The GeneArt® Gene Synthesis service consists of chemical synthesis, cloning, and sequence verification of virtually any desired genetic sequence. You will receive a bacterial stab and/or purified plasmid containing your synthesized gene—ready for downstream applications.
Whether you have limited cloning experience or simply want to save time, the GeneArt® Gene Synthesis service helps you move your ideas from the planning stage to the laboratory more quickly. Benefit from our experience in successfully producing over 180,000 constructs for customers as diverse as large pharmaceutical companies, biotechnology start-ups, and basic research institutions. The comparison shown in the figure below highlights the time and effort saved compared to traditional cloning. For more information visit:
https://www.invitrogen.com/site/us/en/home/Products-and-Services/Applications/Cloning/gene-synthesis.html?CID=genesynthesis-SS-12312
Single strand conformation polymorphismNivethitha T
Single-strand conformation polymorphism (SSCP) is a technique that detects variations in single-stranded DNA sequences. It involves PCR amplification of a target region, denaturing the PCR products to generate single strands, and separating the single strands on a non-denaturing gel based on differences in electrophoretic mobility caused by variations in nucleotide sequence. This allows sequences to be distinguished and variants detected without sequencing. SSCP is useful for discovering new polymorphisms and detecting mutations for diagnostic applications.
What is PCR
Basic Requirements
Types of PCR
Asymmetric PCR
Applications of PCR
Advantages of PCR
Limitations of PCR
DNA Template
Primers
Taq polymerase
Deoxynucleoside
triphosphates(dNTPs)
Buffer solution
Divalent cations(eg.Mg2+ )
The document discusses polymerase chain reaction (PCR), including its history, principles, types, applications, and future. It was invented in 1984 as a way to amplify DNA fragments in the laboratory. PCR works by heating and cooling DNA to make millions of copies of a target sequence. It has many applications in medicine, infectious disease detection, forensics, and research. Quantitative PCR allows measuring DNA quantities and is commonly used to detect gene expression levels. The future of PCR includes more sensitive techniques like immunoliposome-PCR.
Protein arrays can be created using several methods, including robotic spotting, inkjet printing, and photolithography to array proteins onto a solid surface like a microscope slide. The proteins are immobilized using coatings like hydrophilic polymers or by chemical treatments with amines, aldehydes or epoxies. There are different types of protein arrays that can be created for various applications such as disease biomarker discovery or drug target identification.
Electroporation-A simple notable technique in our science field.Technique which is a magic of electric voltage.Technique that works on the mechanism of transient aqueous pore model.
Determination of protein concentration by Bradford method.pptxVijay Hemmadi
Bradford uses Coomasie Blue which is a dye that binds specifically to proteins. It is very accurate and sensitive, compatible with most buffers, sugars, and chaotropic agents but high concentrations of detergent interfere in the assay
Plasmid is a double stranded, circular extra chromosomal DNA of bacterium. It is used in recombinant DNA experiments to clone genes from other organisms and make large quantities of their DNA. Plasmid can be transferred between same species or between different species. Size of plasmids range from 1-1000 kilo base pairs. Plasmids are part of mobilomes (total of all mobile genetic elements in a genome) like transposons or prophages and are associated with conjugation. Even the largest plasmids are considerably smaller than the chromosomal DNA of the bacterium, which can contain several million base pairs.
Explanation on the industrial production of penicillin covering the history, fermentors, specific conditions required for penicillin production, how to increase yield amongst others.
Single strand conformation polymorphismNivethitha T
Single-strand conformation polymorphism (SSCP) is a technique that detects variations in single-stranded DNA sequences. It involves PCR amplification of a target region, denaturing the PCR products to generate single strands, and separating the single strands on a non-denaturing gel based on differences in electrophoretic mobility caused by variations in nucleotide sequence. This allows sequences to be distinguished and variants detected without sequencing. SSCP is useful for discovering new polymorphisms and detecting mutations for diagnostic applications.
What is PCR
Basic Requirements
Types of PCR
Asymmetric PCR
Applications of PCR
Advantages of PCR
Limitations of PCR
DNA Template
Primers
Taq polymerase
Deoxynucleoside
triphosphates(dNTPs)
Buffer solution
Divalent cations(eg.Mg2+ )
The document discusses polymerase chain reaction (PCR), including its history, principles, types, applications, and future. It was invented in 1984 as a way to amplify DNA fragments in the laboratory. PCR works by heating and cooling DNA to make millions of copies of a target sequence. It has many applications in medicine, infectious disease detection, forensics, and research. Quantitative PCR allows measuring DNA quantities and is commonly used to detect gene expression levels. The future of PCR includes more sensitive techniques like immunoliposome-PCR.
Protein arrays can be created using several methods, including robotic spotting, inkjet printing, and photolithography to array proteins onto a solid surface like a microscope slide. The proteins are immobilized using coatings like hydrophilic polymers or by chemical treatments with amines, aldehydes or epoxies. There are different types of protein arrays that can be created for various applications such as disease biomarker discovery or drug target identification.
Electroporation-A simple notable technique in our science field.Technique which is a magic of electric voltage.Technique that works on the mechanism of transient aqueous pore model.
Determination of protein concentration by Bradford method.pptxVijay Hemmadi
Bradford uses Coomasie Blue which is a dye that binds specifically to proteins. It is very accurate and sensitive, compatible with most buffers, sugars, and chaotropic agents but high concentrations of detergent interfere in the assay
Plasmid is a double stranded, circular extra chromosomal DNA of bacterium. It is used in recombinant DNA experiments to clone genes from other organisms and make large quantities of their DNA. Plasmid can be transferred between same species or between different species. Size of plasmids range from 1-1000 kilo base pairs. Plasmids are part of mobilomes (total of all mobile genetic elements in a genome) like transposons or prophages and are associated with conjugation. Even the largest plasmids are considerably smaller than the chromosomal DNA of the bacterium, which can contain several million base pairs.
Explanation on the industrial production of penicillin covering the history, fermentors, specific conditions required for penicillin production, how to increase yield amongst others.
PCR (polymerase chain reaction) is a technique used to amplify specific DNA sequences. It involves repeated cycles of heating and cooling of the DNA sample to separate and copy the DNA strands. There are several types of PCR including nested PCR, which increases sensitivity by using two rounds of amplification, and multiplex PCR, which allows simultaneous amplification of multiple DNA sequences. PCR and its variations have widespread applications in medicine, forensics, agriculture, and research by enabling identification of organisms, understanding disease pathology, and selective isolation of DNA fragments.
This document provides an introduction to genomics and proteomics. It outlines key topics including the tree of life, genes, and genomics definitions. The tree of life section distinguishes between prokaryotic and eukaryotic genomes, noting that prokaryotes like bacteria contain single circular DNA molecules while eukaryotes have more complex genomes. The document also compares genome sizes across various species and describes genes and exons and introns in eukaryotes. It discusses identifying genes in genomes through similarity to known genes or ab initio methods examining DNA sequence properties.
This document discusses cloning vectors, which are DNA molecules used to transport cloned DNA sequences between biological hosts. It defines a cloning vector as a small piece of DNA from a virus, plasmid, or cell that can maintain foreign DNA for cloning. The summary describes the key features of cloning vectors, including an origin of replication, cloning site, selectable marker, and optional reporter gene. It also lists common vector types like plasmids, bacteriophages, cosmids, and artificial chromosomes, and factors that determine the choice of vector, such as insert size.
Human growth hormone can be produced using recombinant DNA technology by inserting the gene for human growth hormone into microbial hosts like E. coli. This allows for large-scale production of the hormone which can then be purified and used as a treatment for growth disorders in children and adults. The conventional method of extracting growth hormone from human cadavers was inefficient. Recombinant technology overcame this by allowing microbial production of the hormone in pure form without relying on human sources.
This document discusses recombinant protein expression in different host cell systems. It begins by outlining strategies for engineering host cells to efficiently produce proteins, including optimizing transcription, translation, and protein stability. It then compares various host cell expression systems, such as bacteria, yeast, insect and mammalian cells, considering factors like post-translational modification abilities and production costs. Specific systems are covered in more detail, like using the pET and pBAD vectors to control protein expression in bacteria. The document concludes by discussing eukaryotic cell expression and challenges producing complex eukaryotic proteins in prokaryotic systems due to lack of post-translational modifications.
Colony hybridization is a technique to identify bacterial colonies containing a specific DNA sequence or gene of interest. It involves transferring DNA from bacterial colonies onto a membrane, then probing the membrane with a complementary DNA or RNA sequence. Only colonies with matching DNA sequences will hybridize with the probe. The oligonucleotide ligation assay (OLA) is a technique used to detect mutations by hybridizing PCR primers and ligating adjacent probes only when the target sequence is present. It has advantages of being rapid, easy, and high-throughput but requires an automated sequencer.
The document discusses nested PCR, which is a modification of polymerase chain reaction (PCR) that improves specificity. It involves two rounds of PCR where the product of the first reaction is used as a template for the second reaction with a nested primer set. This increases specificity by reducing non-specific binding. Some key advantages are improved accuracy and sensitivity for low abundance targets or difficult templates. However, it is more time-consuming and costly than standard PCR due to the extra reagents and steps required. Nested PCR has applications in microbial detection, genetic analysis, and other areas where high specificity is needed.
This document summarizes the process of colony hybridization. Colony hybridization allows researchers to select bacterial colonies containing specific genes. The procedure involves lysing bacterial colonies on a nitrocellulose filter, denaturing the DNA, and hybridizing the DNA to a labeled probe for the target gene. Unbound probe is then washed away. Where the probe binds to colonies containing the target gene, dark spots will appear on an x-ray film placed over the filter, allowing identification of recombinant colonies containing the desired gene. Colony hybridization has applications in identifying recombinant bacteria, cytogenetics studies, disease diagnosis, fingerprinting, and screening bacterial colonies.
RT-PCR is a technique that uses reverse transcription to transcribe RNA into cDNA, which is then amplified using PCR. It allows for the detection and quantification of RNA. There are two main types: one-step RT-PCR, which performs reverse transcription and PCR in a single step, and two-step RT-PCR, which performs them as separate steps. RT-PCR is widely used in research, disease diagnosis, and detection of gene expression levels.
PCR and its variants document discusses various polymerase chain reaction techniques. It begins by describing standard PCR and its components. It then summarizes several common PCR variants including nested PCR, which uses two sets of primers for increased sensitivity; multiplex PCR, which amplifies multiple targets simultaneously; and touchdown PCR, which starts with a high annealing temperature and decreases it in subsequent cycles to improve specificity. The document also discusses other techniques such as real-time PCR, hot start PCR, and COLD PCR which can preferentially amplify minority alleles to detect mutations.
This document provides protocols for making competent E. coli BL-21 cells using either electrotransformation or chemical transformation methods. The electrotransformation method involves growing BL-21 cells overnight, subculturing to an OD of 0.3-0.5, washing the cells in ice cold water several times to make them electrocompetent, and storing them in glycerol at -80°C. The chemical transformation method involves growing and subculturing BL-21 cells, incubating them in ice cold 0.1M CaCl2 for 30 minutes to make them chemically competent, and storing 50μl aliquots in 15% glycerol at -80°C. Both methods aim to make BL-21 cells competent
This document describes Bradford's method for determining the concentration of protein in a serum sample. The method uses Coomassie Brilliant Blue G-250 dye, which binds to protein and shifts its absorption maximum from 465nm to 595nm, allowing for colorimetric quantification. Various volumes of a bovine serum albumin protein standard solution are mixed with dye to generate a standard curve. Unknown serum sample volumes are also mixed with dye and measured at 595nm to determine protein concentration based on the standard curve. The method involves preparing stock and working solutions of dye and protein standard.
This document discusses techniques for strain improvement in microbiology. It describes the ideal characteristics of microbial strains, the purpose of strain improvement, and three main approaches: mutant selection through chemical or radiation mutagenesis, recombination through techniques like transformation and conjugation, and recombinant DNA technology. Novel technologies discussed include metabolic engineering and genome shuffling. Applications include production of medicines, enzymes, and other products.
Emulsion PCR is a technique used in next-generation sequencing to amplify DNA sequences attached to beads. It involves compartmentalizing DNA fragments with primer-coated beads into water-in-oil emulsion droplets, with each droplet containing one fragment. The droplets then act as individual PCR reactors to amplify each fragment clonally onto a single bead. After thermal cycling, millions of copies of the DNA fragment are attached to each bead for downstream sequencing applications.
Nested PCR is a modification of conventional PCR that uses two sets of primers to improve sensitivity and specificity. It involves two rounds of amplification, where the first round uses outer primers that bind outside the target DNA to amplify a larger fragment. The second round uses inner primers that bind within the first amplified fragment to specifically amplify the target DNA. This blocks non-specific amplification. Nested PCR allows for the accurate detection of pathogens or genes present at low levels. While more sensitive and specific than conventional PCR, it is also more time-consuming and prone to contamination due to the use of two primer sets.
PCR is a technique which is used to amplify the number of copies of a specific region of DNA, in order to produce enough DNA to be adequately tested.
Cell-free amplification for synthesizing multiple identical copies (billions) of any DNA of interest.
Basic tool for the molecular biologist.
The purpose of a PCR is to make a huge number of copies of a gene. As a result, it now becomes possible to analyze and characterize DNA fragments found in minute quantities in places like a drop of blood at a crime scene or a cell from an extinct dinosaur.
Like Xerox machine for gene copying.
This document discusses several types of PCR techniques and their applications. It begins by explaining standard PCR and its development. It then describes several specialized PCR techniques including allele-specific PCR, asymmetric PCR, assembly PCR, hot-start PCR, helicase-dependent amplification, in situ PCR, inverse PCR, ligation-mediated PCR, and multiplex ligation-dependent probe amplification. Each technique is explained and examples of its uses and applications are provided.
Selection and screening of recombinant clones neeru02
This document discusses several methods for selecting recombinant clones after introducing recombinant DNA into host cells:
- Direct selection involves using a gene from the inserted DNA that confers antibiotic resistance to select clones that grow on media containing that antibiotic.
- Insertional inactivation selection works by inactivating a host gene when foreign DNA inserts into it, allowing selection of recombinants.
- Blue-white screening uses a vector with a disrupted lacZ gene; foreign DNA insertion repairs the gene, allowing recombinants to be identified by colony color.
- Colony hybridization detects recombinants by transferring colonies to a membrane and probing for the inserted DNA sequence.
- Immunological tests identify clones expressing antigens encoded by the
This document describes RT-PCR (reverse transcription polymerase chain reaction). It discusses that RT-PCR is used to detect RNA expression by converting RNA to cDNA using reverse transcriptase, then amplifying the cDNA using PCR. It provides details on the history and development of RT-PCR, including the discovery of reverse transcriptase. It also explains the basic procedures for one-step and two-step RT-PCR and compares the two methods.
Multiplex PCR is a technique whereby PCR is used to amplify several different DNA sequences simultaneously. It is a type of target enrichment approach. It was first described in 1988 as a method to detect deletion mutations in the dystrophin gene – the largest known human gene
DNA Markers Techniques for Plant Varietal Identification Senthil Natesan
This document discusses DNA marker techniques for plant varietal identification. It provides background information on the importance of identifying crop varieties at different stages of seed production. While morphological traits can identify varieties, they are influenced by the environment and require a full growing season. The document then discusses various molecular marker techniques like RFLP, PCR, AFLP, SSR, and ISSR that can help with rapid and reliable varietal identification. It also covers the relative importance of markers, the skills and costs required for molecular marker analysis, and considerations for selecting the appropriate marker type.
The document discusses reference materials and benchmarking efforts for genome sequencing by the Genome in a Bottle Consortium. Key points:
- The Consortium develops and characterizes human and microbial reference materials to evaluate genome sequencing performance. Materials include various human genomes and microbial strains.
- Genomes are extensively characterized using multiple sequencing technologies to generate "gold standard" calls for variants. Characterizations are regularly updated as technologies advance.
- Benchmarking tools and standards are being developed through the Global Alliance for Genomics and Health to allow standardized performance comparisons. Challenges include interpreting metrics, as true accuracy is hard to estimate, especially in difficult genomic regions.
- While small variant calling benchmarking is established, structural variant benchmarking
PCR (polymerase chain reaction) is a technique used to amplify specific DNA sequences. It involves repeated cycles of heating and cooling of the DNA sample to separate and copy the DNA strands. There are several types of PCR including nested PCR, which increases sensitivity by using two rounds of amplification, and multiplex PCR, which allows simultaneous amplification of multiple DNA sequences. PCR and its variations have widespread applications in medicine, forensics, agriculture, and research by enabling identification of organisms, understanding disease pathology, and selective isolation of DNA fragments.
This document provides an introduction to genomics and proteomics. It outlines key topics including the tree of life, genes, and genomics definitions. The tree of life section distinguishes between prokaryotic and eukaryotic genomes, noting that prokaryotes like bacteria contain single circular DNA molecules while eukaryotes have more complex genomes. The document also compares genome sizes across various species and describes genes and exons and introns in eukaryotes. It discusses identifying genes in genomes through similarity to known genes or ab initio methods examining DNA sequence properties.
This document discusses cloning vectors, which are DNA molecules used to transport cloned DNA sequences between biological hosts. It defines a cloning vector as a small piece of DNA from a virus, plasmid, or cell that can maintain foreign DNA for cloning. The summary describes the key features of cloning vectors, including an origin of replication, cloning site, selectable marker, and optional reporter gene. It also lists common vector types like plasmids, bacteriophages, cosmids, and artificial chromosomes, and factors that determine the choice of vector, such as insert size.
Human growth hormone can be produced using recombinant DNA technology by inserting the gene for human growth hormone into microbial hosts like E. coli. This allows for large-scale production of the hormone which can then be purified and used as a treatment for growth disorders in children and adults. The conventional method of extracting growth hormone from human cadavers was inefficient. Recombinant technology overcame this by allowing microbial production of the hormone in pure form without relying on human sources.
This document discusses recombinant protein expression in different host cell systems. It begins by outlining strategies for engineering host cells to efficiently produce proteins, including optimizing transcription, translation, and protein stability. It then compares various host cell expression systems, such as bacteria, yeast, insect and mammalian cells, considering factors like post-translational modification abilities and production costs. Specific systems are covered in more detail, like using the pET and pBAD vectors to control protein expression in bacteria. The document concludes by discussing eukaryotic cell expression and challenges producing complex eukaryotic proteins in prokaryotic systems due to lack of post-translational modifications.
Colony hybridization is a technique to identify bacterial colonies containing a specific DNA sequence or gene of interest. It involves transferring DNA from bacterial colonies onto a membrane, then probing the membrane with a complementary DNA or RNA sequence. Only colonies with matching DNA sequences will hybridize with the probe. The oligonucleotide ligation assay (OLA) is a technique used to detect mutations by hybridizing PCR primers and ligating adjacent probes only when the target sequence is present. It has advantages of being rapid, easy, and high-throughput but requires an automated sequencer.
The document discusses nested PCR, which is a modification of polymerase chain reaction (PCR) that improves specificity. It involves two rounds of PCR where the product of the first reaction is used as a template for the second reaction with a nested primer set. This increases specificity by reducing non-specific binding. Some key advantages are improved accuracy and sensitivity for low abundance targets or difficult templates. However, it is more time-consuming and costly than standard PCR due to the extra reagents and steps required. Nested PCR has applications in microbial detection, genetic analysis, and other areas where high specificity is needed.
This document summarizes the process of colony hybridization. Colony hybridization allows researchers to select bacterial colonies containing specific genes. The procedure involves lysing bacterial colonies on a nitrocellulose filter, denaturing the DNA, and hybridizing the DNA to a labeled probe for the target gene. Unbound probe is then washed away. Where the probe binds to colonies containing the target gene, dark spots will appear on an x-ray film placed over the filter, allowing identification of recombinant colonies containing the desired gene. Colony hybridization has applications in identifying recombinant bacteria, cytogenetics studies, disease diagnosis, fingerprinting, and screening bacterial colonies.
RT-PCR is a technique that uses reverse transcription to transcribe RNA into cDNA, which is then amplified using PCR. It allows for the detection and quantification of RNA. There are two main types: one-step RT-PCR, which performs reverse transcription and PCR in a single step, and two-step RT-PCR, which performs them as separate steps. RT-PCR is widely used in research, disease diagnosis, and detection of gene expression levels.
PCR and its variants document discusses various polymerase chain reaction techniques. It begins by describing standard PCR and its components. It then summarizes several common PCR variants including nested PCR, which uses two sets of primers for increased sensitivity; multiplex PCR, which amplifies multiple targets simultaneously; and touchdown PCR, which starts with a high annealing temperature and decreases it in subsequent cycles to improve specificity. The document also discusses other techniques such as real-time PCR, hot start PCR, and COLD PCR which can preferentially amplify minority alleles to detect mutations.
This document provides protocols for making competent E. coli BL-21 cells using either electrotransformation or chemical transformation methods. The electrotransformation method involves growing BL-21 cells overnight, subculturing to an OD of 0.3-0.5, washing the cells in ice cold water several times to make them electrocompetent, and storing them in glycerol at -80°C. The chemical transformation method involves growing and subculturing BL-21 cells, incubating them in ice cold 0.1M CaCl2 for 30 minutes to make them chemically competent, and storing 50μl aliquots in 15% glycerol at -80°C. Both methods aim to make BL-21 cells competent
This document describes Bradford's method for determining the concentration of protein in a serum sample. The method uses Coomassie Brilliant Blue G-250 dye, which binds to protein and shifts its absorption maximum from 465nm to 595nm, allowing for colorimetric quantification. Various volumes of a bovine serum albumin protein standard solution are mixed with dye to generate a standard curve. Unknown serum sample volumes are also mixed with dye and measured at 595nm to determine protein concentration based on the standard curve. The method involves preparing stock and working solutions of dye and protein standard.
This document discusses techniques for strain improvement in microbiology. It describes the ideal characteristics of microbial strains, the purpose of strain improvement, and three main approaches: mutant selection through chemical or radiation mutagenesis, recombination through techniques like transformation and conjugation, and recombinant DNA technology. Novel technologies discussed include metabolic engineering and genome shuffling. Applications include production of medicines, enzymes, and other products.
Emulsion PCR is a technique used in next-generation sequencing to amplify DNA sequences attached to beads. It involves compartmentalizing DNA fragments with primer-coated beads into water-in-oil emulsion droplets, with each droplet containing one fragment. The droplets then act as individual PCR reactors to amplify each fragment clonally onto a single bead. After thermal cycling, millions of copies of the DNA fragment are attached to each bead for downstream sequencing applications.
Nested PCR is a modification of conventional PCR that uses two sets of primers to improve sensitivity and specificity. It involves two rounds of amplification, where the first round uses outer primers that bind outside the target DNA to amplify a larger fragment. The second round uses inner primers that bind within the first amplified fragment to specifically amplify the target DNA. This blocks non-specific amplification. Nested PCR allows for the accurate detection of pathogens or genes present at low levels. While more sensitive and specific than conventional PCR, it is also more time-consuming and prone to contamination due to the use of two primer sets.
PCR is a technique which is used to amplify the number of copies of a specific region of DNA, in order to produce enough DNA to be adequately tested.
Cell-free amplification for synthesizing multiple identical copies (billions) of any DNA of interest.
Basic tool for the molecular biologist.
The purpose of a PCR is to make a huge number of copies of a gene. As a result, it now becomes possible to analyze and characterize DNA fragments found in minute quantities in places like a drop of blood at a crime scene or a cell from an extinct dinosaur.
Like Xerox machine for gene copying.
This document discusses several types of PCR techniques and their applications. It begins by explaining standard PCR and its development. It then describes several specialized PCR techniques including allele-specific PCR, asymmetric PCR, assembly PCR, hot-start PCR, helicase-dependent amplification, in situ PCR, inverse PCR, ligation-mediated PCR, and multiplex ligation-dependent probe amplification. Each technique is explained and examples of its uses and applications are provided.
Selection and screening of recombinant clones neeru02
This document discusses several methods for selecting recombinant clones after introducing recombinant DNA into host cells:
- Direct selection involves using a gene from the inserted DNA that confers antibiotic resistance to select clones that grow on media containing that antibiotic.
- Insertional inactivation selection works by inactivating a host gene when foreign DNA inserts into it, allowing selection of recombinants.
- Blue-white screening uses a vector with a disrupted lacZ gene; foreign DNA insertion repairs the gene, allowing recombinants to be identified by colony color.
- Colony hybridization detects recombinants by transferring colonies to a membrane and probing for the inserted DNA sequence.
- Immunological tests identify clones expressing antigens encoded by the
This document describes RT-PCR (reverse transcription polymerase chain reaction). It discusses that RT-PCR is used to detect RNA expression by converting RNA to cDNA using reverse transcriptase, then amplifying the cDNA using PCR. It provides details on the history and development of RT-PCR, including the discovery of reverse transcriptase. It also explains the basic procedures for one-step and two-step RT-PCR and compares the two methods.
Multiplex PCR is a technique whereby PCR is used to amplify several different DNA sequences simultaneously. It is a type of target enrichment approach. It was first described in 1988 as a method to detect deletion mutations in the dystrophin gene – the largest known human gene
DNA Markers Techniques for Plant Varietal Identification Senthil Natesan
This document discusses DNA marker techniques for plant varietal identification. It provides background information on the importance of identifying crop varieties at different stages of seed production. While morphological traits can identify varieties, they are influenced by the environment and require a full growing season. The document then discusses various molecular marker techniques like RFLP, PCR, AFLP, SSR, and ISSR that can help with rapid and reliable varietal identification. It also covers the relative importance of markers, the skills and costs required for molecular marker analysis, and considerations for selecting the appropriate marker type.
The document discusses reference materials and benchmarking efforts for genome sequencing by the Genome in a Bottle Consortium. Key points:
- The Consortium develops and characterizes human and microbial reference materials to evaluate genome sequencing performance. Materials include various human genomes and microbial strains.
- Genomes are extensively characterized using multiple sequencing technologies to generate "gold standard" calls for variants. Characterizations are regularly updated as technologies advance.
- Benchmarking tools and standards are being developed through the Global Alliance for Genomics and Health to allow standardized performance comparisons. Challenges include interpreting metrics, as true accuracy is hard to estimate, especially in difficult genomic regions.
- While small variant calling benchmarking is established, structural variant benchmarking
This document discusses reference materials and datasets developed by the Genome in a Bottle Consortium to benchmark genome sequencing and analysis methods. Key points:
- The Consortium has developed reference materials including human and microbial genomic DNA samples that have been extensively characterized to provide "gold standard" calls used for benchmarking.
- They have released datasets including whole genome, exome, and long-read sequencing data for several personal genomes, including PGP trios, that can be used to benchmark variant calling and other analysis methods.
- An iterative process is used to integrate calls from different methods and datasets to establish high-confidence benchmark calls, filtering out variants with characteristics of bias. The benchmark calls are periodically updated as new data becomes available
The Genome in a Bottle (GIAB) project provides reference materials and benchmarks for validating genome sequencing and variant calling. It has characterized variants in five human genomes, including common and difficult variants. While it currently enables benchmarking of easier variants, GIAB is working to characterize more difficult variants and regions. Many challenges remain in benchmarking structural variants and regions with lower confidence, and collaborations are welcome to help address these challenges.
This document discusses the Genome in a Bottle Consortium's efforts to develop reference materials and data to evaluate whole genome sequencing performance. It summarizes the release of new reference materials, including additional Genome in a Bottle samples from the Personal Genome Project and microbial genomic DNA standards. The consortium aims to apply principles of metrology to genome analysis by generating extensively characterized reference genomes and associated data that can be used to develop and validate analysis methods.
The document discusses the Genome in a Bottle Consortium's efforts to develop reference materials, data, methods, and performance metrics for evaluating whole genome sequencing and variant calling. It provides details on newly released reference materials, including additional Genome in a Bottle reference genomes from the Personal Genome Project consisting of an Ashkenazi Jewish trio and their Asian son. The materials are extensively characterized and are intended to help validate and improve sequencing and analysis methods.
Multi-scale network biology model & the model librarylaserxiong
This document discusses multi-scale network biology models and a network model library. It describes how the library would contain different types of nodes and edges to represent diverse biological interactions. The library would annotate pre-defined network models and integrate updated models. It also discusses multi-scale networks from the inter-cellular to inter-tissue levels. A case study on prioritizing pre-clinical drugs via prognosis-guided genetic interaction networks is mentioned. The document notes challenges in current disease models for drug development and proposes approaches like synergistic outcome determination and module-module cooperation networks to address them.
The document summarizes a presentation about developing open access tools to maximize the value of genomic data through the Genome Commons. The Genome Commons Database will be a repository of variants and associated traits. The Genome Commons Navigator will integrate this data and external tools to facilitate basic research, clinical applications, and more. Participation in the Critical Assessment of Genome Interpretation initiative aims to improve predictions of variant impacts on molecular, cellular and organismal phenotypes. Analysis of variants in folate pathway genes found classes of effects on yeast growth and folate remediation.
This document discusses protein microarrays and their development and applications. It describes some key differences between protein and DNA microarrays, such as the challenges of amplifying and predicting protein activity and interactions due to their 3D structures. Various methods for capturing proteins on chips are presented, including different oriented immobilization techniques. Applications of protein microarrays include analyzing protein interactions, screening for drug targets, and developing techniques like self-assembly and covalent mRNA-protein fusion protein microarrays. Detection methods like fluorescence, enzymatic reactions, and mass spectrometry are also summarized.
Genome in a Bottle - Towards new benchmarks for the “dark matter” of the huma...GenomeInABottle
The document discusses Genome in a Bottle (GIAB) and its efforts to characterize human genomes and provide reference materials and benchmarks to evaluate genome sequencing and variant calling. Specifically, it summarizes how GIAB has characterized 7 human genomes, provides extensive public sequencing data for benchmarking, and is now using linked and long reads to expand the small variant benchmark set, develop a structural variant benchmark, and perform diploid assembly of difficult regions. It also shows how new benchmarks that include more difficult regions have revealed errors in previous benchmarks and reduced performance metrics for variant calling tools.
Please note: This presentation accompanies a recorded webinar at:
https://www1.gotomeeting.com/register/347794241
Biomarkers for studying gene regulation and cell function can be efficiently analyzed by multiplexed methods. Dr. Jim Lazar from OriGene Technologies will provide an overview of four different but related detection technologies that can be used to analyze genetic variants, microRNA expression, transcription factor binding, and protein expression on the Luminex xMAP platform. OriGene’s broad panel of assays and tools for discovery, analysis and validation of multiple classes of important biomarkers will allow researcher to develop more accurate descriptions of biologically complex systems.
Sequencing the transcriptome reveals complex layers of regulation, Department...Copenhagenomics
This document summarizes a study that analyzed gene expression and regulation in adipose tissue from obese and non-obese individuals. MicroRNA expression was found to be different between the two groups, with many miRNAs downregulated in obesity. One miRNA in particular, miR-193b, was shown to regulate secretion of the inflammatory factor CCL2. Motif activity response analysis identified transcription factors with significantly different activity between obese and non-obese individuals. Together, the results provide new insights into the perturbed transcriptional regulation of adipogenesis and inflammation in human obesity.
Apollo is a web-based application that supports and enables collaborative genome curation in real time, allowing teams of curators to improve on existing automated gene models through an intuitive interface. Apollo allows researchers to break down large amounts of data into manageable portions to mobilize groups of researchers with shared interests.
The i5K, an initiative to sequence the genomes of 5,000 insect and related arthropod species, is a broad and inclusive effort that seeks to involve scientists from around the world in their genome curation process, and Apollo is serving as the platform to empower this community.
This presentation is an introduction to Apollo for the members of the i5K Pilot Project working on species of the order Hemiptera.
The document provides information about various bioinformatics tools for DNA sequence analysis. It describes tools for finding protein coding regions like GeneMark and GENSCAN. It discusses tools for predicting promoters like SoftBerry Promoter and Promoter 2.0. It outlines how Tandem Repeat Finder can detect tandem repeats and how RepeatMasker can mask interspersed repeats in a sequence. It also discusses UTRScan for finding UTR locations and CpG Islands for detecting CpG islands. For each tool, it provides the procedure and interpretation of sample results.
Fruit breedomics workshop wp6 from marker assisted breeding to genomics assis...fruitbreedomics
The document discusses strategies for genotyping using single nucleotide polymorphisms (SNPs). It describes different types of molecular markers that have been used over time, including restriction fragment length polymorphisms (RFLPs), random amplified polymorphic DNA (RAPDs), simple sequence repeats (SSRs), amplified fragment length polymorphisms (AFLPs) and SNPs. It also provides details on different SNP genotyping techniques ranging from low to high throughput, such as gel electrophoresis, fluorescent PCR, mass spectrometry and various array-based methods. The document outlines the process of developing a high density 480K SNP array for apple, including SNP discovery by resequencing accessions and filtering SNPs for the array design.
Using accurate long reads to improve Genome in a Bottle Benchmarks 220923GenomeInABottle
Using accurate long reads to improve Genome in a Bottle Benchmarks
The Genome in a Bottle Consortium has used accurate long reads to characterize variants in difficult genomic regions for 7 human genomes. Long and linked reads improved the small variant benchmark by expanding reference coverage and the number of called variants. Accurate long reads were also essential for generating benchmarks for medically relevant genes and for improving benchmarks on chromosomes X and Y. Ongoing work includes developing RNA sequencing benchmarks from long reads and generating the first tumor/normal cell line benchmark.
This document provides information about TaqMan Gene Expression Assay products from Applied Biosystems. It offers pre-designed probe and primer sets (TaqMan Gene Expression Assays) for quantifying gene expression in common model organisms like human, mouse, rat, Arabidopsis, and Drosophila. It also describes options for custom assays with user-designed sequences. The assays use TaqMan chemistry and real-time PCR for sensitive and reproducible gene expression analysis.
EG-CompBio presentation about Artificial Intelligence in Bioinformatics covering:
-AI (Types, Development)
-Deep Learning (Architecture)
-Bioinformatics Fields
-Input formats for AI
-AI Challenges in Biology
-Example: (Proteomics, Transcriptomics)
-Metagenomics: @ NU
-Taxonomic Classification
-Phenotype Classification
-How to begin in AI in Bioinformatics
This document summarizes a presentation given by Dr. Jo Vandesompele on state-of-the-art normalization of RT-qPCR data. It discusses the importance of normalization to remove experimental variation and introduces the geNorm algorithm for determining the optimal number and combination of reference genes for normalization. GeNorm has become the standard method for reference gene validation and normalization and has improved qPCR data analysis. The document also proposes a novel global mean normalization strategy for large-scale gene expression studies.
Hot-start DNA polymerases are commonly used in PCR for genotyping, sequencing, molecular diagnostics, and high-throughput applications. In this presentation, PCR performance of Invitrogen™ Platinum II Taq Hot-Start DNA Polymerase and Invitrogen™ AccuPrime Taq DNA Polymerase is compared in the following areas:
• PCR run time for targets of different lengths
• Amplification of AT-rich and GC-rich sequences
• Tolerance to PCR inhibitors
• Sensitivity in target detection
• Universal protocol for PCR targets of different lengths
• Multiplex PCR of 15 targets
• Product format for direct gel loading
Request a sample of Platinum II Taq enzyme at http://bit.ly/2M4U9cw
Find other PCR enzymes at http://bit.ly/2JIPrzj
Learn more about PCR at http://bit.ly/2y2aSVo
#PCR #PCREducation #Invitrogen #InvitrogenSchoolofMolBio
Human cytomegalovirus (CMV) is a common immune-evasive herpes family virus leading to lifelong asymptomatic infection in 50 to 80% of humans. Current research evaluating the use of
TCR sequencing to predict response to immunotherapy has focused on measurements of T cell clonal expansion and TCR convergence (2,3,4) as potential predictive biomarkers for
response. Given that CMV infection has been reported to elicit large clonal proliferations of CMV reactive T cells (1), and is a source of chronic antigen stimulation, we hypothesized that CMV
infection might alter T cell repertoire features in a manner relevant to the potential biomarker use of TCR sequencing. Here we sought to identify features of CMV infection using TCRB profiling of
peripheral blood (PBL) total RNA. We identify reduced T cell evenness and elevated TCR convergence as features of chronic CMV infection.
Improvement of TMB Measurement by removal of Deaminated Bases in FFPE DNAThermo Fisher Scientific
Tumor mutational burden (TMB) is a positive predictive factor for response to immune-checkpoint inhibitors in certain types of cancer. The Oncomine™ Tumor Mutation Load Assay, a targeted next generation sequencing (NGS) assay, measures TMB (from 1.2Mb of coding region) and detects mutations in 409 cancer genes. The TMB values obtained using targeted sequencing are highly correlated with TMB measured by whole exome sequencing. FFPE preservation methods can lead to significant cytosine deamination of the isolated DNA, resulting in decreased sequencing quality. In these samples, uracils are propagated as thymines and result in false C>T substitutions. Analysis of the Oncomine™ TML Assay using Torrent Suite and Ion Reporter ™ software uniquely estimates the degree of deamination in fixed tissues by measuring C:G>T:A variants. This deamination score is used to assess quality of DNA extracted from FFPE tumor tissue. To minimize the influence
that excess deamination has on TMB results, we have incorporated a repair treatment to eliminate damaged targets and improve usable TMB values of DNA from damaged FFPE tumor tissue using Uracil-DNA glycosylase (UDG). The
Oncomine™ TML Assay for TMB on the Ion Gene Studio™ S5 systems in conjunction with a deamination score is informative and potentially predictive for the use of checkpoint inhibitors in multiple cancer types.
What can we learn from oncologists? A survey of molecular testing patternsThermo Fisher Scientific
Oncologists are increasingly incorporating NGS testing to guide targeted and immuno-oncology therapies1. Most clinical NGS testing is confined to large academic institutions and reference labs, despite the fact that most cancer patients are treated in the community settings. We therefore sought to examine molecular testing selection patterns directly from oncologists in order to better identify perceived gaps in testing and treatment paradigms
Evaluation of ctDNA extraction methods and amplifiable copy number yield usin...Thermo Fisher Scientific
The use of cell-free circulating tumor DNA (ctDNA) for non-invasive cancer testing has the potential to revolutionize the field. However, emergence of an increasing number of extraction methods and detection assays is rendering laboratory workflow development much more complex and cumbersome. The use of standardized, well characterized ctDNA control materials in human plasma could facilitate the evaluation of extraction efficiency and assay performance across platforms. In this study, we use a full process ctDNA quality control material in true human plasma to demonstrate the variability of extraction yield between different ctDNA extraction kits. We also examine the correlation between the amplifiable
copy number and DNA concentration post-extraction.
Analytical Validation of the Oncomine™ Comprehensive Assay v3 with FFPE and C...Thermo Fisher Scientific
The document summarizes an analytical validation of the Oncomine Comprehensive Assay v3 (OCAv3) targeted next-generation sequencing panel performed in a CLIA-certified laboratory. The validation assessed analytical sensitivity, specificity, accuracy, and precision using formalin-fixed paraffin-embedded tumor samples and cell lines. Results showed the assay met performance thresholds of 90% or higher for detecting single nucleotide variants, insertions/deletions, copy number variants, and gene fusions across a wide range of variants. Over 2,500 clinical samples were subsequently sequenced with the assay maintaining a 95% success rate and average turnaround time of 10 days.
Novel Spatial Multiplex Screening of Uropathogens Associated with Urinary Tra...Thermo Fisher Scientific
Accurate identification of uropathogens in a timely manner is important to correctly understand urinary tract infections(UTI’s), which affects nearly 150 million people each year. The
current standard approach for detecting the UTI pathogens is culture based. This method is time consuming, has low throughput, and can lack sensitivity and/or specificity. In addition, not all uropathogens grow equally well under standard culture conditions which can result in a failure to detect the species. To address these gaps, we have developed a unique workflow from sample preparation to target identification using the nanofluidic OpenArray™ platform for spatial multiplexing of target specific assays. In this study, we tested pre-determined blinded research samples and confirmed the subset of results with orthogonal Sanger sequences.
Liquid biopsy quality control – the importance of plasma quality, sample prep...Thermo Fisher Scientific
Liquid biopsy is emerging as a non-invasive companion to traditional solid tumor biopsies. As next generation sequencing (NGS) of circulating cell-free nucleic acids (cfNA = cfDNA and cfRNA) becomes common, it’s important to understand the impact of sample preparation on quality, specificity, and sensitivity of liquid biopsy tests. Plasma samples are often limited, and may have undesirable characteristics such as lipemia or hemolysis that contribute unwanted genomic DNA (gDNA) to the sample. Low cfDNA concentration can also limit the amount available for NGS library prep. In this study, we explore the effects of suboptimal plasma and low library input on liquid biopsy NGS, and discuss various techniques for in-process quality control of cfNA samples isolated from plasma
Streamlined next generation sequencing assay development using a highly multi...Thermo Fisher Scientific
Next generation sequencing (NGS) assay development for solid tumor sequencing requires characterization of variant calling directly from formalin-fixed paraffin embedded (FFPE) tissue samples. However, cell line based FFPE and human FFPE samples only contain 2 to 20 variants, which require laboratories to invest significant resources in sample sourcing and preparation when developing assays to detect 100+ variants
Targeted T-cell receptor beta immune repertoire sequencing in several FFPE ti...Thermo Fisher Scientific
T-cell receptor beta (TCRβ) immune repertoire analysis by next-generation sequencing is a valuable tool for studies of the tumor microenvironment and potential immune responses to cancer immunotherapy. Here we describe a TCRβ sequencing assay that leverages the low sample input requirements of AmpliSeq library preparation technology to extend the capability of targeted immune repertoire sequencing to include FFPE samples which can often be degraded and in short supply
Development of Quality Control Materials for Characterization of Comprehensiv...Thermo Fisher Scientific
Targeted next-generation sequencing (NGS) panels can detect hundreds of mutations in key genes using amplification based and hybrid-capture based NGS technologies. Although NGS technology is a powerful tool, optimizing and characterizing test performance on hundreds of variants is extremely challenging, time consuming, and expensive. Samples must be sourced, variants identified and orthogonally confirmed, then quantified and diluted. This effort is then multiplied across dozens of samples, and then samples must be run over many runs and days to assess assay reproducibility, precision, sensitivity, etc. In this study, we developed a novel reference material, experimental design, and analysis pipeline that allows for highly streamlined NGS assay characterization, enabling thorough test characterization across 500+ variants within only 6 runs.
A panel was developed using the OpenArray platform to profile common respiratory tract pathogens via PCR. Assays were designed to target viral and bacterial sequences with high specificity and strain coverage. The panel demonstrated high specificity when tested against genomic standards. Pre-amplification improved sensitivity by enhancing detection of low copy targets. The panel provides a customizable and high-throughput tool for respiratory infection research.
A high-throughput approach for multi-omic testing for prostate cancer researchThermo Fisher Scientific
The proliferation of genetic testing technologies and genome-scale studies has increased our understanding of the genetic basis of complex diseases. However, this information alone tells an incomplete story of the underlying biology. Integrative approaches that combine data from multiple sources, such as the genome, transcriptome and/or proteome, can provide a more comprehensive and multi-dimensional model of complex diseases. Similarly, the integration of multiple data types in disease screening can improve our understanding of disease in populations. In a series of groundbreaking multi-omic, population-based studies of prostate cancer, researchers at the Karolinska Institutet in Stockholm, Sweden identified sets of genetic and protein biomarkers that when evaluated together with other clinical research data performed significantly better in predicting cancer risk (1,2) than the most-widely used single protein biomarker, the prostate-specific antigen (PSA).
Discover the innovations and more that led to amazing discoveries through the use of thermal cyclers. What were scientists able to accomplish? What things are important to them when selecting a thermal cycler? What do you need to advance your science?
Learn more about thermal cyclers: http://bit.ly/2Q2oPhF
See all thermal cycler offerings: http://bit.ly/2Paf1wH
A rapid library preparation method with custom assay designs for detection of...Thermo Fisher Scientific
Herein, we describe a new research method for library
preparation using the Ion AmpliSeq™ HD Library Kit with
custom assay designs from Ion AmpliSeq HD Panels for
detection of low level variants from liquid biopsy samples. This
method includes incorporation of molecular tags that enable
0.1% Limit of Detection (LOD) in cell free DNA (cfDNA) and
dual barcodes for sample identification. This method is also
applicable to formalin-fixed paraffin embedded (FFPE)
samples. The libraries can be prepared in as little as 3 hours
and are compatible for analysis with the Ion GeneStudio™ S5
system
Generation of Clonal CRISPR/Cas9-edited Human iPSC Derived Cellular Models an...Thermo Fisher Scientific
This document describes a workflow for generating clonal CRISPR-edited human induced pluripotent stem cell (hiPSC) lines. Key aspects of the workflow include:
1) Developing a hiPSC line that stably expresses Cas9 to facilitate efficient genome editing.
2) Optimizing delivery methods for CRISPR/Cas9 editing tools and improving single cell clone survival and isolation using laminin-521 and StemFlex medium.
3) Applying the workflow to generate hiPSC lines carrying disease-relevant mutations and testing the cell models in assays, finding increased sensitivity to stress in models of Parkinson's disease.
TaqMan®Advanced miRNA cDNA synthesis kit to simultaneously study expression o...Thermo Fisher Scientific
MicroRNAs (miRNA) are a class of small non-coding RNAs (approximately 21 nt long) that bind complementary sequences in target mRNAs to specifically regulate gene expression. Aberrant regulation of miRNAs and their targets has been associated with several diseases including cancer. The relationship between miRNA and mRNA has been found to be important in cancer development and progression. Simultaneous expression studies of miRNA and mRNA and detection of mutations in mRNA transcripts can be valuable in understanding molecular mechanisms that
have an underlying role in various diseases. We demonstrate the technical verification of a novel method to reverse-transcribe and pre-amplify miRNA and mRNA from sample-limiting serum research samples using the TaqMan® Advanced miRNA cDNA Synthesis Kit. Based on results from previous studies, a signature of 49 mRNA and 37 miRNA targets has been identified that may help distinguish between benign and malignant pancreatic tissues. In this study, these targets and an additional set of transcript mutations were analyzed in serum from normal and test samples. TaqMan assays for miRNA and mRNA targets and custom TaqMan Mutation Detection Assays (TMDAs) were placed on TaqMan Array Cards to facilitate investigation of several samples in a single experiment. Results demonstrate that transcript mutations can be detected and miRNA and mRNA targets can be reliably quantified from a single reverse transcription reaction. For research use only. Not for use in diagnostic purposes.
Identifying novel and druggable targets in a triple negative breast cancer ce...Thermo Fisher Scientific
In this study, we developed a CRISPR/Cas9-based high throughput loss-of-function screen for identifying target genes responsible for the tumor proliferation and growth in TNBC. Our initial focus was to identify essential kinases in MDA-MB-231 cell line using the Invitrogen™ LentiArray™ Human Kinase CRISPR Library, which targets 840 kinases with up to 4 different gRNAs per protein kinase for complete gene knockout. This functional screen identified over 90 protein kinases that are essential for cell viability and cell proliferation. Ten of these hits (CDK1, CDK2, CDK8, CDK10, CDK11A, CDK19, CDK19, CDC7, EPHA2 and WEE1) are well-known targets validated in the literature. Currently, we are in the process validating the novel hits through target gene sequencing, western blotting and target specific small molecule kinase inhibitors.
Evidence for antigen-driven TCRβ chain convergence in the melanoma-infiltrati...Thermo Fisher Scientific
T cell convergence refers to the phenomenon whereby antigen-driven selection enriches for T cell receptors (TCRs) having a shared antigen specificity but different amino acid or
nucleotide sequence. T cell recruitment and expansion within the tumor microenvironment (TME) may be directed by responses to tumor neoantigen, suggesting that elevated T
cell convergence could be a general feature of the tumor infiltrating T cell repertoire. Here we use the Ion AmpliSeq™ Immune Repertoire Assay Plus – TCRβ to evaluate evidence
for T cell convergence within melanoma tumor biopsy research samples from a set of 63 subjects plus peripheral blood leukocytes (PBL) from four healthy subjects. We find that the melanoma TME is highly enriched for convergent TCRs compared to healthy donor peripheral blood. We discuss the potential use of TCR convergence as a liquid biopsy compatible predictive biomarker for immunotherapy response.
Analytical performance of a novel next generation sequencing assay for Myeloi...Thermo Fisher Scientific
To support clinical and translational research into precision oncology strategies for myeloid cancers, a next-generation sequencing (NGS) assay was developed to detect common and relevant somatic alterations. To define gene targets that were recurrently altered in myeloid cancers and relevant for clinical and translational research, an extensive survey of investigators at hematology oncology research labs was performed.
Your One-Stop Shop for Python Success: Top 10 US Python Development Providersakankshawande
Simplify your search for a reliable Python development partner! This list presents the top 10 trusted US providers offering comprehensive Python development services, ensuring your project's success from conception to completion.
In the rapidly evolving landscape of technologies, XML continues to play a vital role in structuring, storing, and transporting data across diverse systems. The recent advancements in artificial intelligence (AI) present new methodologies for enhancing XML development workflows, introducing efficiency, automation, and intelligent capabilities. This presentation will outline the scope and perspective of utilizing AI in XML development. The potential benefits and the possible pitfalls will be highlighted, providing a balanced view of the subject.
We will explore the capabilities of AI in understanding XML markup languages and autonomously creating structured XML content. Additionally, we will examine the capacity of AI to enrich plain text with appropriate XML markup. Practical examples and methodological guidelines will be provided to elucidate how AI can be effectively prompted to interpret and generate accurate XML markup.
Further emphasis will be placed on the role of AI in developing XSLT, or schemas such as XSD and Schematron. We will address the techniques and strategies adopted to create prompts for generating code, explaining code, or refactoring the code, and the results achieved.
The discussion will extend to how AI can be used to transform XML content. In particular, the focus will be on the use of AI XPath extension functions in XSLT, Schematron, Schematron Quick Fixes, or for XML content refactoring.
The presentation aims to deliver a comprehensive overview of AI usage in XML development, providing attendees with the necessary knowledge to make informed decisions. Whether you’re at the early stages of adopting AI or considering integrating it in advanced XML development, this presentation will cover all levels of expertise.
By highlighting the potential advantages and challenges of integrating AI with XML development tools and languages, the presentation seeks to inspire thoughtful conversation around the future of XML development. We’ll not only delve into the technical aspects of AI-powered XML development but also discuss practical implications and possible future directions.
“An Outlook of the Ongoing and Future Relationship between Blockchain Technologies and Process-aware Information Systems.” Invited talk at the joint workshop on Blockchain for Information Systems (BC4IS) and Blockchain for Trusted Data Sharing (B4TDS), co-located with with the 36th International Conference on Advanced Information Systems Engineering (CAiSE), 3 June 2024, Limassol, Cyprus.
In his public lecture, Christian Timmerer provides insights into the fascinating history of video streaming, starting from its humble beginnings before YouTube to the groundbreaking technologies that now dominate platforms like Netflix and ORF ON. Timmerer also presents provocative contributions of his own that have significantly influenced the industry. He concludes by looking at future challenges and invites the audience to join in a discussion.
Climate Impact of Software Testing at Nordic Testing DaysKari Kakkonen
My slides at Nordic Testing Days 6.6.2024
Climate impact / sustainability of software testing discussed on the talk. ICT and testing must carry their part of global responsibility to help with the climat warming. We can minimize the carbon footprint but we can also have a carbon handprint, a positive impact on the climate. Quality characteristics can be added with sustainability, and then measured continuously. Test environments can be used less, and in smaller scale and on demand. Test techniques can be used in optimizing or minimizing number of tests. Test automation can be used to speed up testing.
Building Production Ready Search Pipelines with Spark and MilvusZilliz
Spark is the widely used ETL tool for processing, indexing and ingesting data to serving stack for search. Milvus is the production-ready open-source vector database. In this talk we will show how to use Spark to process unstructured data to extract vector representations, and push the vectors to Milvus vector database for search serving.
Unlock the Future of Search with MongoDB Atlas_ Vector Search Unleashed.pdfMalak Abu Hammad
Discover how MongoDB Atlas and vector search technology can revolutionize your application's search capabilities. This comprehensive presentation covers:
* What is Vector Search?
* Importance and benefits of vector search
* Practical use cases across various industries
* Step-by-step implementation guide
* Live demos with code snippets
* Enhancing LLM capabilities with vector search
* Best practices and optimization strategies
Perfect for developers, AI enthusiasts, and tech leaders. Learn how to leverage MongoDB Atlas to deliver highly relevant, context-aware search results, transforming your data retrieval process. Stay ahead in tech innovation and maximize the potential of your applications.
#MongoDB #VectorSearch #AI #SemanticSearch #TechInnovation #DataScience #LLM #MachineLearning #SearchTechnology
OpenID AuthZEN Interop Read Out - AuthorizationDavid Brossard
During Identiverse 2024 and EIC 2024, members of the OpenID AuthZEN WG got together and demoed their authorization endpoints conforming to the AuthZEN API
Cosa hanno in comune un mattoncino Lego e la backdoor XZ?Speck&Tech
ABSTRACT: A prima vista, un mattoncino Lego e la backdoor XZ potrebbero avere in comune il fatto di essere entrambi blocchi di costruzione, o dipendenze di progetti creativi e software. La realtà è che un mattoncino Lego e il caso della backdoor XZ hanno molto di più di tutto ciò in comune.
Partecipate alla presentazione per immergervi in una storia di interoperabilità, standard e formati aperti, per poi discutere del ruolo importante che i contributori hanno in una comunità open source sostenibile.
BIO: Sostenitrice del software libero e dei formati standard e aperti. È stata un membro attivo dei progetti Fedora e openSUSE e ha co-fondato l'Associazione LibreItalia dove è stata coinvolta in diversi eventi, migrazioni e formazione relativi a LibreOffice. In precedenza ha lavorato a migrazioni e corsi di formazione su LibreOffice per diverse amministrazioni pubbliche e privati. Da gennaio 2020 lavora in SUSE come Software Release Engineer per Uyuni e SUSE Manager e quando non segue la sua passione per i computer e per Geeko coltiva la sua curiosità per l'astronomia (da cui deriva il suo nickname deneb_alpha).
Ocean lotus Threat actors project by John Sitima 2024 (1).pptxSitimaJohn
Ocean Lotus cyber threat actors represent a sophisticated, persistent, and politically motivated group that poses a significant risk to organizations and individuals in the Southeast Asian region. Their continuous evolution and adaptability underscore the need for robust cybersecurity measures and international cooperation to identify and mitigate the threats posed by such advanced persistent threat groups.
Taking AI to the Next Level in Manufacturing.pdfssuserfac0301
Read Taking AI to the Next Level in Manufacturing to gain insights on AI adoption in the manufacturing industry, such as:
1. How quickly AI is being implemented in manufacturing.
2. Which barriers stand in the way of AI adoption.
3. How data quality and governance form the backbone of AI.
4. Organizational processes and structures that may inhibit effective AI adoption.
6. Ideas and approaches to help build your organization's AI strategy.
Monitoring and Managing Anomaly Detection on OpenShift.pdfTosin Akinosho
Monitoring and Managing Anomaly Detection on OpenShift
Overview
Dive into the world of anomaly detection on edge devices with our comprehensive hands-on tutorial. This SlideShare presentation will guide you through the entire process, from data collection and model training to edge deployment and real-time monitoring. Perfect for those looking to implement robust anomaly detection systems on resource-constrained IoT/edge devices.
Key Topics Covered
1. Introduction to Anomaly Detection
- Understand the fundamentals of anomaly detection and its importance in identifying unusual behavior or failures in systems.
2. Understanding Edge (IoT)
- Learn about edge computing and IoT, and how they enable real-time data processing and decision-making at the source.
3. What is ArgoCD?
- Discover ArgoCD, a declarative, GitOps continuous delivery tool for Kubernetes, and its role in deploying applications on edge devices.
4. Deployment Using ArgoCD for Edge Devices
- Step-by-step guide on deploying anomaly detection models on edge devices using ArgoCD.
5. Introduction to Apache Kafka and S3
- Explore Apache Kafka for real-time data streaming and Amazon S3 for scalable storage solutions.
6. Viewing Kafka Messages in the Data Lake
- Learn how to view and analyze Kafka messages stored in a data lake for better insights.
7. What is Prometheus?
- Get to know Prometheus, an open-source monitoring and alerting toolkit, and its application in monitoring edge devices.
8. Monitoring Application Metrics with Prometheus
- Detailed instructions on setting up Prometheus to monitor the performance and health of your anomaly detection system.
9. What is Camel K?
- Introduction to Camel K, a lightweight integration framework built on Apache Camel, designed for Kubernetes.
10. Configuring Camel K Integrations for Data Pipelines
- Learn how to configure Camel K for seamless data pipeline integrations in your anomaly detection workflow.
11. What is a Jupyter Notebook?
- Overview of Jupyter Notebooks, an open-source web application for creating and sharing documents with live code, equations, visualizations, and narrative text.
12. Jupyter Notebooks with Code Examples
- Hands-on examples and code snippets in Jupyter Notebooks to help you implement and test anomaly detection models.
GraphRAG for Life Science to increase LLM accuracyTomaz Bratanic
GraphRAG for life science domain, where you retriever information from biomedical knowledge graphs using LLMs to increase the accuracy and performance of generated answers
Generating privacy-protected synthetic data using Secludy and MilvusZilliz
During this demo, the founders of Secludy will demonstrate how their system utilizes Milvus to store and manipulate embeddings for generating privacy-protected synthetic data. Their approach not only maintains the confidentiality of the original data but also enhances the utility and scalability of LLMs under privacy constraints. Attendees, including machine learning engineers, data scientists, and data managers, will witness first-hand how Secludy's integration with Milvus empowers organizations to harness the power of LLMs securely and efficiently.
Let's Integrate MuleSoft RPA, COMPOSER, APM with AWS IDP along with Slackshyamraj55
Discover the seamless integration of RPA (Robotic Process Automation), COMPOSER, and APM with AWS IDP enhanced with Slack notifications. Explore how these technologies converge to streamline workflows, optimize performance, and ensure secure access, all while leveraging the power of AWS IDP and real-time communication via Slack notifications.
2. geneArt® services—your partner for
gene synthesis through protein production
Whether you need industry-leading gene synthesis services or optimized protein expression, or want to outsource the entire
process from gene synthesis to protein production, this brochure outlines geneArt® services to help you succeed.
Gene synthesis
An increasingly cost-effective method for obtaining DNA constructs with
100% sequence accuracy, GeneArt® services offer:
• Largest capacity and fastest production processes
• Outstanding quality—ISO 9001:2008 certification
• Gene optimization for maximum protein expression
Custom services
Whether you’re looking to save time or improve upon existing processes,
GeneArt® services provide:
• A single resource for all of your outsourcing needs
• Gene synthesis to custom cell line and protein production
• ISO 9001:2008 certification and responsive project management
Contents
Introduction Cell line, protein, and plasmid services
• GeneArt® services overview ......................................... 2 • Cell lines and proteins ................................................. 8
• Plasmid services .......................................................... 9
Gene synthesis and optimization
• Introduction to gene optimization ............................... 3
• Gene synthesis ............................................................. 6
• Directed evolution ........................................................ 7
2 GeneArt® Gene Synthesis Services
3. GeneArt® services by Life Technologies
Considered one of the foremost global specialists in the area of synthetic biology, the geneArt® facility is the world’s leading
manufacturer of synthetic genes.
History
In 1999, Dr. Ralf Wagner, Dr. Marcus Graf, and Dr. Hans Wolf founded
the GeneArt® company after leaving the University of Regensburg.
Dr. Wagner needed custom-built genes to develop vaccines. They were
not commercially available at the time and thus had to be synthesized
de novo. The synthetic genes performed exceptionally well, and the
scientists recognized their potential benefit for research and industry.
They launched GeneArt® services with the vision to synthesize artificial
genes on a large scale at affordable rates, thus enabling access to these
new tools for scientists worldwide.
The GeneArt® company was awarded one of the largest gene synthesis
contracts for completion of the “Mammalian Gene Collection Program”
by the US National Institutes of Health. In addition, they produced
subgenomic elements for the construction of the first synthetic bacterial
genome by the J. Craig Venter Institute.
Customers
The world‘s largest pharmaceutical companies, many international
biotechnology companies, and major universities/research institutes
benefit from using the GeneArt® technology platform. Customers rely on
the expertise and experience of GeneArt® scientists to improve enzymes,
construct genetically altered bacteria, and develop and produce new
therapeutics and vaccines, in addition to providing the highest-quality
synthetic genes.
To learn more and place your order, go to www.invitrogen.com/genesynthesis 3
4. Gene optimization to maximize protein expression
Production of recombinant human proteins in human cells for biomedical research and product development can be
hampered by low expression yields. These expression issues can limit researchers’ ability to conduct structural and
functional analyses, delaying and in some cases halting the discovery process. gene optimization is the solution to
traditional protein expression limitations. The common pain points associated with protein expression—yield, solubility, and
functionality—can now be addressed in a rational and systematic way.
Using data available from published literature in combination with proprietary data, the geneOptimizer® algorithm
determines the optimal gene sequence for your expression experiments (Figure 1). Optimization has been experimentally
proven to increase protein expression rates up to 100-fold in a variety of host systems.
Multigene study of optimized mammalian genes Summary
In a first-of-its-kind study1, five important, biologically relevant protein Following optimization, the 50 genes all showed reliable expression and
classes were selected for study—protein kinases, transcription factors, 86% exhibited elevated expression (Figure 2, page 4). Further analysis
ribosomal proteins, cytokines, and membrane proteins. Then, 50 human showed no detrimental effect on protein solubility and unaltered func-
genes were chosen from the NCBI database to represent the five protein tionality was demonstrated for JNK1, JNK3, and CDC2 using optimized
classes. constructs (data not shown).
The selected genes were individually optimized using the sliding window Using the geneOptimizer® algorithm:
GeneOptimizer® algorithm.2 The corresponding wild type genes were • 96% of optimized genes showed equal or higher protein expression
subcloned using native sequences available from the NCBI database. • Protein yields increased up to 15-fold with optimized genes
Each gene was then prepped and expressed in triplicate in HEK293T • 100% of optimized genes expressed versus 88% of wild type genes
cells.
Sequence repeats Codon usage GC content
PABP
PABP
PABP
AAAAAA AAAAAA
Killer motifs Splice sites RNA secondary structures
Optimized gene
Figure 1. Proprietary GeneOptimizer ® algorithm determines optimal gene sequence for your experiments.
4 GeneArt® Gene Synthesis Services
5. A B
Wild type Optimized CREB1
x 2.8 References
Relative expression
mock
PP3
PP3
PP2
PP2
PP1
PP1
1. Fath S, Bauer AP, Liss M et al. (2011)
Multiparameter RNA and codon
60 optimization: a standardized tool to assess
CREB1 and enhance autologous mammalian gene
35
expression. PLoS One 6(3):e17596.
wild type optimized 2. Raab D, Graf M, Notka F et al. (2010) The
GeneOptimizer algorithm: using a sliding
SMARCD1 window approach to cope with the vast
x 1.8
sequence space in multiparameter DNA
Relative expression
sequence optimization. Syst Synth Biol
4(3):215–225.
60
SMARCD1
40
wild type optimized
JNK3
x 15.0
Relative expression
60
JNK3
40
wild type optimized
AQP5
x 9.0
Relative expression
60
AQP5
30
wild type optimized
IL-2
x only opt
Relative expression
20
IL-2
15
wild type optimized
Figure 2. Comparative expression analysis. Comparative expression analysis of wild type versus opti-
mized genes representing different protein classes. (A) Cell culture supernatants (immunomodulators,
IM) or cell lysates (all other protein classes) were analyzed by western blots using the α-Penta-His
antibody. One example from each protein class is shown. A cross-reactive 60 kD protein used to
standardize protein amounts is visible, including in the empty-vector negative controls (mock). Left:
molecular weight (kDa) markers, right: arrows indicating specific protein bands. (B) Relative expression
levels were derived by comparing mean expression (three independent transfections) of wild type or
optimized constructs, with wild type set to 1. The X-fold expression increase following gene optimization
is indicated for each protein (only opt = no detectable wild type expression).
To learn more and place your order, go to www.invitrogen.com/genesynthesis 5
6. Gene synthesis
gene synthesis has become a cost-effective, time- and resource-saving method for obtaining nearly any desired DnA
construct with 100% accuracy. It outperforms conventional molecular biology techniques in terms of time and cost, while
providing equivalent or better expression performance, and construct stability and quality. geneArt® gene synthesis tools go
beyond traditional synthesis and enable expression optimization and maximum performance.
Benefits
• Proprietary expression and mRNA stability optimization www Day 1
• Unlimited flexibility in gene and vector design Ordering until 3:00 pm (CET)
• Empirically proven expression increases G
A
• Ready-to-use constructs for expression and transfection
A
G A G
G
5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘ 5‘
Oligo synthesis overnight
• Easy online ordering
Quality
• All processes are ISO 9001:2008 quality certified Day 2
• Comprehensive quality documentation included Gene Assembler ® gene synthesis
platform
• Automated production processes
SuperSPEED Day 3
• Up to 1,200 bp in 5 business days (Figure 3) Cloning
• Up to 1,800 bp in 7 business days
• Emergency genes on request
Day 4
Performance A C G C A Sequencing quality control
• Project setup assistance and individual project support
• Maximum performance is available using the GeneOptimizer®
algorithm—the industry-preferred optimization algorithm Day 5
• Maximum production speed and worldwide delivery; capacity and Ready for shipment
reliability is supported by the world’s only industrial gene-processing
platform Figure 3. SuperSPEED gene synthesis service production
schedule.
Gene synthesis by GeneArt®
GeneOptimizer®
optimization algorithm
wild
type
GeneAssembler®
gene-synthesis platform
expression yield
Classic cloning
?
A C G C GTA
n
m
es
ng
g d
l g th
lib NA
ry
ifi R
s
n
e
tio
in Ad
te
en
io
pl PC
or on
ra i
ra
ni
ci
tu d w
ca
cD
at
si
lo
en
sf ati
co
na smi
qu
an ig
tr L
on
am
en
Se
a
Pl
cl
re
Sc
Figure 4. GeneArt® gene synthesis and gene optimization is faster than classic cloning and can provide better results.
6 GeneArt® Gene Synthesis Services
7. Directed evolution
Directed evolution strategies are the most efficient method for creating proteins with improved or novel properties. The
directed evolution technologies from geneArt® synthesis help to evolve proteins in a goal-oriented, systematic process.
Site-directed mutagenesis 50 60 70 80
Introduce single or multiple mutations (substitutions, insertions, or
wild type GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
deletions) into existing DNA sequences. F58A GVVPILVELDGDVNGHKASVSGEGEGDATYGKLTLKFICT
Benefits: fully sequence-verified clones, no unwanted backbone F59A GVVPILVELDGDVNGHKFAVSGEGEGDATYGKLTLKFICT
F60A GVVPILVELDGDVNGHKFSASGEGEGDATYGKLTLKFICT
mutants, and the fastest turnaround times. F61A GVVPILVELDGDVNGHKFSVAGEGEGDATYGKLTLKFICT
Applications: construction of fusion proteins, tagged proteins,
alternative splice forms, alanine scans, etc.
Site-saturation mutagenesis
Scanning a protein region by site-saturation mutagenesis identifies all 50 60 70 80
beneficial substitutions for enhanced function.
wild type GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
Benefits: best cost efficiency with no structural data needed for protein F58A GVVPILVELDGDVNGHKASVSGEGEGDATYGKLTLKFICT
improvement. F58C GVVPILVELDGDVNGHKCSVSGEGEGDATYGKLTLKFICT
F58D GVVPILVELDGDVNGHKDSVSGEGEGDATYGKLTLKFICT
Applications: improvement of (industrial) proteins, alienation of proteins F58E GVVPILVELDGDVNGHKESVSGEGEGDATYGKLTLKFICT
from patented sequences, etc.
Combinatorial libraries
True rational design for defined randomization of selected sites only, 50 60 70 80
while providing maximum framework integrity.
wild type GVVPILVELDGDVNGHKXXVSGXGEXXATYGKLTLKFICT
Benefits: lowest ancillary mutation rates and highest diversities. peer A01 GVVPILVELDGDVNGHKRQVSGGGEGDATYGKLTLKFICT
Applications: construction of recombinant antibody libraries, promoter peer A02 GVVPILVELDGDVNGHKAGVSGEGEGDATYGKLTLKFICT
peer A03 GVVPILVELDGDVNGHKIYVSGLGEGDATYGKLTLKFICT
libraries, and combination of substitutions identified by site-directed peer A04 GVVPILVELDGDVNGHKLKVSGPGEGDATYGKLTLKFICT
mutagenesis.
Controlled randomization libraries
Substitute any amino acid in a gene with a defined probability. 50 60 70 80
Benefits: accurate fine-tuning of mutation rate, and randomization of wild type GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLXXICT
the entire open reading frame. peer A01 GVVPILVELDGDVNGHKFTVSGEGEGDATYGKLTLLKICT
peer A02 GVVPILVELDGDVNGHKTSVSGEGEDDATYGKLTLIGICT
Applications: affinity maturation of antibodies, improvement of industrial peer A03 GVVPILVELDGDVNGHKFSVSGAGEGDATYGKLTLQDICT
enzymes, modification of enantioselectivity of enzymes, etc. peer A04 GVVPILVELDGDVNGHKFSVSGEGEGYATDGKLTLLPICT
Truncation libraries
50 60 270 280
Create custom-defined populations of up to 40,000 in-frame truncated
constructs. wild type GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
peer A01 VVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
Benefits: Highest quality by avoiding out-of-frame mutations. peer A02 GVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
Applications: solubility screen, minimal functional-size evaluation, peer A03 ILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFI
peer A04 DGDVNGHKFSVSGEGEGDATYGKLTLK
domain identification, inhibitory screenings, epitope mapping, etc.
To learn more and place your order, go to www.invitrogen.com/genesynthesis 7
8. Cell lines and proteins
Starting with only the nucleotide sequence, geneArt® services can provide purified protein within 30 business days. Protein
purification from transiently transfected mammalian cells assures correct folding and processing. Usage of optimized
genes for stable cell-line generation leads to production of high levels of active protein.
Benefits
• Seamless project processing—gene synthesis and protein purification from one source
• Speed—from gene to protein within 30 business days
Services
Expression analysis Optimized gene Genes to expression
in expression expression
Verification of your expression construct or vector verification
evaluation of the best variant of your protein
Protein production Genes to proteins
‘‘pilot‘‘
Genes to proteins
‘‘scale‘‘
Genes to proteins
‘‘guaranteed‘‘
Protein production in mammalian cells using Pilot production Customer–defined
culture volume
Guaranteed
amount
advanced transient transfection protocols
Cell line development Genes to cell lines
‘‘polyclonal‘‘
Genes to cell lines
‘‘clonal‘‘
Generation of cloned or uncloned stable cell lines Stable cell line
polyclonal
Stable cell line
clonal
Examples
• Improved expression reliability—optimized genes show expression of otherwise non-expressible proteins (Figure 4)
• Protein production by transient transfection—natural or approved artificial leader-peptides yield excellent secretion of engineered protein into the
culture supernatant (Figure 5)
• Improved transgene expression—productivity of antibodies from stable cell lines is improved with optimized expression constructs (Figure 6)
1 2 3
mock wild type optimized BSA standard ECD of
kDa 1 2 3 1 2 3 receptor tyrosine kinase
20 monoclonal antibody
IL-2
15
Figure 5. 10 mg of the extracellular domain of a receptor tyrosine kinase and a
monoclonal antibody (heavy and light chain) were purified from the supernatant of
transiently transfected HEK293/CHO cells via affinity tag/ProteinA.
IL-2
x only opt
500
Relative expression
protein concentration (µg/mL)
best producer
400
300
200
100
0
wild type optimized
wild type optimized
Figure 4. Three independent transfections of each wild type and optimized IL-2 gene Figure 6. Stable cell lines expressing different combinations of HC and LC of a human
were analyzed by western blot and densitometric analysis of the resulting bands. antibody were generated with wild type and optimized sequences and antibody pro-
duction yield was compared.
8 GeneArt® Gene Synthesis Services
9. Plasmid services
geneArt® plasmid DnA purification protocols help ensure consistent high quality for research applications and preclinical
studies. From vector construction to the production of plasmid DnA for preclinical trials, geneArt® plasmid services make
the development and execution of your project easy.
Gene synthesis
High-quality, scalable plasmid DNA for all applications
• Highly pure and homogeneous plasmid DNA
• Low levels of endotoxin (down to 0.01 EU/μg pDNA)
• Milligram to gram scale
• Fill-and-finish service
Subcloning
Applications
• Cell transfection
• Immunization studies
• Preclinical studies
• Toxicological studies
• DNA vaccine research
Plasmid production
Vector construction
Using expression-optimized, exchangeable genetic elements, GeneArt®
plasmid services manage individual vector design and complex subclon-
ing projects, delivering streamlined plasmid production and optimal
gene expression.
Project documentation Vector construction
A certificate of analysis (CoA) is provided with every plasmid order.
Premium documentation of all DIN ISO–certified production processes
can be provided on request.
Production documentation
To learn more and place your order, go to www.invitrogen.com/genesynthesis 9