovered I was pregnancy with our first son. Three months
later my spouse would suffer a great tragedy and was no longer able to walk, much less work. I would
have to take on the role of not only breadwinner, but also caregiver and mother within the next year.
Our family does not have the duel career supporting parents as suggested in the text regarding our
ethnic statistics.
Some similarities that our family has had with our African American ethnic families is that of the
maintaining and strong ties to our extended family, as stated in our text. Our families have often
pooled resources in order to support each other. My spouse and I have welcomed members into our
home when they were struggling to find work. Our house guests have ranged from: his brother, my
brother, nephews, and even a great nephew. Some of them have lived with us a few months, others
have stayed a few years. My spouse s sister lives with her husband, his brother, and one of her
daughters. While my mother lives with her cohabitant, my brother, and his daughter. My grandparents
raised not only their four children, my brother and myself, as well as my two cousins in their home.
Another similarity that our family has with our African Americans would be the high

How To Have A Water Pipe Burst
Having a water pipe burst can be so annoying. At first, you might not even recognize you have a leak
until dampness manifest on the surface of a wall or if it s a underground leak moistness coming up
from the floor. Left unchecked, this can lead to further expensive damages including mildew, mold as
well as prominent structural repairs. Here are some reasons a pipe could burst * Extreme
Temperatures: Most people think of cold weather when it comes to pipes bursting; however, intense
summer heat can wreak havoc on them as well. * Previous Repairs: If you have had to fix a crack or
broken water line in the past by attempting to join two different metal materials together, most likely
you will have to replace it in the future. This

Myocardial Infraction Case Study
Abstract:
The aim of this study was to determine the cause of Mr Smith s chest pain and to consider the
consequences of this diagnosis for the patient. An enzyme linked immunosorbent assay (ELISA) was
performed to detect the presence of cardiac protein, cTnI, in the patient s serum at two time points: on
admission to hospital and 12 hours after. Approximately 22ng/ml of cTnI was detected in the serum
taken from Mr. Smith 12 hours after hospital admission, indicating the cause of Mr. Smith s chest pain
can be reasonably diagnosed as a result of a myocardial infraction.
Introduction:
...
The cause of Mr. Smith s chest pain can be reasonably concluded to be as a result of an myocardial
infraction, since serum results taken at T0 (no ... Show more content on Helpwriting.net ...
However, 22ng/ml was detected in the patient s serum at 12 hours after presentation to the hospital.
Thus it can be concluded that Mr Smith most likely had a myocardial infraction and the cause of Mr.
Smith s chest pain. These results supports the hypothesis suggesting that Mr. Smith s chest pain was
caused by a myocardial infraction, which detected by the release of a cardiac protein.
Bibliography
Melanson, S., Tanasijevic, M. Jarolim, P., 2007. Cardiac Troponin Assays. Circulation, Volume 116,
pp. 501 504.
Rahman, A. Broadley, S., 2014. Elevated troponin: Diagnostic gold or fool s gold?. Emergency
Medicine Australasia, 26(2), pp. 125 130.
Reichlin, T. et al., 2009. Early diagnosis of myocardial infarction with sensitive cardiac troponin
assays. The New England Journal of Medicine, 361(9), pp. 858 867.
Reichlin, T. et al., 2011. Utility of absolute and relative changes in cardiac Troponin concentrations in
the early diagnosis of acute myocardial. Circulation, 124(2), pp. 136 145.
Sharma, S., Jackson, P. Makan, J., 2004. Cardiac troponins. Clinical Pathology, 57(10), pp. 1025 1026.
Steg, P. et al., 2012. ESC Guidelines for the management of acute myocardial infarction in patients
presenting with ST segment elevation. European Heart Journal, 33(20), pp.

Walter Mitty Dream
In The Secret Life of Walter Mitty, Walter Mitty daydreams into fantastic fantasies as he faces the
harshness of reality. Walter is first seen as the Commander of a navy hydroplane through a hurricane.
However, the The Old Man ain t afraid of Hell (The) in the hurricane is afraid of his wife as she nags
him for speeding. Unnamed Mrs. Mitty continues to command her husband even insisting that he wear
gloves. Walter, upset, purposely takes off the gloves at a red light. As he stopped at the red light for
too long, a cop tells him to Pick it up, brother! (The). Mitty interestingly assumed the cop to be
referring to the gloves he took off instead of the car. Because of the authority figure of the cop, the
second daydream is triggered. Mitty ... Show more content on Helpwriting.net ...
Thurber had a troublesome marriage with Althea; Walter is constantly being controlled by Mrs. Mitty.
Because of Mrs. Mitty s nagging and imposing influence seen in paragraphs 3 and 4, Walter is
triggered into a daydream. As a world famous surgeon, he not only is in control of his life, but the life
of his patient. Mitty cleverly adapts to emergencies like using a fountain pen to fix the needed surgical
machinery (The). Every time he escapes, it is because of a trigger, often through an authority figure
imposing on him. In fact, it is the clear distinction between fantasy and reality that makes escaping a
theme. The heavy juxtaposition between diction of the dream world and real life is evident. For
example, in the second daydream as a surgeon, Dr. Mitty snapped at fellow doctors and nurses to give
him a fountain pen and uses fake yet complicated sounding medical terms such as Obstreosis of the
ductal tract (The). However, in the subsequent paragraph as Walter clumsily almost hits another car in
the parking lot in reality, he only muttered in response to the valet, unable to give a definitive reply.
The dramatic juxtaposition between Mitty s spectacular fantasies and mundane reality drives the story.
Thurber highlights Mitty s desperateness for action through the drastic differences in scenes. Also,
Thurber distinguishes daydreams by incorporating much more imperative voice and literary devices
compared to straight dialogue in the reality. Thurber literally makes the fantasies more alive and
interesting than boring reality. Onomatopoeia is seen in 3 of the 5 daydreams, ta pocketa pocketa... in
paragraph 1 for the hydroplane and the same sound for the surgical machine (The). Rat tat tatting in
paragraph 14 reflects the machine gun sounds Captain Mitty heard during war. By using
onomatopoeia,

Similarities Between Human And Human Information Processing
Topic: A comparison between human and computer on information processing
Do humans and computers really process information similarly? My essay was inspired when I read
how early psychologists and scientist used the newly invented computer to explain the complexity and
processes of the brain. This was the beginning of cognitive psychology. Before I compare the
differences and similarities between computer and humans on information processing, it is only
necessary to highlight the history of cognitive psychology and the information processing model.
Cognitive psychology is defined as, the scientific study of the mind as an information processor
(McLeod, 2015). Cognitive psychologist developed a cognitive model by focusing on processes such
as memory, attention, consciousness etc. To study human processes, cognitive psychologist mainly
used a nomothetic approach but instances where they conduct case studies they would adopt an
idiographic approach. The development of cognitive psychology was due to several reasons. firstly,
there was a dissatisfaction with the behaviorist simplistic explanation of behavior. Secondly, they
wanted to develop better experimental methods to investigate cognitive processes. Lastly, because of
the invention of computers, cognitive psychologists wanted to explore the similarities between
humans and computers processing of information.
It was the computer analogy that aided cognitive psychology in studying the complexity of the human
mind

Analysis Of Donatello s David Of The Same Boy
The story of the young shepherd boy named David, who defeated the warrior giant Goliath, with
nothing more than his slingshot has become a symbol of how man, or in this case a boy, can achieve
anything with faith and a great deal of will power. Here we compare two statues of the same boy, each
telling a different part of David s story. One depicts the boy moments after the battle and the other
depicts David during pivotal moment of his life. Although both statutes have many features in
common, there are many differences that would suggest Donatello s David was not only meant to be
the victorious David but also meant to be more than just a narrative piece like Bernini s David.
Standing at 5 2 Donatello s bronze sculpture, one of the first life size nude statutes to be created since
the classical period. Donatello depicts a young man (David) stepping on a man s head (goliath) and
confidently gazing down at the viewer. David leans on the sword in his right hand and holds a stone in
his left. His lax composure and the slight smile on his face would imply that the battle is done. Clean
shaven and with long, luscious hair, it is assumed that David is rather young, which makes his victory
over the giant even more remarkable. The viewer gets a sense of the how large Goliath the giant truly
was when they glance down at the bottom of the composition and realize, the giants head is nearly
twice the size of David s foot.
The sculpture incorporates a multitude of elements that would

Finland Research Paper
Finland is located in Northern Europe. It s shores border the Baltic Sea to the South and the Gulf of
Finland to the East (Culture). Geographically, Finland is positioned between Sweden and Russia.
Finland s coordinates are 61.9241 degrees North and 25.7482 degrees east. Finland s land topography
is made up of mostly rolling flat planes and thousands of lakes (Culture). In fact, there are over 60,000
lakes and nearly 1250 kilometers of coastline around Finland (Culture). Thanks to Finland s location,
it s climate is very cold and often considered sub arctic, making farming a formidable task. Finland s
average elevation is 538 feet, with the tallest peak being 4,075 feet and the lowest point being 0 feet
where it meets the Baltic Sea (Culture). ... Show more content on Helpwriting.net ...
The Whites were backed by Germany and the Reds were backed by the Russians (Lonely). The
Whites won the war and Friedrich Karl, Prince of Hessen, was elected King of Finland in 1918
(Lonely). After World War 1, Finland became a republic state and elected its first president, KJ
Stahlberg (Lonely). Around this time, Finnish territory began to expand. In the 1930 s, the Winter War
began after disputes with the Soviet Union. The Winter War, a war marked by extreme cold weather
and many deaths, which ended with the Finnish losing parts of its land to the Soviets

Rhonda s Lockout Analysis
Rhonda, A collective bargaining agreement is set in place to ensure that there is a level of equality
between player, owner, and league. The salary cap is not necessarily a limit as to what the player can
earn, it can be considered more of what the team can spend per year. A lockout such as the one that
occurred in the National Hockey League in 2013 can be detrimental at any level of sport or job type.
There are many aspects of a job that can be affected by a lockout can affect profits in sales, consumer
morale or enjoyment in the future, and employee morale. I do not believe that a union or
league/business owner desire to go into a lockout, however, when they cannot agree on the terms and
conditions of a new contract they are generally forced

A Midsummer Night s Dream Puck
One of the most fascinating characters in William Shakespeare s A Midsummer Night s Dream is
Puck, also known as Robin Goodfellow. In English and Celtic folklore, the word Pouk was a medieval
term for the devil: Robin Goodfellow was also a nickname for the devil. Although Puck shows
antagonistic qualities, many critics believe Puck to be the closest thing to a protagonist A Midsummer
Night s Dream has.
Puck is the only character that is directly involved in all of the action that takes place throughout the
play. Although the action doesn t affect Puck personally, without him, the events of the play wouldn t
take place. According to critic Ana Isabel Bordas del Prado, Puck is completely crucial to the play,
although he appears to be a kind ... Show more content on Helpwriting.net ...
Puck s interference with the Athenian citizen s relationships and the love flower emphasizes the the
difficulties of love, the power of magic, the nature of dreams[,] and the relationships between fantasy
and reality (Bordas del Prado). When Oberon sends Puck to mess with Titania, Puck makes her fall in
love with Nick Bottom, a member of the Athenian working class, after giving him the head of a
donkey. When Titania professes her newfound love for Bottom, he admits, Methinks, mistress, you
should have little reason for that: and to say the truth, reason and love keep little company together
nowadays (Shakespeare). Bottom sees how illogical Titania s interest in him is, but he goes along with
it anyways. Puck creates such a strange relationship out of thin air, between two people that have
absolutely nothing in common. The theme of love being completely unpredictable is evident between
these two, as well as it is between the four Athenian lovers. Though Puck stirs up trouble, he is a
benevolent spirit, and can easily convey the message of love to the audience. Many times in
Shakespeare s play, the main protagonist ends the show with a recap of events and a goodbye blessing.
At the end of the play, Puck closes the show with a positive narration, We will make amends ere long;
else the Puck a liar

Medieval Terminology
The Mentally ill were a quiet but present existence in Medieval society. The Mentally disabled were
treated with leniency in courts and law codes. This is due to a perceived lack of understanding
between right and wrong, and also that they are already punished enough by their illness. In this paper,
the reason and background of the Medieval origins of the insanity defense will be discussed.
Legal Terminology of Differentiating between insanity and mental retardation was important in
medieval law codes. Idiocy was different than insanity in that it was thought to be a defect present at
birth difference between idiota and non compos mentis, both of whom the king was responsible for,
the former being the mentally retarded and the latter being ... Show more content on Helpwriting.net
...
Madness was thought to possibly be caused by severe emotional reaction. Remission letters could be
written by these offenders to explain this. Jealousy, anger, and grief could all evoke powerful reactions
and criminal could use their inability to fulfill familial and household roles, guilt, and familial
conflicts as excuses. The evidence from letters of remission denotes that on several occasions a
recognizably mad person was imprisoned and the officers of justice in the locality refused to proceed
against him or her, encouraging the family and the village, to write to the king requesting remission.
Remission letters were a way to release a mad person from blame without having to circumvent the
normal legal apparatus. Remission letters made dealing with ambiguity of crimes committed by mad
people

Stereotypes In The Movie Brave
Disney Presents: A Brave Butch
In the Disney movie, Brave, the main character is a princess named Merida. You see from the
beginning that Merida enjoys archery, riding her horse, and doing many non girly things. It is
refreshing to see a princess in a movie that is not your typical girly girl. This can teach young girls that
they do not have to succumb to the type of behavior the rest of society makes them feel they should.
However, in other people s eyes, including her mother s, this is not how a proper princess should
behave. Merida should want to wear dresses, take a husband, and become a proper lady. This idea is
the one that most Disney movies give to young women. Ladies should be proper, extremely feminine,
and have a man to complete ... Show more content on Helpwriting.net ...
I love it. Here Merida is proving that even though she is a princess and it is her duty to marry, it is not
what she believes in and she will not stand for it. This is how these children s movies should be.
Women have the right to be free in all of their choices, and they do not need men to complete them.
Also, when she crushes her competition it is shows young women that they too can excel in activities
that are seen as manly.
At the end of the movie Merida s mother changed her mind about the marriage. It is decided that the
firstborns of the clans will marry when and who they choose, even though this goes against the normal
traditions. Merida is finally accepted as she is, and is allowed to just be herself.
In Stone Butch Blues, Jess realizes that the only way to be happy in this world is to be yourself. She
comes out as a butch and refers to herself as a he/she. She begins to speak out into the community
about her story and is fully accepted into the gay community. She finds herself and she finds peace.
Comparing these two stories, Jess and Merida were both different from the mold that they were
supposed to fit into to. Both of these characters fought for what they believed in and found happiness
in just being who they are. While Merida found love and acceptance with her family, Jess found that
same love and acceptance within a new family and

Comparing The Army Profession Of Arms, Its Culture, And Ethic
An Army White Paper: The Army Profession of Arms, Its Culture, and Ethic The overall objective of
the Army Profession of Arms campaign is for Soldiers and leaders to refine their understanding of
what it means to be professionals expert members of the Profession of Arms after nine years of war
and to recommit to a culture of service and the responsibilities and behaviors of our profession as
articulated in the Army Ethic. GEN Martin E. Dempsey, CG, TRADOC The preeminent military task,
and what separates [the military profession] from all other occupations, is that soldiers are routinely
prepared to kill...in addition to killing and preparing to kill, the soldier has two other principal
duties...some soldiers die and, when they are ... Show more content on Helpwriting.net ...
Since the Army s professionalization, there have been ebbs and flows in the degree to which the Army
has manifested the nature and motivations of a profession rather than its other organizational character
of government occupation highly professional in periods of expansion and later phases of war and less
so in periods of contraction after wars, e.g. post WWII into Korea and post Vietnam. Even after the
establishment of an all volunteer force in 1971 and the rebuilding of the Army NCO Corps post
Vietnam, these ebbs and flow have continued. The Army in Desert Shield Desert Storm was highly
professional; the Army after the next decade of build down and the exodus of captains and other
leaders and talent in the late 1990s was arguably much less so. A recent report suggests that the
operating forces of the Army, after nine years of war in the Middle East, exhibit more clearly the traits
and character of a profession, comparatively, to force generating side of the Army. So, as described
above as a producing organization, the Army really has a dual nature that of a government occupation
structured as a hierarchical bureaucracy and that of a vocational, specifically military, profession.
Section 1.1 Where will the balance be? The issue that faces the Army now, and will more so in the
transition period we are entering as we transition from Iraq to Afghanistan,

Raisin In The Sun Prejudice
A Raisin in the Sun
Introduction
The movie A Raisin in the Sun by Lorraine Hansberry is about an African American family who
receives an insurance check for $10,000 from Mr. Younger s life insurance policy. Each of the family
members are anticipating doing something different with the money; in the meantime mama has plans
to buy a house for the family. The Younger family faces economic hardships and racial discrimination
during their struggles to gain middle class acceptance. The movie A Raisin in the Sun demonstrates
the importance of family values, personal dreams, and racial discrimination. In the 1961 play, A Raisin
in the Sun, Lorraine Hansberry uses the Younger family to show individuals whom compete to reach
their dreams that are often disregarded by others however; they eventually learn to support one
another to achieve wealthier and more stable futures.
A Raisin in the Sun In Lorraine Hansberry s play, A Raisin in the Sun, the family in the ... Show more
content on Helpwriting.net ...
Bearak England explain that historically, women who graduate from college were more likely to
remain single than other women just as Beneatha was in the movie A Raisin in the Sun . However,
Beneatha s higher education allowed her to recognize the value of herself while opening her eyes to
discover her true pro black identity in a time of segregation. Beneatha faced the challenges that an
African American women with an education faced during these times. Beneatha dated without
cohabitating and out of her race to find an equal educated man. Beneatha often faced social
consequences such as being labeled a sell out and wanting to be white as Rockquemore Henderson
mention in the article Interracial Families in Post civil Rights Movement . Due to segregation
Beneatha s education fell second in

Hot Chocolate Cookies Essay
The name of the recipe I will be making is Mexican hot chocolate cookies. The reason I chose
Mexican hot chocolate cookies is I find this cookie super unique in taste and texture compared to other
cookies. It is fairly simple to make. I learned how to make these cookies with my mother. It was not
for a special occasion, we just wanted to try a new recipe. Our family often packages the cookies,
three per bag, to take to the military base and distribute to the security forces folks on duty. They
really appreciate being thought of. They often tease my mother saying it has been too long since she
brought them by. There are stories of people hiding them from their spouse or family members. The
recipe originally appeared on Martha Stewart s website. My mother made some changes to the recipe
along the way. It is best to gather all of the ingredients and equipment before you begin to prepare the
recipe. One important tip is to set the butter on the counter for twenty minutes before starting the
recipe. We learned quickly that the temperature of the butter plays a big role in how the cookies turn
out. Consequently, if the butter is too warm the cookies spread out while baking. We determined that
somewhere between twenty and thirty minutes is best. The equipment needed for this recipe is:
Equipment: parchment paper, a medium size bowl, a large bowl, a hand mixer or stand mixer, mixing
spoon, measuring spoons, sifter, spatula, cookie scoop, fork and two cookie sheets. The

Analysis Of The Book Night By Elie Wiesel
Elie Wiesel was born in 1928. In his book, Night, which was published in 1955, Wiesel depicts his
personal journey through the German concentration camps by the use of his character Eliezer
(Sparknotes). At the age of 15, he lives with his family in Sighet, Transylvania (Biography). His father
Shlomo is very involved with the community there. Eliezer is deeply engaged in religious studies,
being taught by Moshe, an older man in his community who is considered a lunatic by many
(Sparknotes). In 1941, Moshe is deported from Sighet. He later returns to tell of a great tragedy. His
train had been overtaken by Gestapo, and all but him where brutally executed. Because of Moshe s
nature, none of the Jews of Sighet believe the horror stories that he tells. Believing they are safe, the
Jews live in denial for a number of years, but eventually the Holocaust makes its way to Sighet
(Sparknotes). In 1945, the whole Jewish population of Sighet is deported to Auschwitz Birkenau. This
is one of the biggest and worst of the German concentration camps. It is here were Eliezer s mother
and sisters are killed in the gas chambers. He and his father are selected for the labor force (eNotes).
The work is very tough and Eliezer has to work very hard to take care of himself as well as his aging
father. As he witnesses the ongoing horrors of the camp he finds his heart turning cold. His faith in
God is lost after he witnesses the hanging of a young child which has connection to some prisoners

Analysis Of 2XU Outlet
What is 2XU? 2XU Outlet is a popular clothing brand in Australia, which provides a wide range of
men s and women s workout apparel. Their collection includes tri suits, wet suits, and compression
outfits. Customers can browse through the brand s products on the website not only by category, but
also by the type of sports they engage in such as running, triathlon, cycling, swimming, or just
exercising in the gym. Founded and based in Melbourne, Australia, the company s philosophy is to
create products that will advance human performance. 2XU employs state of the art fabric and
construction technology to take their products beyond what was previously thought possible. 2XU is
fast becoming the most technical performance sports brand on the planet

Mollie Goodnight Research Paper
Mollie Goodnight did all that she could throughout her whole life from taking care of her siblings
right after both of her parents deaths, to just teaching some of her husband s farm hands how to read.
Mollie tried to do her best even in the darkest of times, which is one of the reasons that she is one of
the best women Texas has ever had. Mollie was born on September 12,1839 in Madison County,
Tennessee to a loving mother and a fabulous father. Her father was the reason that they came to Texas
in the first place in 1845 near Fort Belknap in North Texas. Ten years after moving to Texas, Mollie s
mother died, her father following only two years later, leaving Mollie alone with her five younger
brothers. Mollie got a job as a schoolteacher to support her and her brothers. Later though, Mollie met
a greatly known cattle rancher named Charles Goodnight most known for being called the Father of
the Texas Panhandle . They both got married on July 26, 1870 and had no children throughout their
marriage. ... Show more content on Helpwriting.net ...
On the ranch, Mollie was able to accomplish a number of things, but most notably she started the
Goodnight buffalo herd by first only adopting a few orphan buffalo, but eventually the group grew
until she had an entire herd. Ms.Goodnight also started the Goodnight college, which was established
in 1898, besides the college in their name the Goodnight also has a town named after them in
Colorado. Later in Mollie and Charles life, their house became a tourist attraction for the occasional
passerby to pop in and look at their house as the years went on and the old western years started to
disappear. Mollie and Charles lived in their house for the entire 56 years that they were married until
Mollie started failing in health in the early 1920 s, eventually dying in in early April of

Latin American Art History
The history of Latin American art is far reaching from the period before colonization up to the present
time. As there is only limited space at the Museum of Fine Arts in Boston, this exhibition will only
cover a portion of Latin American art history in gallery 184. The theme of this exhibition will focus on
representations of indigenous figures from the fifteenth to the nineteenth century with the title Latin
American Art: The Representations of Indigenous Figures. The exhibition will include art from
Mexico, and address how indigenous figures were represented as common Indians, Indians from the
Conquest, and as noble Indians. In this essay, I am going to provide the layout of the exhibition, along
with curatorial texts and information about ... Show more content on Helpwriting.net ...
This painting was completed for the four hundredth anniversary of the Conquest and it was exhibited
originally in the Mexican pavilion for the World Colombian exhibition in Chicago in 1893. In being
showcased to the public, it was meant to have a dark representation of the already dark subject matter
of the Conquest. Izaguirre creates a heritage filled with political meaning for Mexico in this historical
painting of the Torture of Cuauhtemoc. Below is the specific text for Leandro Izaguirre s Torture of
Cuauhtemoc. The main figure in this painting is Cuauhtemoc, who was an heir to the meshika
emperor, and he is being tortured by Hernando Cortes. Cuauhtemoc represents the imperial, elite
Indian of the past by his portrayal as a noble emperor. The other Indian, meanwhile, represents the
current pathetic and barbaric Indian, as his face is scrunched up in pain. This romantic image is
enforced further through the power struggle of Cortez and Cuauhtemoc, as they are placed as equals
facing each

Internal Organizational Politics
Questions: 1. The typical U.S. employee works in an establishment with about 600 full time and 72
part time workers. It is also true that the median numbers for full and part time workers are 50 and 2.
Explain this apparent paradox.
2. Why are small companies important to our economy? What are the major problems faced by small
companies?
3. Give some examples of how organizations can affect the cities in which they are based.
4. How can internal organizational changes affect the social structure of the organization? How can
managers minimize the negative aspects of change in order to preserve the social structure?
5. Explain the differences between horizontal and vertical differentiation. Give examples to support
your ... Show more content on Helpwriting.net ...
Using this company as an example, highlight the dangers involved in undertaking change without
careful consideration of where change might lead.
39. Using Energizer Holdings as an example, why would a Command and Control management
structure hinder the transformation to a global business? Explain how information sharing boosted
productivity at Energizer. Include a graphic of Energizer Holdings in this essay.
40. Write 500 words or more in this essay. Go to
http://www.exxonmobil.com/Corporate/energy_o_view.aspx. Study their article The Outlook for
Energy: A view to 2030 . This company caused the Valdez oil spill in Prince William Sound, Alaska
(1989). After analyzing their report, write an essay on what Exxon wants to achieve in organizational
performance and change goals. Compare what you find here with what you know (or can learn about)
the Gulf of Mexico oil spill disaster related to British Petroleum (BP). Give your own comparisons
and

Antigone Research Paper
Throughout history justice has been seen as many things depending on your culture, and moral beliefs
among these include, reparations, atonement, vengeance. As humans when we have been disrespected,
we often seek one of these to fix the wrong doings. While some are more morally accepted such as
reparations, and atonement, others like vengeance have gained negative connotation. Sometimes this
vengeance come more in a form of karma in which the people who have been wrong seek to do the
same or worse to those who have disrespected them. This is the case in Sophocles play, Antigone and
the story plot for one of Criminal Minds episode, getting karma for disrespecting someone, or more
specifically a higher power. In today s society while not as extreme people often seek for ... Show
more content on Helpwriting.net ...
For example he portrayed justice as being a karma sort of framework, where if you did something bad
you would get something done in return. This is especially true in his play, Antigone in which after
two brothers fight for the crown both of them end up dead. The new king, Creon, only gives a proper
burial to one of the brothers. Antigone feels betrayed and goes back to retrieve her other brothers
body, but when the king finds out she did this he tries to kill her. He does end up pardoning her death
after an oracle warns him of his future but he still decides to lock her in tomb for her to starve herself.
As revenge Antigone hangs herself to not suffer a long death, and when her fiance, Creon s son, finds
this out he too kills himself, and when his mom finds this out she too kills herself as well. This turns
out being the gods version of justice to the king for disobeying the orders of not giving the brother
proper burial and killing Antigone orders. The kings ego led him to believe he was higher than the god
s rules and wants so the god s decide to take away the thing he loves most, his family as

Analysis Of The Awakening By Isaac Bennett
Enforcer for the Darkfall Mountain Pack, Isaac Bennett has always wanted tabby shifter Oren Frye.
Sexy, snarky and smart, Oren embodies all the qualities Isaac wants in a mate except Oren choose
Isaac s best friend. Isaac tried to do the decent thing. To forget, Isaac moves to a new town and pack,
but time only worsens the ache and longing. Ten years has passed, and Oren comes knocking on Isaac
s door, seeking sanctuary and carrying an urn of ashes. Isaac takes him and him and helps him get
back on his feet. Along the way, heat sizzles between Isaac and Oren, which culminates to them
becoming lovers. Just when Isaac thinks Oren is moving on, they fulfil the last request of Oren s
departed husband and drive out to the lake to scatter his ashes.

Reaction Paper On Phobias
One of the most common disorders suffering individuals in contemporary societies is the phobic
disorder. Etymologically, the word phobia is the English equivalent of the Greek word φοβία , which
means morbid, unreasonable, compulsive, and agonizing fear (Greek Language). The first noticed
occurrence of a phobia happened approximately in the fourth century B.C., and was made known to us
by Hippocrates, in his work The Seventh Book of Epidemics. However, the specific term phobia was
not used until half a century later, when it was incorporated by the Roman doctor, Celsus, in the word
hydrophobia. (The History of Phobias, 2012)The ancient origins of this word reveal that phobic
disorders were first established many centuries ago. In Psychology, ... Show more content on
Helpwriting.net ...
Brain Chemistry
This model attributes specific phobias to abnormalities in the areas of the brain that are related to fear
and anxiety. In particular, it is said that specific phobias stem from increased responsiveness to fearful
stimuli, of fear and stress associated areas of the brain, such as the sympathetic nervous system (SNS)
and the parasympathetic nervous system (PNS) (David Sue, 2013).
The SNS is responsible for triggering fear responses and preparing the human body to face threatening
situations. The amygdala and the hypothalamus of the brain belong to the SNS. The PNS is the system
which returns the body to its normal, relaxed state after exposure to the threat has ceased. More
specifically, once an individual comes into contact with a fearful stimulus, the amygdala is activated
and in turn activates the hypothalamus. The hypothalamus activates the rest of the SNS with the
objective of preparing the body to face the stimulus. A signal is sent by the hypothalamus to the
adrenal glands which release epinephrine in the bloodstream. The epinephrine brings upon
physiological changes , increasing the alertness of the brain and the energy levels of all body parts. If
the brain continues to perceive the stimulus as dangerous, the hypothalamus releases corticotropin
releasing hormone (CRH), which triggers the release of adrenocorticotropic hormone (ACTH). ACTH
prompts the adrenal glands to release cortisol, which aids the body in remaining alert. Once the
individual

How To Write A Summary Summary Writing, Essay Wr

Recommended

Recommended

More Related Content

Similar to How To Write A Summary Summary Writing, Essay Wr

Similar to How To Write A Summary Summary Writing, Essay Wr (20)

More from Sara Perez

More from Sara Perez (20)

Recently uploaded

Recently uploaded (20)

How To Write A Summary Summary Writing, Essay Wr