SlideShare a Scribd company logo
1 of 19
The Sustainable Use of Animal Genetics 
in Developing Countries 
Steve Staal 
2nd International Conference on Agricultural and Rural Development in Southeast Asia 
Manila, Philippines, 12 November 2014
Outline of the Presentation 
The Livestock Revolution in SE Asia 
Models of livestock production 
Public vs private benefits of conservation 
Opportunities through both demand and supply 
Conclusions
Projected growth in demand for livestock 
products in SE Asia 
12000 
10000 
8000 
6000 
4000 
2000 
0 
Beef Pork Poultry Eggs Milk 
1000s of MTs 
2010 
2030 
Source: IFPRI IMPACT Model, 2013 
Beef and poultry demand to double by 2030
Large yield gaps linked to genetics 
Estimated opportunities to increase smallholder productivity 
$90 
$80 
$70 
$60 
$50 
$40 
$30 
$20 
$10 
$- 
Africa South Asia Total 
Smallholder Productivity Opportunity ($ Billion) 
See Appendix slide 
26 for more detail 
on this model 
genetics 
animal health 
nutrition 
post harvest 
Animal genetics provides 
the largest opportunity 
across all geographies 
There is also 
opportunity in 
animal health, 
particularly in 
SSA 
Sources: estimates based on BMGF analytical models referencing multiple data sources including: Oct 4-5 Livestock Landscape Analysis Expert 
Panel Workshop; Oct 27 Livestock Foundation Genetics Workshop; Expert Interviews; FAOSTAT; OIE Technical Disease Cards; the Center for 
Food Security and Public Health Animal Disease Information; OIE-WAHID database; Merck Veterinary Manual; 2011 Market Probe market 
research for Kenya, Ghana, Nigeria, Ethiopia
Changes in SE ASIA Livestock 
Production Systems 
Drivers of change 
• Population growth and urbanization 
• Increases in income 
• Market and trade liberalization 
• Climate change 
• New technology 
Consequences 
• Growth in demand of livestock products 
• Pressure on and degradation of the resource base 
• Scaling up of production and vulnerability of small farms 
• Increased competition 
Responses 
• Intensification of mixed crop-livestock systems 
• Genetic resource substitution 
• Policies for enhanced productivity
Models of 
livestock production 
Smallholders: The “household model” 
 Multiple objectives besides income, 
including risk reduction, diversification, 
insurance, and social capital 
 Up to 40% additional “returns” 
to livestock in other benefits 
 Maximum use of low cost resources 
and farm synergies, minimum use of 
purchased inputs 
Large producers: The “enterprise model” 
 Only 1 objective: profit (which has its own 
risks) 
 Capital intensive , mechanization and 
economies of scale
The big challenge 
Demand for improved productivity frequently in conflict with 
diversity conservation 
Loss of diversity caused by stakeholders’ choices primarily for 
economic reasons; 
The animal genetic requirements of industrial systems are thus characterized by: 
 ability to manage environment means less demand for breeds adapted to 
local environments or disease resistance 
 more demand for efficiency, and especially FCR to maximize benefit 
 more demand for quality traits due to consumer demand and technical 
requirements related to standardization, size, fat content, color, flavor, etc.
Private vs public 
Securing poor farmers’ livelihoods vs. keeping local breeds 
 Farmers are changing the genotype of their livestock assets, largely 
due to need for greater productivity 
 Farmers invest in livestock for private benefits 
 Society wants to maintain AnGR for long term public benefit 
 Is it fair to ask farmers to maintain public goods embedded in AnGR 
and to forego productivity gains and income? 
 How do we reconcile these two seemingly contradictory objectives?
Private benefits to support sustainable 
conservation 
Recognize 2 forms of capturing 
private benefits 
– Demand side - Traits that the 
market is willing to pay for 
– Production side – maximizing 
benefits of adaptation 
• Heat tolerance, hardiness, diet 
suitability, disease resistance 
• Social status due to traditional 
practices
New business models to generate demand 
for local breeds in-situ conservation 
Demand side - Traits that the market is willing to pay for 
 Strong SE Asian demand for unique taste, novelty, 
traditional consumption, and organic production 
 Animals raised grown in organic, sustainable and 
animal welfare friendly conditions 
 Converting public into private benefits through 
branding and certification 
 Structured cross-breeding systems provide an 
opportunity for in-situ conservation of indigenous 
breeds
The alternative: Ex situ conservation 
To be effective, should consider multiple 
levels of conservation and data assembly 
– Animal-level, genomic-level, gene-level 
(gene cluster, chromosome, karyotype-genome, semen) 
– And different types and levels of data to build the research 
resource 
• Other samples: hair or blood, or parasites on animal 
• Animal characterization such as GPS location of animal to capture 
environment, local breed-name, phenotype, productivity, etc 
– This allows ‘bio-banking’ of breeds under threat not only for 
preserving animals for an unknown future need, but also for 
creating an important research resource for example, for 
gene discovery.
On the supply side 
We must take account of the 
realities of small-scale 
livestock producers. 
Diversity of: 
 Environment 
 Climate 
 Feeds available 
 Endemic diseases 
 Local market context 
 Infrastructure 
 Institutions 
No data systems to 
inform selection. 
No infrastructure to 
manage selection.
New opportunities for phenotyping 
Can we skip a generation 
of technology? 
Fast, light, cheap 
performance data 
harvesting. 
 Cheap sensors, mobile platforms, 
crowd sensing….. 
 Simultaneously providing 
management information to the 
farmer and performance data to 
the breeder.
New opportunities for genotyping 
“traditional” linkage mapping requires crosses – so initial discovery is 
limited to variants within a species 
Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK 
Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK 
Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK 
Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK 
Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER 
Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK 
Comparative gene network and 
sequence analysis allows to ask 
new kinds of questions about 
genomes – eg “what is different 
about this (group of) species 
compared to all other mammals”
Genomic editing breakthrough 
Identify and make use of the 
genetics underlying natural 
variation. 
There has been no systematic 
search for the genomic basis of 
adaptation. Because until now 
we have had no validation 
tools and no delivery tools. 
New Genome Editing tools 
change the landscape.
Discovery to delivery 
Genotyping Phenotyping 
Adapted & 
productive 
livestock 
Genome 
editing 
Targeting 
Data systems 
Delivery systems
Summary 
Growing demand and markets for livestock products 
is bringing about rapid change 
Lack of private incentives for smallholders to raise 
indigenous breeds threatens their survival of 
strategic AnGR 
Ex-situ conservation offers one alternative, but still to 
be explored 
In-situ conservation can be facilitated through 
several options 
Demand side: new market driven models to raise demand 
for specific traits for local breeds 
Supply side: exciting new genomic tools to increase 
adaptability and productivity of local breeds.
Thank you for your attention 
Acknowledgements: 
Jackie Escarcha, Han Jianlin, Steve Kemp, Mwai Okeyo
better lives through livestock 
ilri.org 
The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI.

More Related Content

What's hot

Opportunities from mobile NIRS
Opportunities from mobile NIRSOpportunities from mobile NIRS
Opportunities from mobile NIRSILRI
 
Application of nuclear and genomic technologies for improving livestock produ...
Application of nuclear and genomic technologies for improving livestock produ...Application of nuclear and genomic technologies for improving livestock produ...
Application of nuclear and genomic technologies for improving livestock produ...ILRI
 
Gahakwa - Overview of agricultural research in Rwanda for the past 10 years
Gahakwa - Overview of agricultural research in Rwanda for the past 10 yearsGahakwa - Overview of agricultural research in Rwanda for the past 10 years
Gahakwa - Overview of agricultural research in Rwanda for the past 10 yearsCIALCA
 
Unleashing the power of data in transforming livestock agriculture in Ethiopia
Unleashing the power of data in transforming livestock agriculture in Ethiopia Unleashing the power of data in transforming livestock agriculture in Ethiopia
Unleashing the power of data in transforming livestock agriculture in Ethiopia ILRI
 
Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...ILRI
 
Assessing economic value of poultry health service and genetic resources in r...
Assessing economic value of poultry health service and genetic resources in r...Assessing economic value of poultry health service and genetic resources in r...
Assessing economic value of poultry health service and genetic resources in r...ILRI
 
Knowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldKnowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldILRI
 
Knowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldKnowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldILRI
 
Climate Smart Brachiaria Grass in East Africa
Climate Smart Brachiaria Grass in East AfricaClimate Smart Brachiaria Grass in East Africa
Climate Smart Brachiaria Grass in East AfricaILRI
 
Status of genomic selection in forages
Status of genomic selection in foragesStatus of genomic selection in forages
Status of genomic selection in foragesILRI
 
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...ILRI
 
CBGW Diane Panrucker Panel
CBGW Diane Panrucker PanelCBGW Diane Panrucker Panel
CBGW Diane Panrucker PanelGenome Alberta
 
Crop livestock farming systems research in semi-arid southern Africa II
Crop livestock farming systems research in semi-arid southern Africa IICrop livestock farming systems research in semi-arid southern Africa II
Crop livestock farming systems research in semi-arid southern Africa IIICRISAT
 
Uganda pig genetics
Uganda pig geneticsUganda pig genetics
Uganda pig geneticsILRI
 
TL III Genetic Gains Program improvement Plan_Cowpea_Burkina
TL III Genetic Gains Program improvement Plan_Cowpea_BurkinaTL III Genetic Gains Program improvement Plan_Cowpea_Burkina
TL III Genetic Gains Program improvement Plan_Cowpea_BurkinaTropical Legumes III
 
Ex-ante assessment of potential market demands and commercial viabilities for...
Ex-ante assessment of potential market demands and commercial viabilities for...Ex-ante assessment of potential market demands and commercial viabilities for...
Ex-ante assessment of potential market demands and commercial viabilities for...africa-rising
 
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...ICRISAT
 
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...ILRI
 
Resource use efficiency in forestry: Utilisation of tree genetic resources
 Resource use efficiency in forestry: Utilisation of tree genetic resources  Resource use efficiency in forestry: Utilisation of tree genetic resources
Resource use efficiency in forestry: Utilisation of tree genetic resources ExternalEvents
 
Tropical dairy genomics
Tropical dairy genomics Tropical dairy genomics
Tropical dairy genomics ILRI
 

What's hot (20)

Opportunities from mobile NIRS
Opportunities from mobile NIRSOpportunities from mobile NIRS
Opportunities from mobile NIRS
 
Application of nuclear and genomic technologies for improving livestock produ...
Application of nuclear and genomic technologies for improving livestock produ...Application of nuclear and genomic technologies for improving livestock produ...
Application of nuclear and genomic technologies for improving livestock produ...
 
Gahakwa - Overview of agricultural research in Rwanda for the past 10 years
Gahakwa - Overview of agricultural research in Rwanda for the past 10 yearsGahakwa - Overview of agricultural research in Rwanda for the past 10 years
Gahakwa - Overview of agricultural research in Rwanda for the past 10 years
 
Unleashing the power of data in transforming livestock agriculture in Ethiopia
Unleashing the power of data in transforming livestock agriculture in Ethiopia Unleashing the power of data in transforming livestock agriculture in Ethiopia
Unleashing the power of data in transforming livestock agriculture in Ethiopia
 
Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...Innovative use of conventional and new technologies to unravel breed options ...
Innovative use of conventional and new technologies to unravel breed options ...
 
Assessing economic value of poultry health service and genetic resources in r...
Assessing economic value of poultry health service and genetic resources in r...Assessing economic value of poultry health service and genetic resources in r...
Assessing economic value of poultry health service and genetic resources in r...
 
Knowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldKnowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing World
 
Knowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing WorldKnowledge to Action: ILRI’s Role in a Changing World
Knowledge to Action: ILRI’s Role in a Changing World
 
Climate Smart Brachiaria Grass in East Africa
Climate Smart Brachiaria Grass in East AfricaClimate Smart Brachiaria Grass in East Africa
Climate Smart Brachiaria Grass in East Africa
 
Status of genomic selection in forages
Status of genomic selection in foragesStatus of genomic selection in forages
Status of genomic selection in forages
 
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...
Pig and maize interactions: Lessons for strengthening pig farmers’ livelihood...
 
CBGW Diane Panrucker Panel
CBGW Diane Panrucker PanelCBGW Diane Panrucker Panel
CBGW Diane Panrucker Panel
 
Crop livestock farming systems research in semi-arid southern Africa II
Crop livestock farming systems research in semi-arid southern Africa IICrop livestock farming systems research in semi-arid southern Africa II
Crop livestock farming systems research in semi-arid southern Africa II
 
Uganda pig genetics
Uganda pig geneticsUganda pig genetics
Uganda pig genetics
 
TL III Genetic Gains Program improvement Plan_Cowpea_Burkina
TL III Genetic Gains Program improvement Plan_Cowpea_BurkinaTL III Genetic Gains Program improvement Plan_Cowpea_Burkina
TL III Genetic Gains Program improvement Plan_Cowpea_Burkina
 
Ex-ante assessment of potential market demands and commercial viabilities for...
Ex-ante assessment of potential market demands and commercial viabilities for...Ex-ante assessment of potential market demands and commercial viabilities for...
Ex-ante assessment of potential market demands and commercial viabilities for...
 
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...
ICRISAT Global Planning Meeting 2019:Research Program - Genetic Gains by Dr R...
 
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...
Tropical Poultry Genetic Solutions (TPGS): Delivering farmer preferred, produ...
 
Resource use efficiency in forestry: Utilisation of tree genetic resources
 Resource use efficiency in forestry: Utilisation of tree genetic resources  Resource use efficiency in forestry: Utilisation of tree genetic resources
Resource use efficiency in forestry: Utilisation of tree genetic resources
 
Tropical dairy genomics
Tropical dairy genomics Tropical dairy genomics
Tropical dairy genomics
 

Similar to The sustainable use of animal genetics in developing countries

And what should we do today? Developing a research-for-development agenda for...
And what should we do today? Developing a research-for-development agenda for...And what should we do today? Developing a research-for-development agenda for...
And what should we do today? Developing a research-for-development agenda for...ILRI
 
Livestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionLivestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionILRI
 
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...Francois Stepman
 
Towards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideTowards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideILRI
 
Knowledge to Action: ILRI’s role in pro-poor livestock research for development
Knowledge to Action: ILRI’s role in pro-poor livestock research for developmentKnowledge to Action: ILRI’s role in pro-poor livestock research for development
Knowledge to Action: ILRI’s role in pro-poor livestock research for developmentILRI
 
Poultry breeding
Poultry breedingPoultry breeding
Poultry breedingOsama Zahid
 
Livestock in the new CGIAR Consortium
Livestock in the new CGIAR ConsortiumLivestock in the new CGIAR Consortium
Livestock in the new CGIAR ConsortiumILRI
 
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...ILRI
 
Biotechnologies for animal breeding and coping with climate change
Biotechnologies for animal breeding and coping with climate changeBiotechnologies for animal breeding and coping with climate change
Biotechnologies for animal breeding and coping with climate changeFAO
 
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...ILRI
 
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7ILRI
 
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s research
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s researchPro-poor issues for livestock and some lessons for Vietnam from ILRI’s research
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s researchILRI
 
ILRI overview
ILRI overview ILRI overview
ILRI overview ILRI
 
Livestock in the New CGIAR Consortium
Livestock in the New CGIAR ConsortiumLivestock in the New CGIAR Consortium
Livestock in the New CGIAR Consortiumcopppldsecretariat
 
Livestock genetics flagship
Livestock genetics flagshipLivestock genetics flagship
Livestock genetics flagshipILRI
 
Sustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorSustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorACIAR
 
Animal genetic resources for improved productivity under harsh environmenta...
Animal genetic resources for improved productivity under harsh environmenta...Animal genetic resources for improved productivity under harsh environmenta...
Animal genetic resources for improved productivity under harsh environmenta...ILRI
 
Informing tomorrow's livestock science: Opportunities to transform food syste...
Informing tomorrow's livestock science: Opportunities to transform food syste...Informing tomorrow's livestock science: Opportunities to transform food syste...
Informing tomorrow's livestock science: Opportunities to transform food syste...ILRI
 
CTLGH tropical dairy genomics programme
CTLGH tropical dairy genomics programme CTLGH tropical dairy genomics programme
CTLGH tropical dairy genomics programme ILRI
 

Similar to The sustainable use of animal genetics in developing countries (20)

And what should we do today? Developing a research-for-development agenda for...
And what should we do today? Developing a research-for-development agenda for...And what should we do today? Developing a research-for-development agenda for...
And what should we do today? Developing a research-for-development agenda for...
 
Livestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reductionLivestock research for Africa’s food security and poverty reduction
Livestock research for Africa’s food security and poverty reduction
 
AASW: Livestock research for Africa’s food security and poverty reduction
AASW: Livestock research for Africa’s food security and poverty reductionAASW: Livestock research for Africa’s food security and poverty reduction
AASW: Livestock research for Africa’s food security and poverty reduction
 
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...
The Role and Contribution of Plant Breeding and Plant Biotechnology to Sustai...
 
Towards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwideTowards successful, and sustainable, livestock futures worldwide
Towards successful, and sustainable, livestock futures worldwide
 
Knowledge to Action: ILRI’s role in pro-poor livestock research for development
Knowledge to Action: ILRI’s role in pro-poor livestock research for developmentKnowledge to Action: ILRI’s role in pro-poor livestock research for development
Knowledge to Action: ILRI’s role in pro-poor livestock research for development
 
Poultry breeding
Poultry breedingPoultry breeding
Poultry breeding
 
Livestock in the new CGIAR Consortium
Livestock in the new CGIAR ConsortiumLivestock in the new CGIAR Consortium
Livestock in the new CGIAR Consortium
 
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...
Developing a Livestock Agri-Food Systems Research Program for the CGIAR: Back...
 
Biotechnologies for animal breeding and coping with climate change
Biotechnologies for animal breeding and coping with climate changeBiotechnologies for animal breeding and coping with climate change
Biotechnologies for animal breeding and coping with climate change
 
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...
How can Animal Biotechnology contribute to Agenda 2063, ST&I Strategy for Afr...
 
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7
More milk, meat, and fish by and for the poor: CGIAR Research Program 3.7
 
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s research
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s researchPro-poor issues for livestock and some lessons for Vietnam from ILRI’s research
Pro-poor issues for livestock and some lessons for Vietnam from ILRI’s research
 
ILRI overview
ILRI overview ILRI overview
ILRI overview
 
Livestock in the New CGIAR Consortium
Livestock in the New CGIAR ConsortiumLivestock in the New CGIAR Consortium
Livestock in the New CGIAR Consortium
 
Livestock genetics flagship
Livestock genetics flagshipLivestock genetics flagship
Livestock genetics flagship
 
Sustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sectorSustainable and productive farming systems: The livestock sector
Sustainable and productive farming systems: The livestock sector
 
Animal genetic resources for improved productivity under harsh environmenta...
Animal genetic resources for improved productivity under harsh environmenta...Animal genetic resources for improved productivity under harsh environmenta...
Animal genetic resources for improved productivity under harsh environmenta...
 
Informing tomorrow's livestock science: Opportunities to transform food syste...
Informing tomorrow's livestock science: Opportunities to transform food syste...Informing tomorrow's livestock science: Opportunities to transform food syste...
Informing tomorrow's livestock science: Opportunities to transform food syste...
 
CTLGH tropical dairy genomics programme
CTLGH tropical dairy genomics programme CTLGH tropical dairy genomics programme
CTLGH tropical dairy genomics programme
 

More from ILRI

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...ILRI
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...ILRI
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...ILRI
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesILRI
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseaseILRI
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistanceILRI
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesILRI
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMICILRI
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaILRI
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldILRI
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaILRI
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwaILRI
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogsILRI
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...ILRI
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...ILRI
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformationILRI
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...ILRI
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsILRI
 

More from ILRI (20)

How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...How the small-scale low biosecurity sector could be transformed into a more b...
How the small-scale low biosecurity sector could be transformed into a more b...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
Small ruminant keepers’ knowledge, attitudes and practices towards peste des ...
 
A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...A training, certification and marketing scheme for informal dairy vendors in ...
A training, certification and marketing scheme for informal dairy vendors in ...
 
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...Milk safety and child nutrition impacts of the MoreMilk training, certificati...
Milk safety and child nutrition impacts of the MoreMilk training, certificati...
 
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseasesPreventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
Preventing the next pandemic: a 12-slide primer on emerging zoonotic diseases
 
Preventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne diseasePreventing preventable diseases: a 12-slide primer on foodborne disease
Preventing preventable diseases: a 12-slide primer on foodborne disease
 
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistancePreventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
Preventing a post-antibiotic era: a 12-slide primer on antimicrobial resistance
 
Food safety research in low- and middle-income countries
Food safety research in low- and middle-income countriesFood safety research in low- and middle-income countries
Food safety research in low- and middle-income countries
 
Food safety research LMIC
Food safety research LMICFood safety research LMIC
Food safety research LMIC
 
The application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern AfricaThe application of One Health: Observations from eastern and southern Africa
The application of One Health: Observations from eastern and southern Africa
 
One Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the fieldOne Health in action: Perspectives from 10 years in the field
One Health in action: Perspectives from 10 years in the field
 
Reservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in UgandaReservoirs of pathogenic Leptospira species in Uganda
Reservoirs of pathogenic Leptospira species in Uganda
 
Minyoo ya mbwa
Minyoo ya mbwaMinyoo ya mbwa
Minyoo ya mbwa
 
Parasites in dogs
Parasites in dogsParasites in dogs
Parasites in dogs
 
Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...Assessing meat microbiological safety and associated handling practices in bu...
Assessing meat microbiological safety and associated handling practices in bu...
 
Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...Ecological factors associated with abundance and distribution of mosquito vec...
Ecological factors associated with abundance and distribution of mosquito vec...
 
Livestock in the agrifood systems transformation
Livestock in the agrifood systems transformationLivestock in the agrifood systems transformation
Livestock in the agrifood systems transformation
 
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
Development of a fluorescent RBL reporter system for diagnosis of porcine cys...
 
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farmsPractices and drivers of antibiotic use in Kenyan smallholder dairy farms
Practices and drivers of antibiotic use in Kenyan smallholder dairy farms
 

Recently uploaded

Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Sérgio Sacani
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsSérgio Sacani
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...Sérgio Sacani
 
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfAnalytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfSwapnil Therkar
 
Unlocking the Potential: Deep dive into ocean of Ceramic Magnets.pptx
Unlocking  the Potential: Deep dive into ocean of Ceramic Magnets.pptxUnlocking  the Potential: Deep dive into ocean of Ceramic Magnets.pptx
Unlocking the Potential: Deep dive into ocean of Ceramic Magnets.pptxanandsmhk
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...RohitNehra6
 
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...Labelling Requirements and Label Claims for Dietary Supplements and Recommend...
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...Lokesh Kothari
 
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisRaman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisDiwakar Mishra
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)PraveenaKalaiselvan1
 
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCESTERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCEPRINCE C P
 
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSpermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSarthak Sekhar Mondal
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...jana861314
 
Natural Polymer Based Nanomaterials
Natural Polymer Based NanomaterialsNatural Polymer Based Nanomaterials
Natural Polymer Based NanomaterialsAArockiyaNisha
 
Boyles law module in the grade 10 science
Boyles law module in the grade 10 scienceBoyles law module in the grade 10 science
Boyles law module in the grade 10 sciencefloriejanemacaya1
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxAArockiyaNisha
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksSérgio Sacani
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bSérgio Sacani
 
Caco-2 cell permeability assay for drug absorption
Caco-2 cell permeability assay for drug absorptionCaco-2 cell permeability assay for drug absorption
Caco-2 cell permeability assay for drug absorptionPriyansha Singh
 

Recently uploaded (20)

Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
 
9953056974 Young Call Girls In Mahavir enclave Indian Quality Escort service
9953056974 Young Call Girls In Mahavir enclave Indian Quality Escort service9953056974 Young Call Girls In Mahavir enclave Indian Quality Escort service
9953056974 Young Call Girls In Mahavir enclave Indian Quality Escort service
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
 
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfAnalytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
 
Unlocking the Potential: Deep dive into ocean of Ceramic Magnets.pptx
Unlocking  the Potential: Deep dive into ocean of Ceramic Magnets.pptxUnlocking  the Potential: Deep dive into ocean of Ceramic Magnets.pptx
Unlocking the Potential: Deep dive into ocean of Ceramic Magnets.pptx
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...
 
Engler and Prantl system of classification in plant taxonomy
Engler and Prantl system of classification in plant taxonomyEngler and Prantl system of classification in plant taxonomy
Engler and Prantl system of classification in plant taxonomy
 
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...Labelling Requirements and Label Claims for Dietary Supplements and Recommend...
Labelling Requirements and Label Claims for Dietary Supplements and Recommend...
 
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral AnalysisRaman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
Raman spectroscopy.pptx M Pharm, M Sc, Advanced Spectral Analysis
 
Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)Recombinant DNA technology (Immunological screening)
Recombinant DNA technology (Immunological screening)
 
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCESTERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
 
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatidSpermiogenesis or Spermateleosis or metamorphosis of spermatid
Spermiogenesis or Spermateleosis or metamorphosis of spermatid
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
 
Natural Polymer Based Nanomaterials
Natural Polymer Based NanomaterialsNatural Polymer Based Nanomaterials
Natural Polymer Based Nanomaterials
 
Boyles law module in the grade 10 science
Boyles law module in the grade 10 scienceBoyles law module in the grade 10 science
Boyles law module in the grade 10 science
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disks
 
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43bNightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
Nightside clouds and disequilibrium chemistry on the hot Jupiter WASP-43b
 
Caco-2 cell permeability assay for drug absorption
Caco-2 cell permeability assay for drug absorptionCaco-2 cell permeability assay for drug absorption
Caco-2 cell permeability assay for drug absorption
 

The sustainable use of animal genetics in developing countries

  • 1. The Sustainable Use of Animal Genetics in Developing Countries Steve Staal 2nd International Conference on Agricultural and Rural Development in Southeast Asia Manila, Philippines, 12 November 2014
  • 2. Outline of the Presentation The Livestock Revolution in SE Asia Models of livestock production Public vs private benefits of conservation Opportunities through both demand and supply Conclusions
  • 3. Projected growth in demand for livestock products in SE Asia 12000 10000 8000 6000 4000 2000 0 Beef Pork Poultry Eggs Milk 1000s of MTs 2010 2030 Source: IFPRI IMPACT Model, 2013 Beef and poultry demand to double by 2030
  • 4. Large yield gaps linked to genetics Estimated opportunities to increase smallholder productivity $90 $80 $70 $60 $50 $40 $30 $20 $10 $- Africa South Asia Total Smallholder Productivity Opportunity ($ Billion) See Appendix slide 26 for more detail on this model genetics animal health nutrition post harvest Animal genetics provides the largest opportunity across all geographies There is also opportunity in animal health, particularly in SSA Sources: estimates based on BMGF analytical models referencing multiple data sources including: Oct 4-5 Livestock Landscape Analysis Expert Panel Workshop; Oct 27 Livestock Foundation Genetics Workshop; Expert Interviews; FAOSTAT; OIE Technical Disease Cards; the Center for Food Security and Public Health Animal Disease Information; OIE-WAHID database; Merck Veterinary Manual; 2011 Market Probe market research for Kenya, Ghana, Nigeria, Ethiopia
  • 5. Changes in SE ASIA Livestock Production Systems Drivers of change • Population growth and urbanization • Increases in income • Market and trade liberalization • Climate change • New technology Consequences • Growth in demand of livestock products • Pressure on and degradation of the resource base • Scaling up of production and vulnerability of small farms • Increased competition Responses • Intensification of mixed crop-livestock systems • Genetic resource substitution • Policies for enhanced productivity
  • 6. Models of livestock production Smallholders: The “household model”  Multiple objectives besides income, including risk reduction, diversification, insurance, and social capital  Up to 40% additional “returns” to livestock in other benefits  Maximum use of low cost resources and farm synergies, minimum use of purchased inputs Large producers: The “enterprise model”  Only 1 objective: profit (which has its own risks)  Capital intensive , mechanization and economies of scale
  • 7. The big challenge Demand for improved productivity frequently in conflict with diversity conservation Loss of diversity caused by stakeholders’ choices primarily for economic reasons; The animal genetic requirements of industrial systems are thus characterized by:  ability to manage environment means less demand for breeds adapted to local environments or disease resistance  more demand for efficiency, and especially FCR to maximize benefit  more demand for quality traits due to consumer demand and technical requirements related to standardization, size, fat content, color, flavor, etc.
  • 8. Private vs public Securing poor farmers’ livelihoods vs. keeping local breeds  Farmers are changing the genotype of their livestock assets, largely due to need for greater productivity  Farmers invest in livestock for private benefits  Society wants to maintain AnGR for long term public benefit  Is it fair to ask farmers to maintain public goods embedded in AnGR and to forego productivity gains and income?  How do we reconcile these two seemingly contradictory objectives?
  • 9. Private benefits to support sustainable conservation Recognize 2 forms of capturing private benefits – Demand side - Traits that the market is willing to pay for – Production side – maximizing benefits of adaptation • Heat tolerance, hardiness, diet suitability, disease resistance • Social status due to traditional practices
  • 10. New business models to generate demand for local breeds in-situ conservation Demand side - Traits that the market is willing to pay for  Strong SE Asian demand for unique taste, novelty, traditional consumption, and organic production  Animals raised grown in organic, sustainable and animal welfare friendly conditions  Converting public into private benefits through branding and certification  Structured cross-breeding systems provide an opportunity for in-situ conservation of indigenous breeds
  • 11. The alternative: Ex situ conservation To be effective, should consider multiple levels of conservation and data assembly – Animal-level, genomic-level, gene-level (gene cluster, chromosome, karyotype-genome, semen) – And different types and levels of data to build the research resource • Other samples: hair or blood, or parasites on animal • Animal characterization such as GPS location of animal to capture environment, local breed-name, phenotype, productivity, etc – This allows ‘bio-banking’ of breeds under threat not only for preserving animals for an unknown future need, but also for creating an important research resource for example, for gene discovery.
  • 12. On the supply side We must take account of the realities of small-scale livestock producers. Diversity of:  Environment  Climate  Feeds available  Endemic diseases  Local market context  Infrastructure  Institutions No data systems to inform selection. No infrastructure to manage selection.
  • 13. New opportunities for phenotyping Can we skip a generation of technology? Fast, light, cheap performance data harvesting.  Cheap sensors, mobile platforms, crowd sensing…..  Simultaneously providing management information to the farmer and performance data to the breeder.
  • 14. New opportunities for genotyping “traditional” linkage mapping requires crosses – so initial discovery is limited to variants within a species Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK Comparative gene network and sequence analysis allows to ask new kinds of questions about genomes – eg “what is different about this (group of) species compared to all other mammals”
  • 15. Genomic editing breakthrough Identify and make use of the genetics underlying natural variation. There has been no systematic search for the genomic basis of adaptation. Because until now we have had no validation tools and no delivery tools. New Genome Editing tools change the landscape.
  • 16. Discovery to delivery Genotyping Phenotyping Adapted & productive livestock Genome editing Targeting Data systems Delivery systems
  • 17. Summary Growing demand and markets for livestock products is bringing about rapid change Lack of private incentives for smallholders to raise indigenous breeds threatens their survival of strategic AnGR Ex-situ conservation offers one alternative, but still to be explored In-situ conservation can be facilitated through several options Demand side: new market driven models to raise demand for specific traits for local breeds Supply side: exciting new genomic tools to increase adaptability and productivity of local breeds.
  • 18. Thank you for your attention Acknowledgements: Jackie Escarcha, Han Jianlin, Steve Kemp, Mwai Okeyo
  • 19. better lives through livestock ilri.org The presentation has a Creative Commons licence. You are free to re-use or distribute this work, provided credit is given to ILRI.

Editor's Notes

  1. There MUST be a CGIAR logo or a CRP logo. You can copy and paste the logo you need from the final slide of this presentation. Then you can delete that final slide   To replace a photo above, copy and paste this link in your browser: http://www.flickr.com/photos/ilri/sets/72157632057087650/detail/   Find a photo you like and the right size, copy and paste it in the block above.