SlideShare a Scribd company logo
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2, pp: 78-87 (ISSN: 2455-1716) Impact Factor 2.4 MARCH-2016
http://ijlssr.com IJLSSR © 2015 All rights are reserved
In vitro Antifungal and Antiproliferative Evaluation of a Trypsin Inhibitor from Testa of
Citrullus lanatus Linn.
Sreenu Barla1
, Dowluru Svgk Kaladhar2
*, Narasinga Rao V3
1,3
Department of Biochemistry, GIS, GITAM University, Visakhapatnam-530045, India
2
HOD (Microbiology and Bioinformatics), Bilaspur University, Bilaspur 495001, India
ABSTRACT- Medicinal plants contain valuable sources of biological components that are helpful in control and cure of
ageing diseases. Protein component present in various parts of the medicinal plants is the rich sources of medicine that
contains a permanent cure for several diseases. The studies on edible sources like C. lanatus testa (or seed coat) are to be
conducted to understand, the better action against human diseases. The purified inhibitor is separated by SDS PAGE and
analyzed by MS-MASCOT shown sequence as “MQDVKTYPPAAPVPATPRFGSLAG SLIEINR”. The C. lanatus testa
crude extracts were revealed good antifungal activity against A. niger (18mm) and C. albicans (13mm). The C. lanatus
testa purified extracts were revealed good antifungal activity against A. niger (21 mm) and C. albicans (20mm).
Fluconazole was used as a fungal standard, shown inhibition zone for A. niger (14mm) and C. albicans (20mm). The C.
lanatus Trypsin Inhibitor (CLTI) extracts from testa at 100µg/ml were shown good activity with A. niger acting as
antifungal agent compared to standard antibiotic (Fluconazole). The C. lanatus testa Trypsin inhibitor, it is also shown
good results for anti-proliferative activity. The results were shown good antiproliferation activity with MCF-7 (Breast
Cancer) cell line due to gradual decrease in the percentage of cell survival. The IC50 for standard drug (Tamoxifen) with
MCF-7 (Breast Cancer) cell line was shown as 12µg/ml. The IC50 of CLTI peptide was shown as 60µg/ml and crude as
190µg/ml. The IC50 for standard drug (Tamoxifen) with Hep-G2 (Liver Cancer) Cell line is shown as11 µg/ml. The IC50 of
CLTI peptide with Hep-G2 (Liver Cancer) Cell line was shown as 41 µg/ml and C. lanatus testa crude extract as 144
µg/ml. The experimentation concludes that serine protease inhibitors present in testa of C.lanatus shown both antifungal
and antiproliferative properties.
Key Words- C. lanatus testa, Trypsin inhibitor, Antifungal activity, Antiproliferative activity, Breast and liver cell lines
-------------------------------------------------IJLSSR-----------------------------------------------
INTRODUCTION
Most of the prominent experts have compiled comprehen-
sive and survey of research in science and allied disciplines
[1]. Analyses of the challenges are performing through high
Received: 22 Jan 2016/Revised: 16 Feb 2016/Accepted: 28 Feb 2016
quality science research as a main context of the broader
information systems community [2]. An advance in
genetics, biotechnology, phytochemistry and engineering
involves research leading to new manufacturing concepts
for the production of medicinal compounds that can lead to
a new manufacturing model [3].
Several governments have focused on medicinal plants that
provide more sustain study in the subject of drug
production [4]. The medicinal plant, C. lanatus belongs to
*
Address for Correspondence:
Dr. DSVGK Kaladhar
Dept. of Microbiology and Bioinformatics
Bilaspur University
Bilaspur (C.G.), India
(M): 9885827025
Research Article (Open access)
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
Cucurbitaceae family is using as fruit and vegetable from
the past decades. The fruits and seeds of this plant are
helpful in the control of aging diseases like diabetes and
cancer. One of the prerequisites in the primary health care
is the availability in the use of sustainable drugs from
plants that have a common source of medicaments. The
plants form traditional preparations are pure, active
principles from extracts that have actions or uses in therapy
[5]. Traditional plants medicines are used throughout the
world that clean only depicts that are important in health
and economy [6].
The inhibition of proteinase by protease inhibitor is an
example of protein-protein interaction, where the special
features of tie binding of two partners form complex
structures [7]. A characterization of Helicover paarmigera
contains proteinases and the interaction with proteinase
inhibitors using x-ray film contact print technique has been
experimented basis on basic method [8].
Enzyme inhibitors combine with enzymes to covalently
make them inactivate irreversibly. The irreversible inhibi-
tors are toxic substances and they may be natural or syn-
thetic. Serine proteases like trypsin can be assayed for its
activity in the presence of appropriate irreversible inhibi-
tors to study their inhibitory effects of an enzyme activity.
Enzyme activity is influenced by metal ions. The activity
depends on the nature of various amino acid residues
present at the active site of the enzyme. The effect of
several metal ions can be studied by examining the enzyme
activity in the presence of metal containing salts.
Plants have well-established class of inhibitors called
Serine protease inhibitors that show resistance against
microorganisms. Protease inhibitors will able to disruption
cell damage and enhance the cell's life-span [9]. Plants
produce various peptides and proteins that are extracted and
purified which act as antimicrobials [10]. A novel method
can be used for development of novel antimicrobial agents.
Homologous inhibitor show molecular modelling and
dynamics studies that are measured with Escherichia coli
trypsin and chymotrypsin proteins. The interactions are
provided based on inhibitor–enzyme docking studies [11].
Protease inhibitors ALLN and ALLM are of calpain and
cathepsin proteases inhibitor that shows antiproliferative
activity [12]. The action of Bowman-Birk protease inhibitor
from leguminous family was shown antitumor and
antiproliferative properties [13]. Aprotinin, pepstatin, and
soybean trypsin inhibitor exhibit anticancer properties [14].
L. acutangula (var) Amara annual herb is belonging to the
family, Cucurbitaceae contains ribosome-inactivating
proteins, monocotyledon mannose-binding lectins,
amaranthins and Cucurbitaceae phloem lectins act as
antiproliferative activity [15]. Calf serum (FCS), Dulbec-
co's Modified Eagle medium (DMEM), paclitaxel (PTX),
EDTA, trypsin, penicillin, amphotericin exhibit a powerful
antiproliferation [16]. Protein inhibitors of trypsin from the
seeds of cucurbitaceae plants have shown a good antiproli-
ferative activity [17].
MATERIALS AND METHODS
Collection of C. Lanatus fruits
In the present experiment, Citrullus lanatus fruits were
collected from the fields of Visakhapatnam district, AP,
India during March to June 2011. The plants are authenti-
cated by Dr. P.V. Arjun Rao, Ethanobotanist, Dept. of
Botany, Phytopharma Technology Laboratory, Visakhapat-
nam (No. Res/2 dated 21-09-2010). Citrullus lanatus., on
comparison with the details given in “FLORA OF THE
PRESIDENCY OF MADRAS” by J.S. Gamble, Volume i,
Page nos.534-536, Bishen Singh Mahendra Pal Singh pub-
lishers, India (2004) and “Flowering plants from Chittoor
district, Andhra Pradesh, India” by K. Madhava Chetty, K.
Sivaji and K. TulasiRao, First edition published by students
offset printers, Thirupathi, India, pp. 137-139 (2008).
Preparation of Crude Extract
The seeds present in the fruits are collected and dried for
two days. The testa is separated and crushed to a fine
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
powder using motar and pestle. The fine testa powder is
selected for the present experimentation.
The testa powder was depigmented, dehydrated, and defat-
ted by washing with acetone for several times, followed by
hexane and Folch’s mixture (chloroform: methanol, 2:1)
and with 1% PVP. The solvents were removed by filtration
and the powder air-dried. Testa powder was homogenized
in 100 ml of 0.1M phosphate buffer pH 7.0 and the extract
was prepared in 500 ml conical flask. The homogenate was
mixed by incubating the extract in a rotary shaker at 120
rpm for 30 minutes at room temperature. Then the cell de-
bris was removed by the slurry filtered through cheesec-
loth. The filtrate was collected and centrifuged at 10,000
rpm for 15 minutes at 4°C [18]. The crude extract appears
as a clear supernatant was selected for further precipitation
of inhibitor by Ammonium sulphate precipitation.
Ammonium sulphate precipitation and dialysis
Citrullus lanatus testa protein was precipitated by the
Ammonium sulfate precipitation method. The protein
isolation was done based on the method done by Englard
and Seifter, 1990 [19]. The unwanted proteins are removed
by ammonium sulphate precipitation and at the same time
the protein of interest could be concentrated. Varying
concentrations of ammonium sulphate (30%, 50%, 70%
and 90%) to the crude extract was kept at 4˚C for about one
day precipitation to optimize the selected protease inhibitor.
The precipitated protease inhibitor was collected by centri-
fugation of extract at 10,000 rpm at 4˚C for 15 minutes.
The precipitated protein was further dialyzed against 0.01M
phosphate buffer (pH 7.0) to remove the ammonium
sulphate present in the precipitate as details given below.
The dialysis tube (Sigma-Aldrich) was washed in running
water for about 3-4 hrs. The tube was rinsed with the 0.3%
(w/v) solution sodium sulfide at 80°C for 1 minute. After
washing with hot water (60°C) for 2 minutes, the solution
was acidified with 0.2% sulphuric acid (v /v) and rinsed
with hot water (60°C).The process is done to build the
pores of the tube more clear. Tube will be opened, then
pack the sample solution and this packed solution was keep
in 0.01M phosphate buffer. This method has helped to
removal of salts in the sample solution. Finally the protein
was lyophilized and subjected to various analytical
techniques and also used in the further purification.
Purification of Trypsin Inhibitor
Ion Exchange Chromatography
The active protease inhibitor fraction that was attained after
the process of dialysis by ammonium sulphate precipitation
was purified by Ion exchange chromatography using an
anion exchanger called DEAE cellulose. Proteins obtained
due to surface charge will bind to ion exchangers. The
reversibly adsorbed proteins were eluted out by using either
through a salt gradient or pH.
Activation of DEAE Cellulose
The DEAE cellulose 10g was soaked in double distilled
water, allowed to settle, and the fine particle was removed
by decanting. It was then suspended in 0.1M HCl for
overnight. Remove the hydrochloric acid and wash with
double distilled water, then add 0.1M NaOH incubate for
overnight. Decanted the sodium hydroxide solution and
washed several times with distilled water in a sintered glass
funnel using vacuum filtration, until the pH of the washings
became neutral. Equilibration of the resin in appropriate
buffer by repeated washings with the same buffer was
conducted.
Purification Using DEAE Cellulose Column
DEAE cellulose activated as carefully packed up
(1.5X30cm) column and was equilibrated with phosphate
buffer pH 7.0. A protein content of 4.1mg/ml from 30 ml of
the dialyzed sample was used in the pre-equilibrated DEAE
cellulose column. The complete addition of sample into
pre-equilibrated DEAE cellulose column was connected to
the reservoir that contains the phosphate buffer that
adjusted with a flow rate of 2 ml per minute.
The unbound proteins obtained were washed out until
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
absorbance reached near to zero at 280 nm. An elution was
completed at a flow rate of 2ml per minute using gradients
stepwise with sodium chloride that ranges from 0.1 to 0.5M
that was prepared in 0.01M phosphate buffer at 7.0 pH.
About 2 ml of fractions from columns were collected and
the protein content of each fraction was being estimated by
measuring the OD at 280 nm. The peak fractions from the
column were then pooled and were again dialyzed against
the 0.01M phosphate buffer at pH 7.0. The dialyzed frac-
tions from testa of C. lanatus were assayed for protease
inhibitory activity, protein content and specific activity.
Gel Filtration on Sephadex G -50
Sephadex G-50 activated as carefully packed up (1.5X50
cm) column without any air bubble and the column was
equilibrated with 0.1M phosphate buffer pH 7.0. The
samples were dissolved in 0.1M phosphate buffer pH 7.0,
that samples were loaded on sephadex G-50 column. The
column was previously equilibrated with 0.1M phosphate
buffer pH7.0 and the sample was eluted in the same buffer
with a flow rate of 2 ml/minute, 2 ml fractions were
collected at a flow rate of 120ml per hour and protein
absorbance was measured at 280 nm.
Calculation of yield of protein or protease inhibitor activity
of each fraction during purification is the percent activity
obtained by dividing the total protein content or activity of
that fraction with the total protein content or activity of the
crude extract. Fold of purification in each step was
calculated by dividing the specific activity of the respective
fraction with that of the crude extract.
The purified inhibitor is further purified by SDS PAGE and
analysed by MASCOT.
Antifungal Activity
The antifungal activity was conducted based on zone
method.
Microorganisms
Microbes from ATCC (American Type Culture Collection),
USA have been used in the present study. The fungi used in
the present experimentation are Aspergillus niger (ATCC
6275) and Candida albicans (ATCC 10231).
Antifungal Activity Using Zone Method
Antifungal tests were carried out by agar well diffusion
method [20]. About 8 mm wells on inoculated Sabouraud
dextrose agar plates were filled with 10, 25, 50, 100 µg/ml
of crude and Purified proteins respectively that is made in
10% DMSO. The Flucanozole used (10 µg/ml) as positive
reference standard. The agar plates were incubated for 48
hours at 25˚ C. The antifungal activity was assessing quan-
titatively by the absence or presence of inhibition zones and
zone diameters.
Antiproliferative Activity
As the crude and isolated protein extracts has shown effi-
cient antifungal activities, a preliminary investigation has
been made for finding antiproliferative effects of crude and
isolated samples from testa of C. lanatus on MCF-7 (Breast
Cancer) and Hep –G2 (Liver Cancer) cell lines. The cell
lines were procured from National Centre for Cell Science,
Pune. The whole cells have been grown in Minimal
essential medium (MEM, GIBCO) was being supple-
mented with 4.5 g/L glucose, 5% fetal bovine serum (FBS)
(growth medium) and 2 mM L-glutamine and at 37°C in
5% CO2 incubator.
By using MTT assay, can determine the inhibitory effects
of sample compounds on cell growth in vitro, these assay
developed by Mosmann and was modified has been used .
The T-25 flask is a 96-well flat-bottomed tissue culture
plate. In the culture plate each well seeded with trypsinized
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
cells. Each well density of cell culture was maintained at
5x103
cells/ well in the growth medium and cultured at
37°C in 5% CO2 to adhere. Culture cells were incubated
upto 48 hrs, after the Incubation, the supernatant was
discarded.
The cells were mixed with various concentrations of sam-
ple compounds (6.25, 12.5, 25, 50, 100 and 200 µg/ml)
used to bring about a final volume of 100 µl, before that
cells were pretreated with growth medium and then cell
were cultured for 48 hours. The sample compound was
equipped as 1.0 mg/ml stock solutions in PBS. In this assay
used controls are Solvent and culture medium. Each well
contains 5 µl of fresh MTT, add about 0.5mg/ml in PBS
and then incubate for 2 hoursr at 37°C. The supernatant
contains growth medium, supernatant removed from the
wells and for solubilize the colored formazan product
added 100 µl of DMSO. Incubate upto 30 min, by using
ELISA reader (Anthos 2020 spectrophotometer) colored
culture product absorbance read (OD) at wavelength of 572
nm.
RESULTS AND DISCUSSION
The peptide sequenced in MALDI was selected for in vitro
analysis. The sequence of the peptide sequence shown by
the Mascot report was shown below:
>gi|296399226|gb|ADH10401.1| photosystem I subunit IX
[Selaginella moellendorffii]
MQDVKTYPPAAPVPATPRFGSLAGSLIEINRLSPDAP
VSPPA
The plant extract and purified C. lanatus Trypsin Inhibitor
(CLTI) peptide was analyzed for antifungal activity against
various test microorganisms. All the prepared extracts were
shown good antifungal activity. The antifungal activity
results were represented in Table 1 and 2.
The C. lanatus testa isolated extracts was revealed good
antifungal activity against A. niger (21 mm) and C. albi-
cans (20mm). The C. lanatus testa crude extracts was
revealed good antifungal activity against A. niger (18mm)
and C. albicans (13mm). Fluconazole has used for fungal
standard shown inhibition zone for A. niger (14mm) and C.
albicans (20mm) (Table 1 and 2). The protein and C.
lanatus Trypsin Inhibitor (CLTI) extracts from testa at
100µg/ml was shown good antifungal activities compared
to standard antibiotic.
Table 1: Antifungal activity of Crude protein
extract from Test of C. lanatus
The potential and active compounds to develop the antimi-
crobial compounds from medicinal plants appeared worthy
which leads to the improvement of phytomedicine used
against microbes. Due to fewer side effects that are
frequently associated with synthetic antimicrobials, the
Plant-based-antimicrobials have huge therapeutic potential
[21].
Table 2: Antifungal activity of Trypsin inhibitor
from C. lanatus testa purified
The C. lanatus testa crude and Trypsin inhibitor has also
shown good results for anti-proliferative activity. Table 3
was shown the dose response of C. lanatus testa crude,
Trypsin inhibitor and standard (Tamoxifen) against MCF-7
(Breast Cancer) cell line. The results were shown good
cancer inhibition due to gradual decrease in the percentage
of cell survival. Fig. 1 shows Standard IC50 was shown as
Fungi Zone of Inhibition in mm
Crude protein extract DMS
O
(Con-
trol)
Flucona-
zole
(Stan-
dard)
10µg/
ml
25µg
/ml
50µg
/ml
100µg
/ml
Candida albi-
cans
- - 10 13 - 20
Aspergillus
niger
11 12 14 18 - 14
Fungi Zone of Inhibition in mm
C. lanatus purified testa extract DMS
O
(Con-
trol)
Fluco-
nazole
(Stan-
dard)
10µg/
ml
25µg/
ml
50µg/
ml
100µ
g/ml
Candida
albicans
- - 18 20 -- 20
Aspergillus
niger
- 12 20 21 -- 14
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
12µg/ml. The IC50 of CLTI was shown as 60µg/ml and crude as 190µg/ml. Fig. 2 shows antiproliferative effects of C.
lanatus testa isolated extract on MCF-7 (Breast Cancer) cell line.
Table 3: Dose Response of C. lanatus testa crude and Trypsin inhibitor MCF-7 (Breast Cancer) cell line
Conc.
(in µg /ml)
Tamoxifen Crude extract Isolated extract
% of Cell
survival
% of Cell inhi-
bition
% of cell
survival
% of cell inhi-
bition
% of cell
survival
% of cell inhi-
bition
6.25 82.3 17.7 97.8 2.2 93.5 6.5
12.5 45.5 54.5 84.1 15.9 89.5 10.5
50 30.9 69.1 76.7 23.3 56.4 43.6
100 16 84 58.5 41.5 32.3 67.7
200 4.9 95.1 49 51 21.2 78.8
250 0.4 99.6 30 70 13.4 86.6
Fig. 1: Graphical representation for Antiproliferative activity of C. lanatus testa crude and Trypsin inhibitor on
MCF-7 (Breast cancer) cell line
Fig. 2: Antiproliferative activity of Trypsin inhibitor from C. lanatus testa on MCF-7 (Breast Cancer) cell line be-
fore and after treatment
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
Table 4 was shown the dose response of C. lanatus testa crude, Trypsin inhibitor and standard (Tamoxifen) against
Hep –G2 (Liver Cancer) Cell line. The results were shown good cancer inhibition due to gradual decrease in the percen-
tage of cell survival. Fig. 3 shows Standard IC50 as 11 µg/ml, the IC50 of CLTI peptide as 41 µg/ml and crude as 144
µg/ml. Fig. 4 shows antiproliferative effects of C. lanatus testa isolated extract on Hep –G2 (Liver Cancer) Cell line.
Table 4: Dose Response of C. lanatus testa crude and Trypsin inhibitor on Hep –G2 (Liver Cancer) Cell line
Conc.
(in µg /ml)
Tamoxifen Crude extract Isolated extract
% of
cell survival
% of
cell inhibition
% of
cell survival
% of
cell inhibition
% of
cell surviv-
al
% of
cell inhibition
6.25 82.3 17.7 94 6 89.7 10.3
12.5 45.5 54.5 87.9 12.1 65.8 34.2
50 37.4 62.6 70.1 29.9 45.5 54.5
100 29.2 70.8 58.4 41.6 38.6 61.4
200 21 79 39.7 60.3 31.5 68.5
250 11.2 88.8 22.2 77.8 13.6 86.4
Fig. 3: Graphical representation of antiproliferative activity of C. lanatus testa crude and Trypsin inhibitor on Hep
–G2 cell line
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
Fig. 4: Antiproliferative activity of Trypsin inhibitor from C. lanatus testa on Hep –G2 cell line
Gram-positive and Gram-negative bacteria were capable to
bind with rMjSerp1 through the reaction estimated by the
microorganism binding assay. The rMjSerp1 acts as a mi-
crobial serine protease inhibitor such as subtilisin A and
proteinase K [22]. Various external secretions consists se-
rine proteases that are inhibited by endogenous inhibitors
like Antileukoprotease (ALP), or secretory leukocyte pro-
teinase inhibitor. Antileukoprotease (ALP) comprises two
homologous domains, one of the domains contain protei-
nase inhibitory activities that are located in the COOH-
terminal domain, and the NH2-terminal domain function is
unknown. The E. coli or S. aureus was incubated with
intact ALP or its isolated first domain and resulted in
killing of these bacteria [23]. Antimicrobial peptides
(AMPs) have central role in infection and inflammation
[24]. The protozoan parasite Toxoplasma gondii asexual
development were affected by serine protease inhibitors
like 3,4-dichloroisocoumarin and 4-(2-aminoethyl)-
benzenesulfonyl fluoride and these were prevented invasion
of the host cells [25].
Plants protease inhibitors can potently inhibited the growth
of bacterial and fungal pathogenic strains. PIs are excellent
agents for development of novel antimicrobial agents [26].
Potato tuber has antifungal protein (AFP-J), AFP-J was pu-
rified and strongly inhibited yeast fungal strains like Can-
dida albicans, Trichosporon beigelii and Saccharomyces
cerevisiae, AFP-J could not inhibited the crop fungal pa-
thogens [27]. The Momordica cochinchinensis (MCo)
squash seeds consist three trypsin inhibitors (TIs), these
inhibitors have been isolated and purified using gel filtra-
tion and used as anti fungal agents [28].
CONCLUSION
The present experimentation was shown good PIs of C.
lanatus testa having antifungal and antiproliferative activi-
ties. Hence Trypsin inhibitor from testa of Citrullus lanatus
has good biological activities.
CONFLICT OF INTERESTS
The author declares that there is no conflict of interests re-
garding the publication of this paper.
ACKNOWLEDGEMENT
The authors would like to thank the management and staff
of GITAM University, India for their kind support in bring-
ing out the above literature and providing lab facilities.
REFERENCES
[1] Gabel DL. Handbook of research on science teaching and
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
learning project. Macmillan Publishing Company, Division
of Macmillan, Inc., 866 Third Avenue, New York, NY
10022: 1993.
[2] Hevner AR, March ST, Park J, and Ram S (Design science in
information systems research). MIS quarterly, 2004; 28(1):
75-105.
[3] Ragauskas AJ, Williams CK, Davison BH, Britovsek G, Cair-
ney J, Eckert CA and Tschaplinski T (The path forward for
biofuels and biomaterials). Science, 2006; 311(5760): 484-
489.
[4] Kirtikar KR, and Basu BD (Indian Medicinal Plants). Indian
Medicinal Plants, 1918; 72.
[5] Farnsworth NR, Akerele O, Bingel AS, Soejarto DD, and Guo
Z (Medicinal plants in therapy). Bulletin of the world health
organization, 1985; 63(6):965.
[6] Jamil A, Shahid M, Khan MM, and Ashraf M (Screening of
some medicinal plants for isolation of antifungal proteins
and peptides). Pakistan Journal of Botany, 2007;39.
[7] Bieth J. Some kinetic consequences of the tight binding of
protein-proteinase-inhibitors to proteolytic enzymes and their
application to the determination of dissociation constants. In
Proteinase Inhibitors Springer Berlin Heidelberg, 1974; 463-
469.
[8] Harsulkar AM, Giri AP, Gupta VS, Sainani MN, Deshpande
VV, Patankar AG, and Ranjekar PK (Characterization of He-
licoverpaarmigera gut proteinases and their interaction with
proteinase inhibitors using gel X‐ray film contact print tech-
nique). Electrophoresis, 1998; 19(8‐9): 1397-1402.
[9] Mandal SM, Porto WF, De D, Phule A, Korpole S, Ghosh
AK, Sanat KR, and Franco OL (Screening of serine protease
inhibitors with antimicrobial activity using iron oxide nano-
particles functionalized with dextran conjugated trypsin and
in silico analyses of bacterial serine protease inhibition).
Analyst, 2014; 139(2): 464-472.
[10] Milisav I, Poljsak B, and Šuput D (Adaptive response, evi-
dence of cross-resistance and its potential clinical use). In-
ternational journal of molecular sciences, 2012; 13(9):
10771-10806.
[11] Santi MM, William FP, Debasis D, AjitPhule, Suresh
K, Ananta KG, Sanat KR, and Octavio LF (Screening of
serine protease inhibitors with antimicrobial activity using
iron oxide nanoparticles functionalized with dextran con-
jugated trypsin and in silico analyses of bacterial serine
protease inhibition). Analyst, 2014; 139: 464-472.
[12] An WG, Hwang SG, Trepel JB, and Blagosklonny MV (Pro-
tease inhibitor-induced apoptosis: accumulation of wt
p53, p21 WAF1/CIP1, and induction of apoptosis are in-
dependent markers of proteasome inhibition). Leukemia,
2000; 14(7): 1276–1283.
[13] Ho VSM, and NG TB (A Bowman-Birk trypsin inhibitor
with antiproliferative activity from Hokkaido large black
soybeans). J. Peptide Sci., 2008; 14: 278–282.
[14] Ly LH, Zhao XY, Holloway L, and Feldman D (Liarozole
Acts Synergistically with 1α, 25-Dihydroxyvitamin D3 to
Inhibit Growth of DU 145 Human Prostate Cancer Cells
by Blocking 24-Hydroxylase Activity 1). Endocrinology,
1999; 140(5): 2071-2076.
[15] Kabir SR, Zubair MA, Nurujjaman M, Haque MA, Hasan I,
Islam MF, and Absar N (Purification and characterization
of a Ca2+-dependent novel lectin from Nymphaea
nouchali tuber with antiproliferative activities). Bioscience
reports, 2011; 31(6): 465-475.
[16] Vanajothi R, Sudha A, Manikandan R, Rameshthangam P,
and Srinivasan P (Luffa acutangula and Lippia nodiflora
leaf extract induces growth inhibitory effect through in-
duction of apoptosis on human lung cancer cell line). Bio-
medicine and Preventive Nutrition 2012; 2(4): 287-293.
[17] Dibyendu DM (Recent updates on pharmaceutical potential
of plant protease inhibitors). International Journal of
Medicine and Pharmaceutical Science, 2013; 3(4): 101-
120.
[18] Pichare MM, and Kachole MS (Detection of electrophoreti-
cally separated protease inhibitors using X-ray film).
Journal of biochemical and biophysical methods, 1994;
28(3): 215-224.
[19] Englard S, and Seifter S (Precipitation techniques). Methods
Enzymol, 1990; 182: 285-300.
[20] Kaladhar DSVGK, Geetha S, Varahalarao V, and Nagendra
SY (Anti-dandruff activity of ethanolic extract of Sapin-
dus), IJAPSBS, 2013; 2(3): 149-155.
[21] Hema TA, Arya AS, Suseelan S, Celestinal RJ and Divya PV
(Antimicrobial activity of five south Indian medicinal
Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2
http://ijlssr.com IJLSSR © 2015 All rights are reserved
plants against clinical pathogens). International Journal of
Pharma and Bio Sciences, 2013; 4(1): 70-80.
[22] Zhao YR, Xu YH, Jiang HS, Xu S, Zhao XF, and Wang JX
(Antibacterial Activity of Serine Protease Inhibitor 1 from
Kuruma Shrimp Marsupenaeus japonicas). Developmental
and Comparative Immunology. 2014; 44(2): 261-269.
[23] Hiemstra PS, Maassen RJ, Stolk J, Heinzel-Wieland R,
Steffens GJ, and Dijkman JH (Antibacterial activity of an-
tileukoprotease). Antibacterial activity
of antileukoprotease, 1996; 64(11): 4520-4524.
[24] Lai Y, and Gallo RL (AMPed up immunity: how antimicro-
bial peptides have multiple roles in immune defense).
Trends in immunology, 2009; 30(3): 131-141
[25] Conseil V, Soete M, and Dubremetz JF (Serine protease in-
hibitors block invasion of host cells by Toxoplasma gondii).
Antimicrobial agents and chemotherapy, 1999; 43(6): 1358-
1361.
[26] Kim JY, Park SC, Hwang I, Cheong H, Nah JW, Hahm KS,
and Park Y (Protease inhibitors from plants with antim-
icrobial activity). International journal of molecular sci-
ences, 2009; 10(6): 2860-2872.
[27] Park Y, Choi BH, Kwak JS, Kang CW, Lim HT, Cheong HS,
and Hahm KS (Kunitz-type serine protease inhibitor from
potato (Solanum tuberosum L. cv. Jopung)). J.Agric Food
Chem, 2005; 53(16): 6491-6496.
[28] Hernandez JF, Gagnon J, Chiche L, Nguyen T M, Andrieu
JP, Heitz A, and Le Nguyen D (Squash trypsin inhibitors
from Momordica cochinchinensis exhibit an atypical mac-
rocyclic structure). Biochemistry, 2000; 39(19): 5722-
5730.

More Related Content

What's hot

Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
IOSRJPBS
 
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
Alexander Decker
 
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
ijtsrd
 
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
pharmaindexing
 
Petersheim Poster april2016 (Final Version)
Petersheim Poster april2016 (Final Version)Petersheim Poster april2016 (Final Version)
Petersheim Poster april2016 (Final Version)Sandra D. Cojocaru
 
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
iosrphr_editor
 
Antioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leavesAntioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leaves
Silentdisco Berlin
 
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
Agriculture Journal IJOEAR
 
Cumulative effect of modified atmospheric packaging on the textural and chemi...
Cumulative effect of modified atmospheric packaging on the textural and chemi...Cumulative effect of modified atmospheric packaging on the textural and chemi...
Cumulative effect of modified atmospheric packaging on the textural and chemi...
SukhveerSingh31
 
Influence of gongronema latifolium leaf extracts treatment on some hepatic...
Influence of gongronema  latifolium  leaf extracts  treatment on some hepatic...Influence of gongronema  latifolium  leaf extracts  treatment on some hepatic...
Influence of gongronema latifolium leaf extracts treatment on some hepatic...
Alexander Decker
 
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA L.
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA  L.ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA  L.
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA L.
Raju Sanghvi
 
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
Jolene1981
 
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germinationBiostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
Alexander Decker
 
Food as Medicine: Moringa, the Miracle Tree
Food as Medicine: Moringa, the Miracle TreeFood as Medicine: Moringa, the Miracle Tree
Food as Medicine: Moringa, the Miracle Tree
Kevin KF Ng
 

What's hot (18)

Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
Hepatoprotective and Antioxidant Effects of the Flavonoid-rich Fraction of th...
 
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
Studies of in vitro antioxidant and cytotoxic activities of extracts and isol...
 
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
Protective Effect of Alysicarpus Monilifer L., Against CCl4 induced Hepatotox...
 
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
Screening of mentha cordifolia opiz (yerba buena) buffer crude extract for as...
 
Petersheim Poster april2016 (Final Version)
Petersheim Poster april2016 (Final Version)Petersheim Poster april2016 (Final Version)
Petersheim Poster april2016 (Final Version)
 
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
Evaluation of antioxidant activities of Cyperusrotundus (Ethanolic extract an...
 
Antioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leavesAntioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leaves
 
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
The Role of Cell Wall-Degrading Enzymes in the Development of Anthracnose Dis...
 
Cumulative effect of modified atmospheric packaging on the textural and chemi...
Cumulative effect of modified atmospheric packaging on the textural and chemi...Cumulative effect of modified atmospheric packaging on the textural and chemi...
Cumulative effect of modified atmospheric packaging on the textural and chemi...
 
aging study
aging studyaging study
aging study
 
Influence of gongronema latifolium leaf extracts treatment on some hepatic...
Influence of gongronema  latifolium  leaf extracts  treatment on some hepatic...Influence of gongronema  latifolium  leaf extracts  treatment on some hepatic...
Influence of gongronema latifolium leaf extracts treatment on some hepatic...
 
Tua tua
Tua tuaTua tua
Tua tua
 
Citronella
CitronellaCitronella
Citronella
 
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA L.
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA  L.ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA  L.
ANTI - INFLAMMATORY ACTIVITY OF LEAVES OF JATROPHA GOSSYPIFOLIA L.
 
publication
publicationpublication
publication
 
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
Cytotoxicity of Blended Versus Single Medicinal Mushroom Extracts on Human Ca...
 
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germinationBiostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
Biostimulatory effect of shilajeet on wheat (triticum astivum) seed germination
 
Food as Medicine: Moringa, the Miracle Tree
Food as Medicine: Moringa, the Miracle TreeFood as Medicine: Moringa, the Miracle Tree
Food as Medicine: Moringa, the Miracle Tree
 

Similar to In vitro Antifungal and Antiproliferative Evaluation of a Trypsin Inhibitor from Testa of Citrullus lanatus Linn.

Antioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leavesAntioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leavesDrumstick Moringa
 
Gp1
Gp1Gp1
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
International Journal of Engineering Inventions www.ijeijournal.com
 
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
pharmaindexing
 
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of PharmacyIOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacyiosrphr_editor
 
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of PharmacyIOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacyiosrphr_editor
 
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
IOSR Journals
 
Ijpar 8 11
Ijpar 8 11Ijpar 8 11
Ijpar 8 11
pharmaindexing
 
Ijpar 8 11
Ijpar 8 11Ijpar 8 11
Ijpar 8 11
pharmaindexing
 
Cymbopogon citratus (Lemongrass)
Cymbopogon citratus (Lemongrass)Cymbopogon citratus (Lemongrass)
Cymbopogon citratus (Lemongrass)
Harley Lam Hoi Sun
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
semualkaira
 
Phytochemical and Biological Evaluation of Cichorium intybus L. Seeds
Phytochemical and Biological Evaluation of Cichorium intybus L. SeedsPhytochemical and Biological Evaluation of Cichorium intybus L. Seeds
Phytochemical and Biological Evaluation of Cichorium intybus L. Seeds
iosrjce
 
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
IOSR Journals
 
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
UniversitasGadjahMada
 

Similar to In vitro Antifungal and Antiproliferative Evaluation of a Trypsin Inhibitor from Testa of Citrullus lanatus Linn. (20)

Antioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leavesAntioxidant and-anticancer-activities-of-moringa-leaves
Antioxidant and-anticancer-activities-of-moringa-leaves
 
IJPTB 0004
IJPTB 0004IJPTB 0004
IJPTB 0004
 
Gp1
Gp1Gp1
Gp1
 
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
Protective Effect of Salacia Oblanga and Quercetin on Cyclophosphamide-Induce...
 
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
Evaluation of Hepatoprotective and Antioxidant activity of Euphorbia cyanthop...
 
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of PharmacyIOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
 
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of PharmacyIOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
IOSRPHR(www.iosrphr.org) IOSR Journal of Pharmacy
 
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
Efficacy Studies of Hepatoprotective Drug Isolated from Eclipta prostrata. L.
 
Ijpar 8 11
Ijpar 8 11Ijpar 8 11
Ijpar 8 11
 
Ijpar 8 11
Ijpar 8 11Ijpar 8 11
Ijpar 8 11
 
Cymbopogon citratus (Lemongrass)
Cymbopogon citratus (Lemongrass)Cymbopogon citratus (Lemongrass)
Cymbopogon citratus (Lemongrass)
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
Investigation on Effects of Methanolic and Aqueous Extracts of Seeds of Datur...
 
Phytochemical and Biological Evaluation of Cichorium intybus L. Seeds
Phytochemical and Biological Evaluation of Cichorium intybus L. SeedsPhytochemical and Biological Evaluation of Cichorium intybus L. Seeds
Phytochemical and Biological Evaluation of Cichorium intybus L. Seeds
 
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
Preliminary Phytochemical Screening and Antibacterial Activity on Stem Bark E...
 
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
Attenuation of Pseudomonas aeruginosa Virulence by Some Indonesian Medicinal ...
 

More from SSR Institute of International Journal of Life Sciences

Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
SSR Institute of International Journal of Life Sciences
 
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
SSR Institute of International Journal of Life Sciences
 
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
SSR Institute of International Journal of Life Sciences
 
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdfReview_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
SSR Institute of International Journal of Life Sciences
 
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdfKnowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
SSR Institute of International Journal of Life Sciences
 
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdfEffectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
SSR Institute of International Journal of Life Sciences
 
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdfEffectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
SSR Institute of International Journal of Life Sciences
 
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
SSR Institute of International Journal of Life Sciences
 
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdfDouble_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
SSR Institute of International Journal of Life Sciences
 
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdfCorrection_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
SSR Institute of International Journal of Life Sciences
 
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdfComparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
SSR Institute of International Journal of Life Sciences
 
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdfAssessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
SSR Institute of International Journal of Life Sciences
 
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdfReview_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
SSR Institute of International Journal of Life Sciences
 
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdfEvaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
SSR Institute of International Journal of Life Sciences
 
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdfTeleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
SSR Institute of International Journal of Life Sciences
 
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdfMindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
SSR Institute of International Journal of Life Sciences
 
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdfMaize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
SSR Institute of International Journal of Life Sciences
 
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdfWheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
SSR Institute of International Journal of Life Sciences
 
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
SSR Institute of International Journal of Life Sciences
 
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdfSeasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
SSR Institute of International Journal of Life Sciences
 

More from SSR Institute of International Journal of Life Sciences (20)

Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
Warm_Water_Foot_Bath_Reducing_Level_Fatigue_Insomnia_Chemotherapy_Cancer_Pati...
 
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
Socio_Economic_Cultural_Factors_Hospitalized_Patients_Alcoholic_Liver_Disease...
 
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
Prevalence_Treatment_Options_Abnormal_Uterine_Bleeding_Adolescent_Tertiary_Ca...
 
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdfReview_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
Review_Various_Types_Routes_Administration_Chondroitinase_Enzymes.pdf
 
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdfKnowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
Knowledge_Attitude_Caregivers_Old_Age_Health_Problems.pdf
 
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdfEffectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
Effectiveness_VATP_Uses_Moringa_Juice_Management_Anemia_Adolescent_Girls.pdf
 
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdfEffectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
Effectiveness_VATP_Knowledge_Water_Birth_Nursing_Students.pdf
 
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
Effectiveness_Teaching Programme_Knowledge_Foot_Reflexology_Post_Menopausa_Wo...
 
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdfDouble_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
Double_Primordial_Uterine_Vaginal_Atresia_Torsion_Left_Ovarian_Cyst_Pedicle.pdf
 
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdfCorrection_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
Correction_Cell_Phone_Addiction_Classroom_Alertness_Nursing_Students.pdf
 
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdfComparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
Comparative_Study_Direct_Layering_Centrifugation_Method_Embryo_Yeild.pdf
 
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdfAssessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
Assessment_Acromion_Morphology_Association_Shoulder_Impingement_Syndrome_MRI.pdf
 
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdfReview_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
Review_COVID_19_ Post_Pandemic_Emergencies_Health_Sectors.pdf
 
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdfEvaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
Evaluation_Soil_Properties_Different_Forests_Mid_Hills_Himachal_Himalayas.pdf
 
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdfTeleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
Teleophthalmology_Rural_India_Struggle_Boom_Research_Note.pdf
 
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdfMindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
Mindfulness_Based_Intervention_Treatment_Diseases_Acne_Eczema_Psoriasis.pdf
 
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdfMaize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
Maize_Yield_Affected_Periods_Weed_Interference_Southern_Guinea_Savannah_Zone.pdf
 
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdfWheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
Wheat_Importance_High_Quality_Protein_Effects_ Human_Health.pdf
 
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
Solid_State_Fermentation_Wheat_Bran_Production_Glucoamylase_Aspergillus_niger...
 
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdfSeasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
Seasonal_Incidence_Varietal_Response_Gram_Helicoverpa_armigera_Hubner.pdf
 

Recently uploaded

Prix Galien International 2024 Forum Program
Prix Galien International 2024 Forum ProgramPrix Galien International 2024 Forum Program
Prix Galien International 2024 Forum Program
Levi Shapiro
 
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIONDACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
DR SETH JOTHAM
 
263778731218 Abortion Clinic /Pills In Harare ,
263778731218 Abortion Clinic /Pills In Harare ,263778731218 Abortion Clinic /Pills In Harare ,
263778731218 Abortion Clinic /Pills In Harare ,
sisternakatoto
 
Charaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
Charaka Samhita Sutra sthana Chapter 15 UpakalpaniyaadhyayaCharaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
Charaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
Dr KHALID B.M
 
BRACHYTHERAPY OVERVIEW AND APPLICATORS
BRACHYTHERAPY OVERVIEW  AND  APPLICATORSBRACHYTHERAPY OVERVIEW  AND  APPLICATORS
BRACHYTHERAPY OVERVIEW AND APPLICATORS
Krishan Murari
 
Are There Any Natural Remedies To Treat Syphilis.pdf
Are There Any Natural Remedies To Treat Syphilis.pdfAre There Any Natural Remedies To Treat Syphilis.pdf
Are There Any Natural Remedies To Treat Syphilis.pdf
Little Cross Family Clinic
 
Knee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdfKnee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdf
vimalpl1234
 
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
VarunMahajani
 
Non-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdfNon-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdf
MedicoseAcademics
 
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptxHow STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
FFragrant
 
Ophthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE examOphthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE exam
KafrELShiekh University
 
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
Savita Shen $i11
 
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #GirlsFor Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
Savita Shen $i11
 
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Oleg Kshivets
 
Physiology of Special Chemical Sensation of Taste
Physiology of Special Chemical Sensation of TastePhysiology of Special Chemical Sensation of Taste
Physiology of Special Chemical Sensation of Taste
MedicoseAcademics
 
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.GawadHemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
NephroTube - Dr.Gawad
 
ARTIFICIAL INTELLIGENCE IN HEALTHCARE.pdf
ARTIFICIAL INTELLIGENCE IN  HEALTHCARE.pdfARTIFICIAL INTELLIGENCE IN  HEALTHCARE.pdf
ARTIFICIAL INTELLIGENCE IN HEALTHCARE.pdf
Anujkumaranit
 
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptxTriangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Dr. Rabia Inam Gandapore
 
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
GL Anaacs
 
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model SafeSurat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Savita Shen $i11
 

Recently uploaded (20)

Prix Galien International 2024 Forum Program
Prix Galien International 2024 Forum ProgramPrix Galien International 2024 Forum Program
Prix Galien International 2024 Forum Program
 
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIONDACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
 
263778731218 Abortion Clinic /Pills In Harare ,
263778731218 Abortion Clinic /Pills In Harare ,263778731218 Abortion Clinic /Pills In Harare ,
263778731218 Abortion Clinic /Pills In Harare ,
 
Charaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
Charaka Samhita Sutra sthana Chapter 15 UpakalpaniyaadhyayaCharaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
Charaka Samhita Sutra sthana Chapter 15 Upakalpaniyaadhyaya
 
BRACHYTHERAPY OVERVIEW AND APPLICATORS
BRACHYTHERAPY OVERVIEW  AND  APPLICATORSBRACHYTHERAPY OVERVIEW  AND  APPLICATORS
BRACHYTHERAPY OVERVIEW AND APPLICATORS
 
Are There Any Natural Remedies To Treat Syphilis.pdf
Are There Any Natural Remedies To Treat Syphilis.pdfAre There Any Natural Remedies To Treat Syphilis.pdf
Are There Any Natural Remedies To Treat Syphilis.pdf
 
Knee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdfKnee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdf
 
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
 
Non-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdfNon-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdf
 
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptxHow STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
 
Ophthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE examOphthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE exam
 
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
Phone Us ❤85270-49040❤ #ℂall #gIRLS In Surat By Surat @ℂall @Girls Hotel With...
 
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #GirlsFor Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
For Better Surat #ℂall #Girl Service ❤85270-49040❤ Surat #ℂall #Girls
 
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
 
Physiology of Special Chemical Sensation of Taste
Physiology of Special Chemical Sensation of TastePhysiology of Special Chemical Sensation of Taste
Physiology of Special Chemical Sensation of Taste
 
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.GawadHemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
Hemodialysis: Chapter 3, Dialysis Water Unit - Dr.Gawad
 
ARTIFICIAL INTELLIGENCE IN HEALTHCARE.pdf
ARTIFICIAL INTELLIGENCE IN  HEALTHCARE.pdfARTIFICIAL INTELLIGENCE IN  HEALTHCARE.pdf
ARTIFICIAL INTELLIGENCE IN HEALTHCARE.pdf
 
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptxTriangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
 
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
HOT NEW PRODUCT! BIG SALES FAST SHIPPING NOW FROM CHINA!! EU KU DB BK substit...
 
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model SafeSurat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
 

In vitro Antifungal and Antiproliferative Evaluation of a Trypsin Inhibitor from Testa of Citrullus lanatus Linn.

  • 1. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2, pp: 78-87 (ISSN: 2455-1716) Impact Factor 2.4 MARCH-2016 http://ijlssr.com IJLSSR © 2015 All rights are reserved In vitro Antifungal and Antiproliferative Evaluation of a Trypsin Inhibitor from Testa of Citrullus lanatus Linn. Sreenu Barla1 , Dowluru Svgk Kaladhar2 *, Narasinga Rao V3 1,3 Department of Biochemistry, GIS, GITAM University, Visakhapatnam-530045, India 2 HOD (Microbiology and Bioinformatics), Bilaspur University, Bilaspur 495001, India ABSTRACT- Medicinal plants contain valuable sources of biological components that are helpful in control and cure of ageing diseases. Protein component present in various parts of the medicinal plants is the rich sources of medicine that contains a permanent cure for several diseases. The studies on edible sources like C. lanatus testa (or seed coat) are to be conducted to understand, the better action against human diseases. The purified inhibitor is separated by SDS PAGE and analyzed by MS-MASCOT shown sequence as “MQDVKTYPPAAPVPATPRFGSLAG SLIEINR”. The C. lanatus testa crude extracts were revealed good antifungal activity against A. niger (18mm) and C. albicans (13mm). The C. lanatus testa purified extracts were revealed good antifungal activity against A. niger (21 mm) and C. albicans (20mm). Fluconazole was used as a fungal standard, shown inhibition zone for A. niger (14mm) and C. albicans (20mm). The C. lanatus Trypsin Inhibitor (CLTI) extracts from testa at 100µg/ml were shown good activity with A. niger acting as antifungal agent compared to standard antibiotic (Fluconazole). The C. lanatus testa Trypsin inhibitor, it is also shown good results for anti-proliferative activity. The results were shown good antiproliferation activity with MCF-7 (Breast Cancer) cell line due to gradual decrease in the percentage of cell survival. The IC50 for standard drug (Tamoxifen) with MCF-7 (Breast Cancer) cell line was shown as 12µg/ml. The IC50 of CLTI peptide was shown as 60µg/ml and crude as 190µg/ml. The IC50 for standard drug (Tamoxifen) with Hep-G2 (Liver Cancer) Cell line is shown as11 µg/ml. The IC50 of CLTI peptide with Hep-G2 (Liver Cancer) Cell line was shown as 41 µg/ml and C. lanatus testa crude extract as 144 µg/ml. The experimentation concludes that serine protease inhibitors present in testa of C.lanatus shown both antifungal and antiproliferative properties. Key Words- C. lanatus testa, Trypsin inhibitor, Antifungal activity, Antiproliferative activity, Breast and liver cell lines -------------------------------------------------IJLSSR----------------------------------------------- INTRODUCTION Most of the prominent experts have compiled comprehen- sive and survey of research in science and allied disciplines [1]. Analyses of the challenges are performing through high Received: 22 Jan 2016/Revised: 16 Feb 2016/Accepted: 28 Feb 2016 quality science research as a main context of the broader information systems community [2]. An advance in genetics, biotechnology, phytochemistry and engineering involves research leading to new manufacturing concepts for the production of medicinal compounds that can lead to a new manufacturing model [3]. Several governments have focused on medicinal plants that provide more sustain study in the subject of drug production [4]. The medicinal plant, C. lanatus belongs to * Address for Correspondence: Dr. DSVGK Kaladhar Dept. of Microbiology and Bioinformatics Bilaspur University Bilaspur (C.G.), India (M): 9885827025 Research Article (Open access)
  • 2. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved Cucurbitaceae family is using as fruit and vegetable from the past decades. The fruits and seeds of this plant are helpful in the control of aging diseases like diabetes and cancer. One of the prerequisites in the primary health care is the availability in the use of sustainable drugs from plants that have a common source of medicaments. The plants form traditional preparations are pure, active principles from extracts that have actions or uses in therapy [5]. Traditional plants medicines are used throughout the world that clean only depicts that are important in health and economy [6]. The inhibition of proteinase by protease inhibitor is an example of protein-protein interaction, where the special features of tie binding of two partners form complex structures [7]. A characterization of Helicover paarmigera contains proteinases and the interaction with proteinase inhibitors using x-ray film contact print technique has been experimented basis on basic method [8]. Enzyme inhibitors combine with enzymes to covalently make them inactivate irreversibly. The irreversible inhibi- tors are toxic substances and they may be natural or syn- thetic. Serine proteases like trypsin can be assayed for its activity in the presence of appropriate irreversible inhibi- tors to study their inhibitory effects of an enzyme activity. Enzyme activity is influenced by metal ions. The activity depends on the nature of various amino acid residues present at the active site of the enzyme. The effect of several metal ions can be studied by examining the enzyme activity in the presence of metal containing salts. Plants have well-established class of inhibitors called Serine protease inhibitors that show resistance against microorganisms. Protease inhibitors will able to disruption cell damage and enhance the cell's life-span [9]. Plants produce various peptides and proteins that are extracted and purified which act as antimicrobials [10]. A novel method can be used for development of novel antimicrobial agents. Homologous inhibitor show molecular modelling and dynamics studies that are measured with Escherichia coli trypsin and chymotrypsin proteins. The interactions are provided based on inhibitor–enzyme docking studies [11]. Protease inhibitors ALLN and ALLM are of calpain and cathepsin proteases inhibitor that shows antiproliferative activity [12]. The action of Bowman-Birk protease inhibitor from leguminous family was shown antitumor and antiproliferative properties [13]. Aprotinin, pepstatin, and soybean trypsin inhibitor exhibit anticancer properties [14]. L. acutangula (var) Amara annual herb is belonging to the family, Cucurbitaceae contains ribosome-inactivating proteins, monocotyledon mannose-binding lectins, amaranthins and Cucurbitaceae phloem lectins act as antiproliferative activity [15]. Calf serum (FCS), Dulbec- co's Modified Eagle medium (DMEM), paclitaxel (PTX), EDTA, trypsin, penicillin, amphotericin exhibit a powerful antiproliferation [16]. Protein inhibitors of trypsin from the seeds of cucurbitaceae plants have shown a good antiproli- ferative activity [17]. MATERIALS AND METHODS Collection of C. Lanatus fruits In the present experiment, Citrullus lanatus fruits were collected from the fields of Visakhapatnam district, AP, India during March to June 2011. The plants are authenti- cated by Dr. P.V. Arjun Rao, Ethanobotanist, Dept. of Botany, Phytopharma Technology Laboratory, Visakhapat- nam (No. Res/2 dated 21-09-2010). Citrullus lanatus., on comparison with the details given in “FLORA OF THE PRESIDENCY OF MADRAS” by J.S. Gamble, Volume i, Page nos.534-536, Bishen Singh Mahendra Pal Singh pub- lishers, India (2004) and “Flowering plants from Chittoor district, Andhra Pradesh, India” by K. Madhava Chetty, K. Sivaji and K. TulasiRao, First edition published by students offset printers, Thirupathi, India, pp. 137-139 (2008). Preparation of Crude Extract The seeds present in the fruits are collected and dried for two days. The testa is separated and crushed to a fine
  • 3. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved powder using motar and pestle. The fine testa powder is selected for the present experimentation. The testa powder was depigmented, dehydrated, and defat- ted by washing with acetone for several times, followed by hexane and Folch’s mixture (chloroform: methanol, 2:1) and with 1% PVP. The solvents were removed by filtration and the powder air-dried. Testa powder was homogenized in 100 ml of 0.1M phosphate buffer pH 7.0 and the extract was prepared in 500 ml conical flask. The homogenate was mixed by incubating the extract in a rotary shaker at 120 rpm for 30 minutes at room temperature. Then the cell de- bris was removed by the slurry filtered through cheesec- loth. The filtrate was collected and centrifuged at 10,000 rpm for 15 minutes at 4°C [18]. The crude extract appears as a clear supernatant was selected for further precipitation of inhibitor by Ammonium sulphate precipitation. Ammonium sulphate precipitation and dialysis Citrullus lanatus testa protein was precipitated by the Ammonium sulfate precipitation method. The protein isolation was done based on the method done by Englard and Seifter, 1990 [19]. The unwanted proteins are removed by ammonium sulphate precipitation and at the same time the protein of interest could be concentrated. Varying concentrations of ammonium sulphate (30%, 50%, 70% and 90%) to the crude extract was kept at 4˚C for about one day precipitation to optimize the selected protease inhibitor. The precipitated protease inhibitor was collected by centri- fugation of extract at 10,000 rpm at 4˚C for 15 minutes. The precipitated protein was further dialyzed against 0.01M phosphate buffer (pH 7.0) to remove the ammonium sulphate present in the precipitate as details given below. The dialysis tube (Sigma-Aldrich) was washed in running water for about 3-4 hrs. The tube was rinsed with the 0.3% (w/v) solution sodium sulfide at 80°C for 1 minute. After washing with hot water (60°C) for 2 minutes, the solution was acidified with 0.2% sulphuric acid (v /v) and rinsed with hot water (60°C).The process is done to build the pores of the tube more clear. Tube will be opened, then pack the sample solution and this packed solution was keep in 0.01M phosphate buffer. This method has helped to removal of salts in the sample solution. Finally the protein was lyophilized and subjected to various analytical techniques and also used in the further purification. Purification of Trypsin Inhibitor Ion Exchange Chromatography The active protease inhibitor fraction that was attained after the process of dialysis by ammonium sulphate precipitation was purified by Ion exchange chromatography using an anion exchanger called DEAE cellulose. Proteins obtained due to surface charge will bind to ion exchangers. The reversibly adsorbed proteins were eluted out by using either through a salt gradient or pH. Activation of DEAE Cellulose The DEAE cellulose 10g was soaked in double distilled water, allowed to settle, and the fine particle was removed by decanting. It was then suspended in 0.1M HCl for overnight. Remove the hydrochloric acid and wash with double distilled water, then add 0.1M NaOH incubate for overnight. Decanted the sodium hydroxide solution and washed several times with distilled water in a sintered glass funnel using vacuum filtration, until the pH of the washings became neutral. Equilibration of the resin in appropriate buffer by repeated washings with the same buffer was conducted. Purification Using DEAE Cellulose Column DEAE cellulose activated as carefully packed up (1.5X30cm) column and was equilibrated with phosphate buffer pH 7.0. A protein content of 4.1mg/ml from 30 ml of the dialyzed sample was used in the pre-equilibrated DEAE cellulose column. The complete addition of sample into pre-equilibrated DEAE cellulose column was connected to the reservoir that contains the phosphate buffer that adjusted with a flow rate of 2 ml per minute. The unbound proteins obtained were washed out until
  • 4. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved absorbance reached near to zero at 280 nm. An elution was completed at a flow rate of 2ml per minute using gradients stepwise with sodium chloride that ranges from 0.1 to 0.5M that was prepared in 0.01M phosphate buffer at 7.0 pH. About 2 ml of fractions from columns were collected and the protein content of each fraction was being estimated by measuring the OD at 280 nm. The peak fractions from the column were then pooled and were again dialyzed against the 0.01M phosphate buffer at pH 7.0. The dialyzed frac- tions from testa of C. lanatus were assayed for protease inhibitory activity, protein content and specific activity. Gel Filtration on Sephadex G -50 Sephadex G-50 activated as carefully packed up (1.5X50 cm) column without any air bubble and the column was equilibrated with 0.1M phosphate buffer pH 7.0. The samples were dissolved in 0.1M phosphate buffer pH 7.0, that samples were loaded on sephadex G-50 column. The column was previously equilibrated with 0.1M phosphate buffer pH7.0 and the sample was eluted in the same buffer with a flow rate of 2 ml/minute, 2 ml fractions were collected at a flow rate of 120ml per hour and protein absorbance was measured at 280 nm. Calculation of yield of protein or protease inhibitor activity of each fraction during purification is the percent activity obtained by dividing the total protein content or activity of that fraction with the total protein content or activity of the crude extract. Fold of purification in each step was calculated by dividing the specific activity of the respective fraction with that of the crude extract. The purified inhibitor is further purified by SDS PAGE and analysed by MASCOT. Antifungal Activity The antifungal activity was conducted based on zone method. Microorganisms Microbes from ATCC (American Type Culture Collection), USA have been used in the present study. The fungi used in the present experimentation are Aspergillus niger (ATCC 6275) and Candida albicans (ATCC 10231). Antifungal Activity Using Zone Method Antifungal tests were carried out by agar well diffusion method [20]. About 8 mm wells on inoculated Sabouraud dextrose agar plates were filled with 10, 25, 50, 100 µg/ml of crude and Purified proteins respectively that is made in 10% DMSO. The Flucanozole used (10 µg/ml) as positive reference standard. The agar plates were incubated for 48 hours at 25˚ C. The antifungal activity was assessing quan- titatively by the absence or presence of inhibition zones and zone diameters. Antiproliferative Activity As the crude and isolated protein extracts has shown effi- cient antifungal activities, a preliminary investigation has been made for finding antiproliferative effects of crude and isolated samples from testa of C. lanatus on MCF-7 (Breast Cancer) and Hep –G2 (Liver Cancer) cell lines. The cell lines were procured from National Centre for Cell Science, Pune. The whole cells have been grown in Minimal essential medium (MEM, GIBCO) was being supple- mented with 4.5 g/L glucose, 5% fetal bovine serum (FBS) (growth medium) and 2 mM L-glutamine and at 37°C in 5% CO2 incubator. By using MTT assay, can determine the inhibitory effects of sample compounds on cell growth in vitro, these assay developed by Mosmann and was modified has been used . The T-25 flask is a 96-well flat-bottomed tissue culture plate. In the culture plate each well seeded with trypsinized
  • 5. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved cells. Each well density of cell culture was maintained at 5x103 cells/ well in the growth medium and cultured at 37°C in 5% CO2 to adhere. Culture cells were incubated upto 48 hrs, after the Incubation, the supernatant was discarded. The cells were mixed with various concentrations of sam- ple compounds (6.25, 12.5, 25, 50, 100 and 200 µg/ml) used to bring about a final volume of 100 µl, before that cells were pretreated with growth medium and then cell were cultured for 48 hours. The sample compound was equipped as 1.0 mg/ml stock solutions in PBS. In this assay used controls are Solvent and culture medium. Each well contains 5 µl of fresh MTT, add about 0.5mg/ml in PBS and then incubate for 2 hoursr at 37°C. The supernatant contains growth medium, supernatant removed from the wells and for solubilize the colored formazan product added 100 µl of DMSO. Incubate upto 30 min, by using ELISA reader (Anthos 2020 spectrophotometer) colored culture product absorbance read (OD) at wavelength of 572 nm. RESULTS AND DISCUSSION The peptide sequenced in MALDI was selected for in vitro analysis. The sequence of the peptide sequence shown by the Mascot report was shown below: >gi|296399226|gb|ADH10401.1| photosystem I subunit IX [Selaginella moellendorffii] MQDVKTYPPAAPVPATPRFGSLAGSLIEINRLSPDAP VSPPA The plant extract and purified C. lanatus Trypsin Inhibitor (CLTI) peptide was analyzed for antifungal activity against various test microorganisms. All the prepared extracts were shown good antifungal activity. The antifungal activity results were represented in Table 1 and 2. The C. lanatus testa isolated extracts was revealed good antifungal activity against A. niger (21 mm) and C. albi- cans (20mm). The C. lanatus testa crude extracts was revealed good antifungal activity against A. niger (18mm) and C. albicans (13mm). Fluconazole has used for fungal standard shown inhibition zone for A. niger (14mm) and C. albicans (20mm) (Table 1 and 2). The protein and C. lanatus Trypsin Inhibitor (CLTI) extracts from testa at 100µg/ml was shown good antifungal activities compared to standard antibiotic. Table 1: Antifungal activity of Crude protein extract from Test of C. lanatus The potential and active compounds to develop the antimi- crobial compounds from medicinal plants appeared worthy which leads to the improvement of phytomedicine used against microbes. Due to fewer side effects that are frequently associated with synthetic antimicrobials, the Plant-based-antimicrobials have huge therapeutic potential [21]. Table 2: Antifungal activity of Trypsin inhibitor from C. lanatus testa purified The C. lanatus testa crude and Trypsin inhibitor has also shown good results for anti-proliferative activity. Table 3 was shown the dose response of C. lanatus testa crude, Trypsin inhibitor and standard (Tamoxifen) against MCF-7 (Breast Cancer) cell line. The results were shown good cancer inhibition due to gradual decrease in the percentage of cell survival. Fig. 1 shows Standard IC50 was shown as Fungi Zone of Inhibition in mm Crude protein extract DMS O (Con- trol) Flucona- zole (Stan- dard) 10µg/ ml 25µg /ml 50µg /ml 100µg /ml Candida albi- cans - - 10 13 - 20 Aspergillus niger 11 12 14 18 - 14 Fungi Zone of Inhibition in mm C. lanatus purified testa extract DMS O (Con- trol) Fluco- nazole (Stan- dard) 10µg/ ml 25µg/ ml 50µg/ ml 100µ g/ml Candida albicans - - 18 20 -- 20 Aspergillus niger - 12 20 21 -- 14
  • 6. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved 12µg/ml. The IC50 of CLTI was shown as 60µg/ml and crude as 190µg/ml. Fig. 2 shows antiproliferative effects of C. lanatus testa isolated extract on MCF-7 (Breast Cancer) cell line. Table 3: Dose Response of C. lanatus testa crude and Trypsin inhibitor MCF-7 (Breast Cancer) cell line Conc. (in µg /ml) Tamoxifen Crude extract Isolated extract % of Cell survival % of Cell inhi- bition % of cell survival % of cell inhi- bition % of cell survival % of cell inhi- bition 6.25 82.3 17.7 97.8 2.2 93.5 6.5 12.5 45.5 54.5 84.1 15.9 89.5 10.5 50 30.9 69.1 76.7 23.3 56.4 43.6 100 16 84 58.5 41.5 32.3 67.7 200 4.9 95.1 49 51 21.2 78.8 250 0.4 99.6 30 70 13.4 86.6 Fig. 1: Graphical representation for Antiproliferative activity of C. lanatus testa crude and Trypsin inhibitor on MCF-7 (Breast cancer) cell line Fig. 2: Antiproliferative activity of Trypsin inhibitor from C. lanatus testa on MCF-7 (Breast Cancer) cell line be- fore and after treatment
  • 7. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved Table 4 was shown the dose response of C. lanatus testa crude, Trypsin inhibitor and standard (Tamoxifen) against Hep –G2 (Liver Cancer) Cell line. The results were shown good cancer inhibition due to gradual decrease in the percen- tage of cell survival. Fig. 3 shows Standard IC50 as 11 µg/ml, the IC50 of CLTI peptide as 41 µg/ml and crude as 144 µg/ml. Fig. 4 shows antiproliferative effects of C. lanatus testa isolated extract on Hep –G2 (Liver Cancer) Cell line. Table 4: Dose Response of C. lanatus testa crude and Trypsin inhibitor on Hep –G2 (Liver Cancer) Cell line Conc. (in µg /ml) Tamoxifen Crude extract Isolated extract % of cell survival % of cell inhibition % of cell survival % of cell inhibition % of cell surviv- al % of cell inhibition 6.25 82.3 17.7 94 6 89.7 10.3 12.5 45.5 54.5 87.9 12.1 65.8 34.2 50 37.4 62.6 70.1 29.9 45.5 54.5 100 29.2 70.8 58.4 41.6 38.6 61.4 200 21 79 39.7 60.3 31.5 68.5 250 11.2 88.8 22.2 77.8 13.6 86.4 Fig. 3: Graphical representation of antiproliferative activity of C. lanatus testa crude and Trypsin inhibitor on Hep –G2 cell line
  • 8. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved Fig. 4: Antiproliferative activity of Trypsin inhibitor from C. lanatus testa on Hep –G2 cell line Gram-positive and Gram-negative bacteria were capable to bind with rMjSerp1 through the reaction estimated by the microorganism binding assay. The rMjSerp1 acts as a mi- crobial serine protease inhibitor such as subtilisin A and proteinase K [22]. Various external secretions consists se- rine proteases that are inhibited by endogenous inhibitors like Antileukoprotease (ALP), or secretory leukocyte pro- teinase inhibitor. Antileukoprotease (ALP) comprises two homologous domains, one of the domains contain protei- nase inhibitory activities that are located in the COOH- terminal domain, and the NH2-terminal domain function is unknown. The E. coli or S. aureus was incubated with intact ALP or its isolated first domain and resulted in killing of these bacteria [23]. Antimicrobial peptides (AMPs) have central role in infection and inflammation [24]. The protozoan parasite Toxoplasma gondii asexual development were affected by serine protease inhibitors like 3,4-dichloroisocoumarin and 4-(2-aminoethyl)- benzenesulfonyl fluoride and these were prevented invasion of the host cells [25]. Plants protease inhibitors can potently inhibited the growth of bacterial and fungal pathogenic strains. PIs are excellent agents for development of novel antimicrobial agents [26]. Potato tuber has antifungal protein (AFP-J), AFP-J was pu- rified and strongly inhibited yeast fungal strains like Can- dida albicans, Trichosporon beigelii and Saccharomyces cerevisiae, AFP-J could not inhibited the crop fungal pa- thogens [27]. The Momordica cochinchinensis (MCo) squash seeds consist three trypsin inhibitors (TIs), these inhibitors have been isolated and purified using gel filtra- tion and used as anti fungal agents [28]. CONCLUSION The present experimentation was shown good PIs of C. lanatus testa having antifungal and antiproliferative activi- ties. Hence Trypsin inhibitor from testa of Citrullus lanatus has good biological activities. CONFLICT OF INTERESTS The author declares that there is no conflict of interests re- garding the publication of this paper. ACKNOWLEDGEMENT The authors would like to thank the management and staff of GITAM University, India for their kind support in bring- ing out the above literature and providing lab facilities. REFERENCES [1] Gabel DL. Handbook of research on science teaching and
  • 9. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved learning project. Macmillan Publishing Company, Division of Macmillan, Inc., 866 Third Avenue, New York, NY 10022: 1993. [2] Hevner AR, March ST, Park J, and Ram S (Design science in information systems research). MIS quarterly, 2004; 28(1): 75-105. [3] Ragauskas AJ, Williams CK, Davison BH, Britovsek G, Cair- ney J, Eckert CA and Tschaplinski T (The path forward for biofuels and biomaterials). Science, 2006; 311(5760): 484- 489. [4] Kirtikar KR, and Basu BD (Indian Medicinal Plants). Indian Medicinal Plants, 1918; 72. [5] Farnsworth NR, Akerele O, Bingel AS, Soejarto DD, and Guo Z (Medicinal plants in therapy). Bulletin of the world health organization, 1985; 63(6):965. [6] Jamil A, Shahid M, Khan MM, and Ashraf M (Screening of some medicinal plants for isolation of antifungal proteins and peptides). Pakistan Journal of Botany, 2007;39. [7] Bieth J. Some kinetic consequences of the tight binding of protein-proteinase-inhibitors to proteolytic enzymes and their application to the determination of dissociation constants. In Proteinase Inhibitors Springer Berlin Heidelberg, 1974; 463- 469. [8] Harsulkar AM, Giri AP, Gupta VS, Sainani MN, Deshpande VV, Patankar AG, and Ranjekar PK (Characterization of He- licoverpaarmigera gut proteinases and their interaction with proteinase inhibitors using gel X‐ray film contact print tech- nique). Electrophoresis, 1998; 19(8‐9): 1397-1402. [9] Mandal SM, Porto WF, De D, Phule A, Korpole S, Ghosh AK, Sanat KR, and Franco OL (Screening of serine protease inhibitors with antimicrobial activity using iron oxide nano- particles functionalized with dextran conjugated trypsin and in silico analyses of bacterial serine protease inhibition). Analyst, 2014; 139(2): 464-472. [10] Milisav I, Poljsak B, and Šuput D (Adaptive response, evi- dence of cross-resistance and its potential clinical use). In- ternational journal of molecular sciences, 2012; 13(9): 10771-10806. [11] Santi MM, William FP, Debasis D, AjitPhule, Suresh K, Ananta KG, Sanat KR, and Octavio LF (Screening of serine protease inhibitors with antimicrobial activity using iron oxide nanoparticles functionalized with dextran con- jugated trypsin and in silico analyses of bacterial serine protease inhibition). Analyst, 2014; 139: 464-472. [12] An WG, Hwang SG, Trepel JB, and Blagosklonny MV (Pro- tease inhibitor-induced apoptosis: accumulation of wt p53, p21 WAF1/CIP1, and induction of apoptosis are in- dependent markers of proteasome inhibition). Leukemia, 2000; 14(7): 1276–1283. [13] Ho VSM, and NG TB (A Bowman-Birk trypsin inhibitor with antiproliferative activity from Hokkaido large black soybeans). J. Peptide Sci., 2008; 14: 278–282. [14] Ly LH, Zhao XY, Holloway L, and Feldman D (Liarozole Acts Synergistically with 1α, 25-Dihydroxyvitamin D3 to Inhibit Growth of DU 145 Human Prostate Cancer Cells by Blocking 24-Hydroxylase Activity 1). Endocrinology, 1999; 140(5): 2071-2076. [15] Kabir SR, Zubair MA, Nurujjaman M, Haque MA, Hasan I, Islam MF, and Absar N (Purification and characterization of a Ca2+-dependent novel lectin from Nymphaea nouchali tuber with antiproliferative activities). Bioscience reports, 2011; 31(6): 465-475. [16] Vanajothi R, Sudha A, Manikandan R, Rameshthangam P, and Srinivasan P (Luffa acutangula and Lippia nodiflora leaf extract induces growth inhibitory effect through in- duction of apoptosis on human lung cancer cell line). Bio- medicine and Preventive Nutrition 2012; 2(4): 287-293. [17] Dibyendu DM (Recent updates on pharmaceutical potential of plant protease inhibitors). International Journal of Medicine and Pharmaceutical Science, 2013; 3(4): 101- 120. [18] Pichare MM, and Kachole MS (Detection of electrophoreti- cally separated protease inhibitors using X-ray film). Journal of biochemical and biophysical methods, 1994; 28(3): 215-224. [19] Englard S, and Seifter S (Precipitation techniques). Methods Enzymol, 1990; 182: 285-300. [20] Kaladhar DSVGK, Geetha S, Varahalarao V, and Nagendra SY (Anti-dandruff activity of ethanolic extract of Sapin- dus), IJAPSBS, 2013; 2(3): 149-155. [21] Hema TA, Arya AS, Suseelan S, Celestinal RJ and Divya PV (Antimicrobial activity of five south Indian medicinal
  • 10. Int. J. Life. Sci. Scienti. Res., VOL 2, ISSUE 2 http://ijlssr.com IJLSSR © 2015 All rights are reserved plants against clinical pathogens). International Journal of Pharma and Bio Sciences, 2013; 4(1): 70-80. [22] Zhao YR, Xu YH, Jiang HS, Xu S, Zhao XF, and Wang JX (Antibacterial Activity of Serine Protease Inhibitor 1 from Kuruma Shrimp Marsupenaeus japonicas). Developmental and Comparative Immunology. 2014; 44(2): 261-269. [23] Hiemstra PS, Maassen RJ, Stolk J, Heinzel-Wieland R, Steffens GJ, and Dijkman JH (Antibacterial activity of an- tileukoprotease). Antibacterial activity of antileukoprotease, 1996; 64(11): 4520-4524. [24] Lai Y, and Gallo RL (AMPed up immunity: how antimicro- bial peptides have multiple roles in immune defense). Trends in immunology, 2009; 30(3): 131-141 [25] Conseil V, Soete M, and Dubremetz JF (Serine protease in- hibitors block invasion of host cells by Toxoplasma gondii). Antimicrobial agents and chemotherapy, 1999; 43(6): 1358- 1361. [26] Kim JY, Park SC, Hwang I, Cheong H, Nah JW, Hahm KS, and Park Y (Protease inhibitors from plants with antim- icrobial activity). International journal of molecular sci- ences, 2009; 10(6): 2860-2872. [27] Park Y, Choi BH, Kwak JS, Kang CW, Lim HT, Cheong HS, and Hahm KS (Kunitz-type serine protease inhibitor from potato (Solanum tuberosum L. cv. Jopung)). J.Agric Food Chem, 2005; 53(16): 6491-6496. [28] Hernandez JF, Gagnon J, Chiche L, Nguyen T M, Andrieu JP, Heitz A, and Le Nguyen D (Squash trypsin inhibitors from Momordica cochinchinensis exhibit an atypical mac- rocyclic structure). Biochemistry, 2000; 39(19): 5722- 5730.