This document summarizes work on protein structure prediction using threading and context-specific alignment potentials. It introduces the problem of predicting protein structure for distant homologs using threading approaches. The work presents a solution that models protein alignment as a conditional probability using a context-specific conditional neural field (CNF) model incorporating both local and global alignment information. Evaluation on 1000 test cases showed improved accuracy over HHpred, an established threading approach, demonstrating the effectiveness of the proposed context-specific alignment potential.
Prediction of the three dimensional structure of a given protein sequence i.e. target protein from the amino acid sequence of a homologous (template) protein for which an X-ray or NMR structure is available based on an alignment to one or more known protein structures
Prediction of the three dimensional structure of a given protein sequence i.e. target protein from the amino acid sequence of a homologous (template) protein for which an X-ray or NMR structure is available based on an alignment to one or more known protein structures
This talk presents an on line decision support system for structural biologists who are interested in performing multiple protein structure comparisons, via multiple methods, in one go.
HERE IN THIS PRESENTATION HY HOMOLOGY MODELING IS EXPLAIN , WITH EXAMPLES OF PROTEIN PRIMARY AND SECONDARY, SHOWING THE IMAGES FORM WHICH MAKES EASY TO UNDERSTAND
protein structure prediction methods. homology modelling, fold recognition, threading, ab initio methods. in short and easy form slides. after one time read you can easily understand methods for protein structure prediction.
Protein structure prediction is the inference of the three-dimensional structure of a protein from its amino acid sequence—that is, the prediction of its folding and its secondary and tertiary structure from its primary structure. Structure prediction is fundamentally different from the inverse problem of protein design. Protein structure prediction is one of the most important goals pursued by bioinformatics and theoretical chemistry; it is highly important in medicine (for example, in drug design) and biotechnology (for example, in the design of novel enzymes).
A multiple sequence alignment (MSA) is a sequence alignment of three or more biological sequences, generally protein, DNA, or RNA. In many cases, the input set of query sequences are assumed to have an evolutionary relationship by which they share a linkage and are descended from a common ancestor. From the resulting MSA, sequence homology can be inferred and phylogenetic analysis can be conducted to assess the sequences' shared evolutionary origins.
Homology modeling, also known as comparative modeling of protein, refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental three-dimensional structure of a related homologous protein (the "template"). Homology modeling relies on the identification of one or more known protein structures likely to resemble the structure of the query sequence, and on the production of an alignment that maps residues in the query sequence to residues in the template sequence has been shown that protein structures are more conserved than protein sequences amongst homologues, but sequences falling below a 20% sequence identity can have very different structure.
Homology modeling, also known as comparative modeling of protein, refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental three-dimensional structure of a related homologous protein.
This talk presents an on line decision support system for structural biologists who are interested in performing multiple protein structure comparisons, via multiple methods, in one go.
HERE IN THIS PRESENTATION HY HOMOLOGY MODELING IS EXPLAIN , WITH EXAMPLES OF PROTEIN PRIMARY AND SECONDARY, SHOWING THE IMAGES FORM WHICH MAKES EASY TO UNDERSTAND
protein structure prediction methods. homology modelling, fold recognition, threading, ab initio methods. in short and easy form slides. after one time read you can easily understand methods for protein structure prediction.
Protein structure prediction is the inference of the three-dimensional structure of a protein from its amino acid sequence—that is, the prediction of its folding and its secondary and tertiary structure from its primary structure. Structure prediction is fundamentally different from the inverse problem of protein design. Protein structure prediction is one of the most important goals pursued by bioinformatics and theoretical chemistry; it is highly important in medicine (for example, in drug design) and biotechnology (for example, in the design of novel enzymes).
A multiple sequence alignment (MSA) is a sequence alignment of three or more biological sequences, generally protein, DNA, or RNA. In many cases, the input set of query sequences are assumed to have an evolutionary relationship by which they share a linkage and are descended from a common ancestor. From the resulting MSA, sequence homology can be inferred and phylogenetic analysis can be conducted to assess the sequences' shared evolutionary origins.
Homology modeling, also known as comparative modeling of protein, refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental three-dimensional structure of a related homologous protein (the "template"). Homology modeling relies on the identification of one or more known protein structures likely to resemble the structure of the query sequence, and on the production of an alignment that maps residues in the query sequence to residues in the template sequence has been shown that protein structures are more conserved than protein sequences amongst homologues, but sequences falling below a 20% sequence identity can have very different structure.
Homology modeling, also known as comparative modeling of protein, refers to constructing an atomic-resolution model of the "target" protein from its amino acid sequence and an experimental three-dimensional structure of a related homologous protein.
Some considerations on using the two systems to manage molecular biology knowledge networks. This comes from: https://github.com/marco-brandizi/odx_neo4j_converter_test
Optimization of Test Pattern Using Genetic Algorithm for Testing SRAMIJERA Editor
An optimization of test pattern for testing of a Static Random Access Memory (SRAM) using genetic algorithm
interconnects presented here is a method that associates a turn on inputs to numerous nets, which gives rise to
test vectors to determine stuck-at, open, and bridging faults. This set up gives us privilege in reducing
unnecessary composition that reduces the testing time for application-dependent testing for coverage of faults.
This optimized test pattern is used as a test source for testing a circuit and identifying the faults in the circuit.
The faults which are covered in are stuck at open and bridging faults. Genetic algorithm reduces the redundancy
and optimizes the test pattern which results in reduced testing time and power consumption
Foundation and Synchronization of the Dynamic Output Dual Systemsijtsrd
In this paper, the synchronization problem of the dynamic output dual systems is firstly introduced and investigated. Based on the time domain approach, the state variables synchronization of such dual systems can be verified. Meanwhile, the guaranteed exponential convergence rate can be accurately estimated. Finally, some numerical simulations are provided to illustrate the feasibility and effectiveness of the obtained result. Yeong-Jeu Sun "Foundation and Synchronization of the Dynamic Output Dual Systems" Published in International Journal of Trend in Scientific Research and Development (ijtsrd), ISSN: 2456-6470, Volume-3 | Issue-6 , October 2019, URL: https://www.ijtsrd.com/papers/ijtsrd29256.pdf Paper URL: https://www.ijtsrd.com/engineering/electrical-engineering/29256/foundation-and-synchronization-of-the-dynamic-output-dual-systems/yeong-jeu-sun
Nowadays, there is a rapid growth of open-source version control systems and repositories. A large number of new software projects are implemented, developed and maintained through these systems. Τhis way, software engineers can collaborate directly with each other, organize effectively and maintain an up-to-date history of the project’s evolution. Therefore, the volume of information stored is significant and its harnessing can lead to the development of smart and efficient systems. Within the context of this diploma thesis a machine learning system is developed, which stores, processes and groups source code changes that have taken place during the development stage, with the goal of extracting source code changes patterns. These patterns can act as recommendations for new projects, in order to optimize code development and/or fix potential bugs found repeatedly in project repositories. The proposed methodology was applied on the GitHub code hosting platform. GitHub tracks changes of source code files contained in a repository. These changes are represented as Abstract Syntax Trees (ASTs), so that the calculation of a similarity metric for the algorithmic structure can be achieved. Additionally, their semantic similarity is calculated and thus final clustering of source code changes is possible. Clusters that meet specific criteria, contain patterns of source code changes that can be used to provide recommendations for new software projects.
Εξαγωγή Προτύπων Αλλαγών Κώδικα από Αποθετήρια Ανοικτού ΛογισμικούISSEL
Στη σημερινή εποχή παρατηρείται ραγδαία ανάπτυξη των συστημάτων ελέγχου εκδόσεων και των αποθετηρίων ανοικτού λογισμικού. Τεράστιος όγκος νέων έργων λογισμικού υλοποιείται, αναπτύσσεται και συντηρείται μέσω των συστημάτων αυτών. Κατ’ αυτόν τον τρόπο, οι μηχανικοί λογισμικού μπορούν να συνεργάζονται άμεσα μεταξύ τους, να οργανώνουν αποτελεσματικά τα έργα που υλοποιούν και να διατηρούν ένα συγχρονισμένο ιστορικό της εξέλιξής τους. Επομένως, ο όγκος πληροφορίας που αποθηκεύεται είναι τεράστιος και η αξιοποίηση του μπορεί να οδηγήσει στη δημιουργία έξυπνων και αποτελεσματικών συστημάτων. Τα αποθετήρια αυτά αποτελούν μια θαυμάσια πηγή πληροφοριών. Στη συγκεκριμένη εργασία υλοποιείται ένα σύστημα μηχανικής μάθησης το οποίο αποθηκεύει, επεξεργάζεται και ομαδοποιεί αλλαγές πηγαίου κώδικα που έχουν πραγματοποιηθεί κατά τη διάρκεια εξέλιξης των έργων λογισμικού με τελικό στόχο την εξόρυξη προτύπων αλλαγών πηγαίου κώδικα. Τα πρότυπα αυτά μπορούν να προσφέρουν προτάσεις σε νέα συστήματα που υλοποιούνται ώστε να πραγματοποιηθούν βελτιστοποιήσεις ή διορθώσεις πιθανών σφαλμάτων, οι οποίες έχουν γίνει επανειλημμένα σε μια πληθώρα διαφορετικών έργων λογισμικού στο παρελθόν. Η μεθοδολογία εφαρμόστηκε στα αποθετήρια του συστήματος GitHub. Μέσω του GitHub, εξορύσσονται οι αλλαγές των αρχείων πηγαίου κώδικα που περιέχονται στο ιστορικό εξέλιξης των αποθετηρίων. Οι αλλαγές αυτές αναπαρίστανται ως Αφηρημένα Συντακτικά Δέντρα (Abstract Syntax Trees) για τον υπολογισμό της ομοιότητας που παρουσιάζει η αλγοριθμική δομή τους. Επίσης, υπολογίζεται η λεξιλογική ομοιότητά τους και, έτσι, είναι εφικτή η τελική τους ομαδοποίηση. Ομάδες οι οποίες πληρούν συγκεκριμένες προϋποθέσεις περιέχουν πρότυπα αλλαγών πηγαίου κώδικα, τα οποία χρησιμοποιούνται για την παροχή συστάσεων σε νέα έργα λογισμικού.
Deep Learning Meets Biology: How Does a Protein Helix Know Where to Start and...Melissa Moody
UVA Data Science Institute Master of Science in Data Science students Sean Mullane, Ruoyan Chen and Sri Vaishnavi Vemulapalli were motivated to apply data science tools and techniques to the problem, and see if protein structures can be quantitatively described, compared and otherwise analyzed in a more robust, efficient and automated manner. Potential applications include more effectively designed drugs to inhibit disease-related proteins, or even newly engineered ones.
The researchers received the award for Best Paper in the Data Science for Health category at the 2019 Systems & Information Design Symposium (SIEDS) meeting. Their project, "Machine Learning for Classification of Protein Helix Capping Motifs," focused on small segments of a protein called secondary structural elements. These structural elements are the basic molecular-scale building blocks that all proteins—and therefore life—build upon.
Similar to Protein threading using context specific alignment potential ismb-2013 (20)
GraphRAG is All You need? LLM & Knowledge GraphGuy Korland
Guy Korland, CEO and Co-founder of FalkorDB, will review two articles on the integration of language models with knowledge graphs.
1. Unifying Large Language Models and Knowledge Graphs: A Roadmap.
https://arxiv.org/abs/2306.08302
2. Microsoft Research's GraphRAG paper and a review paper on various uses of knowledge graphs:
https://www.microsoft.com/en-us/research/blog/graphrag-unlocking-llm-discovery-on-narrative-private-data/
The Art of the Pitch: WordPress Relationships and SalesLaura Byrne
Clients don’t know what they don’t know. What web solutions are right for them? How does WordPress come into the picture? How do you make sure you understand scope and timeline? What do you do if sometime changes?
All these questions and more will be explored as we talk about matching clients’ needs with what your agency offers without pulling teeth or pulling your hair out. Practical tips, and strategies for successful relationship building that leads to closing the deal.
Epistemic Interaction - tuning interfaces to provide information for AI supportAlan Dix
Paper presented at SYNERGY workshop at AVI 2024, Genoa, Italy. 3rd June 2024
https://alandix.com/academic/papers/synergy2024-epistemic/
As machine learning integrates deeper into human-computer interactions, the concept of epistemic interaction emerges, aiming to refine these interactions to enhance system adaptability. This approach encourages minor, intentional adjustments in user behaviour to enrich the data available for system learning. This paper introduces epistemic interaction within the context of human-system communication, illustrating how deliberate interaction design can improve system understanding and adaptation. Through concrete examples, we demonstrate the potential of epistemic interaction to significantly advance human-computer interaction by leveraging intuitive human communication strategies to inform system design and functionality, offering a novel pathway for enriching user-system engagements.
Key Trends Shaping the Future of Infrastructure.pdfCheryl Hung
Keynote at DIGIT West Expo, Glasgow on 29 May 2024.
Cheryl Hung, ochery.com
Sr Director, Infrastructure Ecosystem, Arm.
The key trends across hardware, cloud and open-source; exploring how these areas are likely to mature and develop over the short and long-term, and then considering how organisations can position themselves to adapt and thrive.
Observability Concepts EVERY Developer Should Know -- DeveloperWeek Europe.pdfPaige Cruz
Monitoring and observability aren’t traditionally found in software curriculums and many of us cobble this knowledge together from whatever vendor or ecosystem we were first introduced to and whatever is a part of your current company’s observability stack.
While the dev and ops silo continues to crumble….many organizations still relegate monitoring & observability as the purview of ops, infra and SRE teams. This is a mistake - achieving a highly observable system requires collaboration up and down the stack.
I, a former op, would like to extend an invitation to all application developers to join the observability party will share these foundational concepts to build on:
UiPath Test Automation using UiPath Test Suite series, part 3DianaGray10
Welcome to UiPath Test Automation using UiPath Test Suite series part 3. In this session, we will cover desktop automation along with UI automation.
Topics covered:
UI automation Introduction,
UI automation Sample
Desktop automation flow
Pradeep Chinnala, Senior Consultant Automation Developer @WonderBotz and UiPath MVP
Deepak Rai, Automation Practice Lead, Boundaryless Group and UiPath MVP
DevOps and Testing slides at DASA ConnectKari Kakkonen
My and Rik Marselis slides at 30.5.2024 DASA Connect conference. We discuss about what is testing, then what is agile testing and finally what is Testing in DevOps. Finally we had lovely workshop with the participants trying to find out different ways to think about quality and testing in different parts of the DevOps infinity loop.
Encryption in Microsoft 365 - ExpertsLive Netherlands 2024Albert Hoitingh
In this session I delve into the encryption technology used in Microsoft 365 and Microsoft Purview. Including the concepts of Customer Key and Double Key Encryption.
Securing your Kubernetes cluster_ a step-by-step guide to success !KatiaHIMEUR1
Today, after several years of existence, an extremely active community and an ultra-dynamic ecosystem, Kubernetes has established itself as the de facto standard in container orchestration. Thanks to a wide range of managed services, it has never been so easy to set up a ready-to-use Kubernetes cluster.
However, this ease of use means that the subject of security in Kubernetes is often left for later, or even neglected. This exposes companies to significant risks.
In this talk, I'll show you step-by-step how to secure your Kubernetes cluster for greater peace of mind and reliability.
Dev Dives: Train smarter, not harder – active learning and UiPath LLMs for do...UiPathCommunity
💥 Speed, accuracy, and scaling – discover the superpowers of GenAI in action with UiPath Document Understanding and Communications Mining™:
See how to accelerate model training and optimize model performance with active learning
Learn about the latest enhancements to out-of-the-box document processing – with little to no training required
Get an exclusive demo of the new family of UiPath LLMs – GenAI models specialized for processing different types of documents and messages
This is a hands-on session specifically designed for automation developers and AI enthusiasts seeking to enhance their knowledge in leveraging the latest intelligent document processing capabilities offered by UiPath.
Speakers:
👨🏫 Andras Palfi, Senior Product Manager, UiPath
👩🏫 Lenka Dulovicova, Product Program Manager, UiPath
Elevating Tactical DDD Patterns Through Object CalisthenicsDorra BARTAGUIZ
After immersing yourself in the blue book and its red counterpart, attending DDD-focused conferences, and applying tactical patterns, you're left with a crucial question: How do I ensure my design is effective? Tactical patterns within Domain-Driven Design (DDD) serve as guiding principles for creating clear and manageable domain models. However, achieving success with these patterns requires additional guidance. Interestingly, we've observed that a set of constraints initially designed for training purposes remarkably aligns with effective pattern implementation, offering a more ‘mechanical’ approach. Let's explore together how Object Calisthenics can elevate the design of your tactical DDD patterns, offering concrete help for those venturing into DDD for the first time!
Elevating Tactical DDD Patterns Through Object Calisthenics
Protein threading using context specific alignment potential ismb-2013
1. Protein Threading Using Context-
Specific Alignment Potential
Sheng Wang
http://raptorx.uchicago.edu
Toyota Technological Institute at Chicago,
Joint work with Jianzhu Ma, Feng Zhao and Jinbo Xu
ISMB 2013
Jul 22, ICC Berlin, Germany
2. Outline
• Where we are @ template-based modeling
• What’s our work
• What’s the problem
• What’s our solution
• Welcome to our server
3. Template-based Modeling (or, Threading)
• Observation
– ~50,000 non-redundant structures in PDB
– ~ 1,200 unique structure folds (SCOP)
• Methodology
– Use known structures to predict a new one
Template sequence
Query sequence DDVYILDQAEEG
DE-FIVD-PDEH
DDVYILDQAEEG
SPCKR---ADEG
DDVYILDQAEEG
E--IFVDQADDS
DDVYILDQAEEG
NMCVFGQWERTY
database
4. Template-based Modeling Procedures
Easy: similar sequences → similar structures
Sequence-based method, e.g., BLAST, FASTA
Works only for close homologous (>70% sequence identity)
Medium: similar profiles → similar structures
Protein profile is a matrix that represents a multiple sequence
alignment of the similar proteins
Profile-based method, e.g., PSI-BLAST , HHMER, HHpred,
Works for relative remote homologous (>40% sequence identity)
Challenge: dissimilar profiles → similar structures
Adding structural information, or context-specific into sequence/profile
based methods
Threading method, e.g., MUSTER, RAPTOR, CS-BLAST
Works for distant remote homologous (<40% sequence identity)
5. Our Work
• CNFpred: Transform a template-sequence
alignment problem into a Machine Learning
problem to calculate the alignment’s probability.
• DeepAlign: Prepare for high quality training
data of structural alignment.
• CNF model: Combined Machine Learning model
that incorporate Conditional Random Field (CRF)
and Neural Network (NN).
6. Protein Alignment Model
S A L R Q
L
P
L
S
E
M
M
M
M
L P L S - E
S A - L R Q
Template
Sequence
Match states (M)
M M Is M It M
Insertion at sequence (Is)
Insertion at template (It)
The structural alignment generated by DeepAlign is used for training data
7. DeepAlign for Structure Alignment
• evolutionary information
• local sub-structure similarity
• angular similarity for hydrogen bonding
BLOSUM is the local amino acid substitution matrix;
CLESUM is the local sub-structure substitution matrix;
v(i,j) measures the angular similarity for hydrogen bonding;
d(i,j) measures the spatial proximity of two aligned residues.
local similarity global similarity
Score(i,j)=( max(0,BLOSUM(i,j) )+CLESUM(i,j) )*v(i,j)*d(i,j)
8. CNF-based Alignment Model
E: a neural network estimating the log-likelihood of state transition
Z(S,T): normalization factor
1 2{ , ,..., }LA a a a { , , }i t sa M I IGiven an alignment
Define a conditional probability
between Sequence S and Template T
Where,
),(/)),,,(exp(),|( 1 TSZTSaaETSAp
i
ii
Context-Specific
9. Comprehensive Features
MTYKLILN--GKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE
How similar two
residues : EAA
How similar query’s
sequence and profile and
template’s profile: Esp,
Epp
How similar template’s
secondary structure and
sequence’s predicted second
structure (3-class and 8-class):
Ess3, Ess8
Sequence S
How similar is the query’s solvent
accessibility and template’s
solvent accessibility: Esa
Total scoring function is a non-linear combination of:
E( ai, ai-1, EAA , Esp , Epp , Ediso, Ess3 , Ess8 , Esa )
Template T
MTYKLILNSTVRTKSDTVTDAVP---ADKICSFAQQLPWEREWSF--
For disordered regions, Ediso,
no structure information used.
10. What’s the problem?
• Only the alignment probability is described,
instead of the log-odds potential compared to
background.
• Only incorporate local information, insufficient
of global information.
11. Our solution
Propose a protein alignment potential
• With an elaborately designed reference state.
• Can be generalized into sequence-sequence,
sequence-structure as well as structure-structure
alignment.
Incorporate both local and global terms
• For local term, CNFpred potential is applied.
• For global term, EPAD potential is employed.
12. Protein alignment potential
Similarly, given one alignment A between sequence S and template T,
we define the potential of A as follows.
N
N
i
ref
yxAP
TSAP
AP
TSAP
TSAu
1
),|(
),|(
log
)(
),|(
log),|(
Given 2 AAs a and b, their mutation potential is defined as follows.
)()(
)(
log
)(
)(
log)(
bPaP
baP
baP
baP
bau
ref
x and y are two random proteins with
the as S and T, respectively.
Assumption: the alignment maximizing the potential is the optimal.
13. ),(/)),|(),|(exp(),|( TSZTSAGTSAFTSAP
The alignment probability given sequence S and template T could be modeled
as follows,
local term global term
partition function
A
TSAPtsZ ),|(),(
Protein alignment potential
15. Model the local potential
i
ii TSaaETSAF ),,,(),|( 1
From CNFpred, we use a context-specific linear chain model as,
The expectation term can be calculated by uniformly sampling a few
thousand protein pairs, so the local potential is
The local potential is defined as,
),|(),|(),|( , yxAFEXPTSAFTSAU yxlocal
i
iiiilocal aaETSaaETSAU )),(),,,((),|( 11
16. Maximize on probability Maximize on potential
Long but less informative and
highly false positive.
Good for building models.
Template Template
Sequence
Sequence
Short but relevant and highly
significant.
Good for ranking templates.
What’s the difference between
17. Model the global potential
ji
ji
T
ij ssdPTSAG ),|(log),|(
From EPAD, we use a context-specific distance-dependent model as,
The expectation term can be calculated by uniformly sampling a few
thousand residue pairs from templates, so the global potential is
The global potential is defined as,
),|(),|(),|( , yxAGEXPTSAGTSAU yxglobal
ji
T
ijji
T
ijglobal dPssdPTSAU ))(log),|((log),|(
18. What’s global information given an
alignment?
i j
i j
ji
ji
T
ij ssdPTSAG ),|(log),|(
Template T
Sequence S
T
ijd
T
ijd
i j
If the alignment is good, the distance of a sequence residue pair
shall match well with that of their aligned template residue pair.
si
sj
20. Welcome to our server
http://raptorx.uchicago.edu/
Binding
Contact
21. Thank you
Jinbo Xu
Feng Zhao
Jianzhu Ma
National Institutes of Health (R01GM0897532)
National Science Foundation (DBI-0960390)
NSF CAREER award CCF-1149811
Alfred P. Sloan Research Fellowship
Editor's Notes
Currently, template-based modeling is the main-stream approach in protein structure prediction. This is based on the observation that although we have around 50,000 non-redundant structures in PDB, the unique structure fold in SCOP is only about 12 hundred. And what most important thing is, in recent years after 2010, the new unique fold less appeared, which implies that number of naturally occurring protein fold is limited, and this becomes a fundamental assumption that, we could use known structures to predict an unknown query sequence.More formally, the definition of template-based modelingis, given a query protein one-dimension amino acid sequence, and a template database with known three-dimension structure, we align each template and query to find the best match and build the query model upon the template.
Here we move into the first part, how to define the label for protein alignment data. In details, we transfer an alignment path into a series of continuous labels with M,Is and It, these three states. So there are nine adjacent state transitions in total.After defined the label, we could apply DeepAlign to generate the training data by structurally similar proteins.