In this ppt one can know the diiferent softwares and several online servers for the epitope mapping.This mapping helpful for production of different vaccines and antibodies.
SYNTHETIC PEPTIDE VACCINES AND RECOMBINANT ANTIGEN VACCINED.R. Chandravanshi
What is a Vaccine?
A vaccine is a substance that is introduced into the body to prevent infection or to control disease due to a certain pathogen (a disease-causing organism, such as a virus, bacteria or parasite). The vaccine “teaches” the body how to defend itself against the pathogen by creating an immune response.
1 Unlike traditional pharmaceuticals, vaccines are biologics since they are made from living organisms (biological sources).
2 Specifically, vaccines are preparations of components derived from (or related to) a pathogen; they can typically induce a protective effect through one to three very small doses, in the range of micrograms to milligrams.
3 Immunity lasts for an extended period, from one year up to lifetime protection, including prevention of disease and/or related sequelae.
Synthetic peptide vaccines represent fragments of protein antigen sequences, synthesizing specific B cell and T cell epitopes offer the potential to induce diseases neutralizing immuno response with completely synthetic structure. Now it is well established that short chain peptides can be used to mimic antigenic sites of viruses and thus can be used the basics for vaccines and development. therefore, attempts have been made to synthesize such peptides which act as the serrogate immuunogens, as an alternative to the existing conventional vaccines.
SYNTHETIC PEPTIDE VACCINES AND RECOMBINANT ANTIGEN VACCINED.R. Chandravanshi
What is a Vaccine?
A vaccine is a substance that is introduced into the body to prevent infection or to control disease due to a certain pathogen (a disease-causing organism, such as a virus, bacteria or parasite). The vaccine “teaches” the body how to defend itself against the pathogen by creating an immune response.
1 Unlike traditional pharmaceuticals, vaccines are biologics since they are made from living organisms (biological sources).
2 Specifically, vaccines are preparations of components derived from (or related to) a pathogen; they can typically induce a protective effect through one to three very small doses, in the range of micrograms to milligrams.
3 Immunity lasts for an extended period, from one year up to lifetime protection, including prevention of disease and/or related sequelae.
Synthetic peptide vaccines represent fragments of protein antigen sequences, synthesizing specific B cell and T cell epitopes offer the potential to induce diseases neutralizing immuno response with completely synthetic structure. Now it is well established that short chain peptides can be used to mimic antigenic sites of viruses and thus can be used the basics for vaccines and development. therefore, attempts have been made to synthesize such peptides which act as the serrogate immuunogens, as an alternative to the existing conventional vaccines.
Developing vaccines against infectious and epidemic diseases with the aid of Bioinformatics is now possible, by predicting epitopes on an antigen and finding possible targets for the antibody to bind. A new era of vaccine production is just ahead of us.
Watch out the ppt to know more!!!
One of the important parts in the study of Immunology.I prepared it for the sake of a seminar series competition conducted in my university. Now I thought of sharing it with others.
The ppt covers the following topic-
1.Introduction about antibody.
2. Types of antibody.
3.Genetic basis of antibody diversity.
4. Antibody diversity.
5.Light chain gene segment.
6. Mechanism of variable region DNA rearrangment.
7. Heavy chain gene segment.
8.Alternate splicing.
Developing vaccines against infectious and epidemic diseases with the aid of Bioinformatics is now possible, by predicting epitopes on an antigen and finding possible targets for the antibody to bind. A new era of vaccine production is just ahead of us.
Watch out the ppt to know more!!!
One of the important parts in the study of Immunology.I prepared it for the sake of a seminar series competition conducted in my university. Now I thought of sharing it with others.
The ppt covers the following topic-
1.Introduction about antibody.
2. Types of antibody.
3.Genetic basis of antibody diversity.
4. Antibody diversity.
5.Light chain gene segment.
6. Mechanism of variable region DNA rearrangment.
7. Heavy chain gene segment.
8.Alternate splicing.
ANTIGEN, HAPTEN, ALL TYPES OF ANTIGENS, IMMUNOGEN , ATTRIBUTES OF ANTIGENICITY, DETERMINANTS OF ANTIGENICITY,
IMMUNOLOGY KUBY, MEDICAL MICROBIOLOGY & IMMUNOLOGY OF PANIKER , LIPPINCOTT'S IMMUNOLOGY, OTHER SOURCES.
Structure of antigens and receptors, Genetic control of immune response, Antigens processing by antigen presenting cell, Role of MHC and accessory molecules, Antigen-antibody interactions
It includes general introduction to antibodies; Monoclonal antibodies; comparison between Polyclonal & Monoclonal antibodies; Hybridoma Technology & Hyridoma Selection; advantages & disadvantages of mABs; Applications of mABs; Recombinant Monoclonal antibodies production through Antibody Engineering.
VHIR Seminar led by Gerrit Borchard, Section of Pharmaceutical Sciences University of Geneva, University of Lausanne Biopharmaceutical Sciences Geneva Switzerland.
Abstract: In order to enhance the efficacy of vaccines, antigen and adjuvants are combined in particulate carrier systems resembling pathogens in size, shape and surface properties. These novelnano- and microcarriervaccines strategies, using DNA or subunit vaccines as antigens and specific ligands of receptors of the innate immune system,offer several advantages, such as enhanced immune recognition, direction of immune response bias, and enhancement of vaccine stability. We are focusing on eliciting protective immune responses against M. tuberculosis, a pathogen transmitted through inhalation, bydeveloping vaccine delivery systems composed of different materialsand administered by the mucosal route.
Operation “Blue Star” is the only event in the history of Independent India where the state went into war with its own people. Even after about 40 years it is not clear if it was culmination of states anger over people of the region, a political game of power or start of dictatorial chapter in the democratic setup.
The people of Punjab felt alienated from main stream due to denial of their just demands during a long democratic struggle since independence. As it happen all over the word, it led to militant struggle with great loss of lives of military, police and civilian personnel. Killing of Indira Gandhi and massacre of innocent Sikhs in Delhi and other India cities was also associated with this movement.
June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...Levi Shapiro
Letter from the Congress of the United States regarding Anti-Semitism sent June 3rd to MIT President Sally Kornbluth, MIT Corp Chair, Mark Gorenberg
Dear Dr. Kornbluth and Mr. Gorenberg,
The US House of Representatives is deeply concerned by ongoing and pervasive acts of antisemitic
harassment and intimidation at the Massachusetts Institute of Technology (MIT). Failing to act decisively to ensure a safe learning environment for all students would be a grave dereliction of your responsibilities as President of MIT and Chair of the MIT Corporation.
This Congress will not stand idly by and allow an environment hostile to Jewish students to persist. The House believes that your institution is in violation of Title VI of the Civil Rights Act, and the inability or
unwillingness to rectify this violation through action requires accountability.
Postsecondary education is a unique opportunity for students to learn and have their ideas and beliefs challenged. However, universities receiving hundreds of millions of federal funds annually have denied
students that opportunity and have been hijacked to become venues for the promotion of terrorism, antisemitic harassment and intimidation, unlawful encampments, and in some cases, assaults and riots.
The House of Representatives will not countenance the use of federal funds to indoctrinate students into hateful, antisemitic, anti-American supporters of terrorism. Investigations into campus antisemitism by the Committee on Education and the Workforce and the Committee on Ways and Means have been expanded into a Congress-wide probe across all relevant jurisdictions to address this national crisis. The undersigned Committees will conduct oversight into the use of federal funds at MIT and its learning environment under authorities granted to each Committee.
• The Committee on Education and the Workforce has been investigating your institution since December 7, 2023. The Committee has broad jurisdiction over postsecondary education, including its compliance with Title VI of the Civil Rights Act, campus safety concerns over disruptions to the learning environment, and the awarding of federal student aid under the Higher Education Act.
• The Committee on Oversight and Accountability is investigating the sources of funding and other support flowing to groups espousing pro-Hamas propaganda and engaged in antisemitic harassment and intimidation of students. The Committee on Oversight and Accountability is the principal oversight committee of the US House of Representatives and has broad authority to investigate “any matter” at “any time” under House Rule X.
• The Committee on Ways and Means has been investigating several universities since November 15, 2023, when the Committee held a hearing entitled From Ivory Towers to Dark Corners: Investigating the Nexus Between Antisemitism, Tax-Exempt Universities, and Terror Financing. The Committee followed the hearing with letters to those institutions on January 10, 202
Model Attribute Check Company Auto PropertyCeline George
In Odoo, the multi-company feature allows you to manage multiple companies within a single Odoo database instance. Each company can have its own configurations while still sharing common resources such as products, customers, and suppliers.
A Strategic Approach: GenAI in EducationPeter Windle
Artificial Intelligence (AI) technologies such as Generative AI, Image Generators and Large Language Models have had a dramatic impact on teaching, learning and assessment over the past 18 months. The most immediate threat AI posed was to Academic Integrity with Higher Education Institutes (HEIs) focusing their efforts on combating the use of GenAI in assessment. Guidelines were developed for staff and students, policies put in place too. Innovative educators have forged paths in the use of Generative AI for teaching, learning and assessments leading to pockets of transformation springing up across HEIs, often with little or no top-down guidance, support or direction.
This Gasta posits a strategic approach to integrating AI into HEIs to prepare staff, students and the curriculum for an evolving world and workplace. We will highlight the advantages of working with these technologies beyond the realm of teaching, learning and assessment by considering prompt engineering skills, industry impact, curriculum changes, and the need for staff upskilling. In contrast, not engaging strategically with Generative AI poses risks, including falling behind peers, missed opportunities and failing to ensure our graduates remain employable. The rapid evolution of AI technologies necessitates a proactive and strategic approach if we are to remain relevant.
The Roman Empire A Historical Colossus.pdfkaushalkr1407
The Roman Empire, a vast and enduring power, stands as one of history's most remarkable civilizations, leaving an indelible imprint on the world. It emerged from the Roman Republic, transitioning into an imperial powerhouse under the leadership of Augustus Caesar in 27 BCE. This transformation marked the beginning of an era defined by unprecedented territorial expansion, architectural marvels, and profound cultural influence.
The empire's roots lie in the city of Rome, founded, according to legend, by Romulus in 753 BCE. Over centuries, Rome evolved from a small settlement to a formidable republic, characterized by a complex political system with elected officials and checks on power. However, internal strife, class conflicts, and military ambitions paved the way for the end of the Republic. Julius Caesar’s dictatorship and subsequent assassination in 44 BCE created a power vacuum, leading to a civil war. Octavian, later Augustus, emerged victorious, heralding the Roman Empire’s birth.
Under Augustus, the empire experienced the Pax Romana, a 200-year period of relative peace and stability. Augustus reformed the military, established efficient administrative systems, and initiated grand construction projects. The empire's borders expanded, encompassing territories from Britain to Egypt and from Spain to the Euphrates. Roman legions, renowned for their discipline and engineering prowess, secured and maintained these vast territories, building roads, fortifications, and cities that facilitated control and integration.
The Roman Empire’s society was hierarchical, with a rigid class system. At the top were the patricians, wealthy elites who held significant political power. Below them were the plebeians, free citizens with limited political influence, and the vast numbers of slaves who formed the backbone of the economy. The family unit was central, governed by the paterfamilias, the male head who held absolute authority.
Culturally, the Romans were eclectic, absorbing and adapting elements from the civilizations they encountered, particularly the Greeks. Roman art, literature, and philosophy reflected this synthesis, creating a rich cultural tapestry. Latin, the Roman language, became the lingua franca of the Western world, influencing numerous modern languages.
Roman architecture and engineering achievements were monumental. They perfected the arch, vault, and dome, constructing enduring structures like the Colosseum, Pantheon, and aqueducts. These engineering marvels not only showcased Roman ingenuity but also served practical purposes, from public entertainment to water supply.
2. Antigen-antibody interaction
• Antigen is recognized by the immune system and stimulates an
antibody response
• Can be a bacteria, virus, a protein…
• Originally the term antigen came from antibody generator
Antigen
3. An
• Antigen is recognized as foreign by the immune system and
is engulfed by antigen presenting cells, such as macrophages,
monocytes and dendritic cells
Antigen presenting cell
Antigen
Antigen-antibody interaction
4. Antigen-antibody interaction
• The antigen is degrated into smaller fragments and displayed
on the cell surface together with specialized glycoproteins
Antigen presenting cell
Antigen
6. Antigen-antibody interaction
• T-cells stimulate B-cells to produce
antibodies towards the specific antigen
Antigen presenting cell
T-cell
B-cell
Antibodies
Antigen
9. Antigen presenting cell
T-cellSelf protein
(auto-antigen)
B-cell
Auto-antibodies
• Abnormal functioning of the immune system, it fails to recognize
protein/tissue ~ antibody response is produced against these
• A disease that results from such an immune response is termed an
autoimmune disease
Auto-immune disease
10. Epitope mapping
• Epitope mapping is the process of identifying the binding
sites of antibodies on their target antigens
• Several strategies for epitope mapping exist:
recombinant proteins
X-ray co-crystallography
phage-display
peptide scanning
truncated resin-bound peptides
Through Bioinformatical analysis
11. Need
Used for vaccine development against influenza,small
pox,pertusis
mAB and Polyclonal antobodies production.
To know the antigen-antibody interaction.
12. Why epitope mapping ??
Conventional vaccine production is time consuming.
Atteneuated or killed pathogen may cause disease in
host genome.
To know the different consensus and conserved
sequence which forms epitopes.
13. Epitope based vaccine
Immunoprotective and immuno dominat epitopes are
used.
rDNA technology is used for multitarget vaccine
production.
Linear epitope or conformational epitope is used.
Also used as adjuvents. e.g T cell epitopes.
14.
15. Prediction of potential T- cell
binding-epitopes
Interaction occures between R groups of epitope and
Grooves/pocket of MHC molecules.
RANKEP –online server predicts peptides binders to
MHC-I and MHC-II alleles.
PSSM(position specific scoring matrices) algorithim is
used in RANKEP.
16. Lets take an example
>A56881 PIR2 release 71.00
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKH
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELA
HYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMP
EGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVIL
YSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGI
AEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQ
KVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVH
EIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADS
SIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRI
SKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPM
FKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS
VSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPD
RPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQA
AAETLSEVA
Protein blast was done to know the function of this protein
28. PREDICTION OF B-CELL BINDING
EPITOPES
B cell epitopes are recognized by B cell receptors or
antibodies in their native structure.
Score is calculated on the bais of AA properties such as
hydrophilicity,charge,exposed surface area and secondary
structures.
Different online server are present for continuous and
discontinous B-cell epitopes.
It has been tested on B cell epitope database (BCIPEP),
and will therefore presumbly have better performance for
prediction of B cell epitope of the antigen. Bcepred can
predict continuous B cell epitopes.
32. CONCLUSION
Epitope mapping gives high throughput analysis of
dfferent candidate sequences for prediction of
potential epitopes.
Less time consuming and less expensive.
Editor's Notes
Imagine that we have an antigen. An Antigen, is a molecule, usually foreign, which is recognized by the immune system and stimulates a antibody response. Originally the term came from antibody generator. An antigen can be a bacteria, virus, a protein, a lipid, carbohydrate…..
This antigen is recognized as foreign by the immune system and the antigen is engulfed by antigen presenting cells
The antigen is degrated into smaller fragments and displayed on the cell surface together with specialized glycoproteints.
T-Cells will recognize the antigen-glycoprotein complex
T-Cells stimulate B-cells to produce antibodies towards the specific antigen. These antibodies are of significant importance, so I’m going to take a moment to introduce you to these antibodies.
Next the antibodies produced will interact with the antigen. The region of an antigen that interacts with an antibody is defined as an epitope. And it is this specific interaction between the antibody and the epitope of the antigen that I’m interested in.
Finally, when the antibodies have bound to the antigen, the antigen is neutralized.
This is more or less what happens, when an antigen induces an antigen response. The antigen is recognized as foreign by the immune system, a cascade of cellular reactions takes place, and eventually specific antibodies are generated towards the antigen, and finally the antigen is neutralized.
Occasionally, abnormal functioning of the immune system occur, the immune system fails to recognize own cells/proteins, and an antibody response is produced against these. A Disease that results from such an immune response is termed an auto-immune disease.
The Antibodies produced in this process are termed auto-antibodies, whereas the protein/tissue that triggers this immune response is termed auto-antigen.
type 1 diabetes is one of the most known autoimmune diseases, where the insulin producing cells are destroyed, another example is celiac disease, which I’m going to introduce you to.