Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Lots Of Free Printables For Kids Animal Writing Writi
1. Lots Of Free Printables For Kids! |
Animal Writing, Writi
1. Step
To get started, you must first create an account on site HelpWriting.net.
The registration process is quick and simple, taking just a few moments.
During this process, you will need to provide a password and a valid email
address.
2. Step
In order to create a "Write My Paper For Me" request, simply complete the
10-minute order form. Provide the necessary instructions, preferred
sources, and deadline. If you want the writer to imitate your writing style,
attach a sample of your previous work.
3. Step
When seeking assignment writing help from HelpWriting.net, our
platform utilizes a bidding system. Review bids from our writers for your
request, choose one of them based on qualifications, order history, and
feedback, then place a deposit to start the assignment writing.
4. Step
After receiving your paper, take a few moments to ensure it meets your
expectations. If you're pleased with the result, authorize payment for the
writer. Don't forget that we provide free revisions for our writing services.
5. Step
When you opt to write an assignment online with us, you can request
multiple revisions to ensure your satisfaction. We stand by our promise to
provide original, high-quality content - if plagiarized, we offer a full
refund. Choose us confidently, knowing that your needs will be fully met.
Lots Of Free Printables For Kids! | Animal Writing, Writi Lots Of Free Printables For Kids! | Animal Writing, Writi
2. Gold Rush Research Paper
The gold rush was an event that took place over 150 years ago and was a very big part of both
Australian and general history. Due to tis creance It forced lots of events to take place in Australia,
such as new laws placed and even forming the common wealth. What did stand out though was racism
and differences between other cultures that made Australia very strict on who entered their borders.
before early 1800 s, Australia s people that make up the country were mostly British. Around the late
1700 s and early 1800 s, people from Asian countries and other foreign countries tried to come and
make a new life in Australia. But at this time, work was very hard to get for anyone who was not
British. It was recorded In early records Chinese scripture, ... Show more content on Helpwriting.net
...
Gold rushes were constantly popping up in areas of Australia, and once one was starting to get dry of
gold, it was a race to the next. Around the 1850 s Australia made a significant establishment of the
first royal mint made outside of England, this was placed in Sydney. Between 1851 and 1861 Australia
produced a third of the worlds gold. WA had major gold deposits and since they had not formed in to
the common wealth they had little say. With the new found wealth that the gold had brought Western
Australia was being left out of the conversation in having no say on the wealth of the gold and
introducing more people in to their area they decided to become a part of the commonwealth.
Australian gold rush timeline/date accessed:Sqwirk/date accessed: 17/07/2016/
http://www.skwirk.com/p c_s 17_u 453_t 1222_c 4673/sa/sose/gold and mining/discovering
gold/australian gold rush This event took place during the middle of the gold rush when new areas of
gold started to pop up all over Australia and many were found in western Australia. Soon after this
though, finding gold was starting to decrease and lots of people started to quit mining and going back
to doing factory work as it was a better source of income. The gold rushes that changed
Australia/1/9/2010/author: Emma Wynne/ date accessed: 17/08/2016/
... Get more on HelpWriting.net ...
3. Essay on The Sinking of the Lusitania
The Sinking of the Lusitania On the 7 May 1915 at 14:30, then 240 metre long and 27 meter wide ship
the Lusitania sunk to the sea bed. Despite the fact that so many were killed, 1,195 people, this ship has
not become one of history s most well known vessels, unlike the Titanic. This is due to the fact that
the Lusitania was sunk by the Germans during the First World War. The Lusitania and her sister ship,
the Mauretania, were built by John Brown CO Ltd in Glasgow for the purpose of winning back the
Blue Riband, an award to ships crossing the Atlantic ocean in the quickest time. *
http://www.lusitania.net/ * http://www.geocities.com/titanicandco/lusitania.html * ... Show more
content on Helpwriting.net ...
Ships that came later, the Titanic included, could only reach speeds of 22 knots, however in these
cases speed was compromised by concentrating more on comfort and luxury; perhaps more
importantly the Lusitania was built for use in war. The Lusitania left Liverpool on the 7 September
1907 on her maiden voyage to Queenstown and New York. Approximately 200 000 people had
gathered to see her offmänniskor, despite the fact the ship had been built to win the Blue Riband back
from the German ship Deutschland it was not until the Lusitania s second journey that the record was
broken on the 5 October 1907. The journey from Queenstown to Sandy Hook took 4 days and 19
hours. * http://www.geocities.com/titanicandco/lusitania.html#5.%20Maiden%20voyage *
http://www.ocean liners.com/ships/lusitania.asp When the Lusitania left Liverpool on the 16 January
1915 its services across the North Atlantic were about to become markedly more appreciated. The ship
sailed through bad weather with a permanent threat of being torpedoed, so much so that the captain
raised the flag of the United States hoping to reduce the risk as America had not yet joined the war.
This however came out in the international press and soon became known throughout the world, the
German Embassy in Washington sent a
... Get more on HelpWriting.net ...
4. Nazi Medical Experiment Essay
considered military necessity adequate justification for their heinous experiments. They justified their
acts by saying that the prisoners were condemned to death anyway. (Cohen, Baruch C. Nazi Medical
Experimentation: The Ethics Of Using Medical Data From Nazi Experiments. Jewish Virtual Library.
American Israeli Cooperative Enterprise, n.d. Web. 12 Mar. 2016. .) It did change things about the
military and how it used to be but too many were forced to die for this change. Dr. Sigmund Rascher
Dr. Rascher was most known for his freezing and high altitude experiments. Freezing Experiments:
Prisoner was put in ice freezing water, often tell they would shiver themselves to death. He did this to
see how long German pilots shot down in the ... Show more content on Helpwriting.net ...
This method was devised to test whether such liquid as the only supply fluid cause physical
disturbance or death within 6 to 12 days. They were so desperate for water they waited for the freshly
mopped floors to get water by licking them. He showed no humanity. Nothing good came out of this
experiment; Furthermore, it does not shape the medical field. Sulfanilamide Experiments The German
Armed Forces suffered heavy casualties on the Russian Front in 1941 to 1943 because of gas gangrene
(Cohen, Baruch C. Nazi Medical Experimentation: The Ethics Of Using Medical Data From Nazi
Experiments. Jewish Virtual Library. American Israeli Cooperative Enterprise, n.d. Web. 12 Mar.
2016). These casualties and other war wounds are the cause for healthy Jews to be deliberately
wounded and then the subjects were infected with bacteria creating almost a battlefield wound.
Although he had a motive behind his research. He did not have any humanity to all of those people he
killed to get this far. His research was a springboard for many different researches containing toxic
gases.This research contained more to the military aspect of the experiments. Miscellaneous
... Get more on HelpWriting.net ...
5. Multicultural Issues In Multicultural Education
Multicultural Issues Raquel mentions she failed the seventh grade; as a result she was placed in
special classes. She also stated she does not see the point of going to school. Brammer (2004)
mentions language barriers is a hindrance among Latin American while in school. Many Latin
Americans are bilingual; however, the will speak little English outside of the school setting. This
causes complications due to their primary language is Spanish which is spoken by family and friends
(Brammer, 2004). Additionally, Latin American endures a vast amount of peer pressure to do poorly in
school or to drop out. One method to reduce the dropout rate of Latin Americans is teachers can make
reasonable accommodation to their lesson plan to the address the students needs. Also involving the
child s parents in their educations with the use of interpreters can assist the child to thrive
educationally (Amy Buttler, personal communication, November 7, 2017). It is mentioned that Raquel
s family has strong ethnicity rooted in the Costa Rican lineage. Latin Americans tend to have strong
family ties that rely on the support and strength of each other. Familismo is a part of their cultural
placing high value on the family that extends past the nuclear family (e.g. grandparents and extended
family members) (Brammer, 2004). It is beneficial to be close with one s family; however, Brammer
(2004) mentions the family bonds can lead to sexual exploitation of children by family members. He
... Get more on HelpWriting.net ...
6. The Complexity And Characteristics Of The Japanese Culture
A very distinct humanistic behavior is the willingness and need to assimilate with others to form
societies and cultures. Societies have a very special stronghold on how different communities and
people interact and thrive amongst each other on a piece of land. Humans inherently need to create
societies in an effort to live more comfortable and it is said societies that vastly vary across the globe.
One example of how a society has lived is portrayed through the enigmatic Japanese people; the
Japanese are enigmatic because they have managed to stand the test of time throughout the years
despite the plethora of issues they have faced that could very well have been their demise. That being
said, the Japanese have a lot of special traits that outline their culture as unique, those are as follows;
language, art, religion, marriage, and finally teaching methods are all different outliners that describe
the complexity and uniqueness of the Japanese.
Human beings are incredibly fascinating beings in that over the span of many years different forms of
verbal communication have arose. This is attributed to the word one calls language which is
essentially the communication of one human to another using verbal language; this language comes in
a variety of dialects and in today s day and age language is so vast that it is near impossible to see just
how many languages persist in the world today. This is no different when we take a look at
predominantly Asian countries; while these
... Get more on HelpWriting.net ...
7. The Steps Of Scientific Method
The scientific method is when you have a specific problem and you go through steps to try and solve
your problem. The steps of scientific method are develop a theory, check and analyze your theory,
explain your hypothesis, and prove your hypothesis. Whether that hypothesis could be wrong, you can
still change it. That is the best thing about theories, hypothesis, and the scientific method.
An example of the scientific method is my automobile does not crank. I would check for gas because
if there is no gas, then the car will not crank. I put gas in the car tank and car cranks.
Another example of scientific method is the remote does not work. I will check the batteries, to see if
they are dead. I take out the batteries. Then, I would, find another set of batteries to replace the old
ones. After putting in the new batteries, the remote works.
A way Scientific method could be used in my everyday life would be when the computer does not turn
on. First, I would check to see if the power plug has been tampered with or is loose. If the power plug
has not been tampered with or been loose then I would unplug and replug the power cord. This
method has not worked because the computer will still not turn on. So, I will try another method.
Since, that did not work, I will, now, look to see if it is the monitor. I have pressed the power button.
Monitor flashes and the green light appears. So, there is nothing wrong with the monitor. This method
did not work either, so I am going to
... Get more on HelpWriting.net ...
8. Symbolism in The Scarlet Letter by Nathaniel Hawthorne Essay
Symbolism enhances the meaning of even a simple painting. It is when a person looks at the images in
the painting and tries to understand why the painter made those images while another person looks at
it and just calls it dumb without even trying to understand it. The latter person completely loses faith
in the painting and misses the actual point. When people first read The Scarlet Letter, they notice not
only the characters, but also the objects, which may be non living, but carry tons of meaning. They no
longer view everything as random occurring objects in our daily lives or as a mere coincidence, but try
to find the specific reasons of them occurring in the story. All sorts of questions rose in mind: Why did
Hawthorne use the red ... Show more content on Helpwriting.net ...
Pearl s presence gives Hester a reason to live and augments her spirits whenever she loses hope. Pearl,
just like the literal meaning of her name, is really precious to her mother and represents the passion
and spirit the sin provoked in Hester.
The Meteor
The meteor also plays a vital role in The Scarlet Letter. In Chapter 12, when the meteor makes the
letter A in the sky, it is a reminder of the same sin made by Hester to Dimmesdale. It implies that the
letter A should also be worn by Dimmesdale. But the rest of the society interprets the meteor
differently. They think it stands for Angel denoting the entry of the Governor into heaven.
The Red Color
While red personifies Hester s passion as well as hope and love. For example, the red letter, the red
rose bush and Pearl s red dress. Just like Hester doesn t fit in the Puritan society, the wild rose bush
outside prison doesn t fit in the place it grows. The red light shining through the room when sunlight
passes through the red window symbolizes how Hester s passion is spreading among the society.
The Black Color
Hawthorne uses black to symbolize evil, the worst of someone and the darkness that conceals the
truth. Hester describes the prison as the black flower of the civilized society , Pearl s eyes as small
black mirrors and Satan as The Black Man in the forest.
The Gold Color
The way the letter was
... Get more on HelpWriting.net ...
9. The Tulsa Race Riot Of 1921
The Tulsa Race Riot of 1921 was the culmination of racial tensions both endemic in American society
as a whole in the period, and certain tensions peculiar to Tulsa, Oklahoma. In 1921, Greenwood and
its African American population became the outlet for these often violent tensions seething among
Tulsa s white population. The following paper seeks to shed some further understanding on what
motivated and pushed the whites of Tulsa, Oklahoma to such a violent, extreme reaction during the
riot.
To answer the question, Why were the whites so mean? it is necessary to understand the pre existing
conditions that existed in Tulsa, Oklahoma before the actual riot took place in 1921.
Pre existing racism in Tulsa was the foundation on which all the other causes of the riot were built
upon. Wide spread segregation was still common in America at that time and it was accepted by many
in the North and South that whites were inherently superior to blacks. These views were particularly
strong in the South, where emancipated blacks were seen as a threat and scourge to white Southern
culture, a culture which was utterly dominated by whites and where blacks were oppressed with no
hope of equal protection under the law, equal representation, etc. This was also the case in Tulsa in the
early 1900s. Blacks were segregated against by the white residents and as a consequence formed their
own community, called Greenwood, on the north side of the Frisco Railroad tracks, which was
heralded by
... Get more on HelpWriting.net ...
10. Henry Iv And Henry V By William Shakespeare
In Henry IV and Henry V by Shakespeare, a father and son have diametrically different reigns as king.
While both kings are politically savvy and gain the favor of the people, only one, Henry V, has the
divine right of kings. The divine right of kings is the belief that power is instilled in them by God and
rebellion against them is considered a sin. The influence of divine intervention is shown through the
punishment and guilt of Henry IV and the success of Henry V. The rule of Henry IV illustrates the fate
of one who seizes a crown that is not rightfully his by divine ordinance: a reign troubled with treason
and uprisings. He does not have the right to rule because he has not obtained the crown through the
law of primogeniture and therefore lacks the divine power imparted on those who gain the throne
legitimately. Henry IV seems to have all of the right characteristics to be a successful king; however,
he comes to the throne as an illegitimate ruler with the responsibility of the death of God s chosen
king, Richard II, on his shoulders. These actions cause Henry IV to incur the wrath of God against him
and to have a reign plagued with conflict; his ambitiousness and political intelligence cannot fight
back against the divine punishment inflicted upon him. His divine punishment dictates that he will
have no peace in his rule. The instability of England when Henry IV becomes king is foreshadowed by
Carlisle: In this seat of peace tumultuous wars / Shall kin with kin and
... Get more on HelpWriting.net ...
11. Analysis Of Kurt Vonnegut s Harrison Bergeron
POSSIBLE THESIS STATEMENTS
#1 Can we live in Kurt Vonnegut s story of Harrison Bergeron which is a Utopian society where
everyone is equal mentally, socially, and physically? Would we need to interact or come together with
others in society? #2 Harrison Bergeron , a short story written by Kurt Vonnegut Jr., Vonnegut makes
it well known to his readers how dangerous it can be to have total equality. Throughout the story, the
author uses comedy, sarcasm, and tone. #3 In Kurt Vonnegut Jr. s short story, Harrison Bergeron , the
author argues the dangers of a world that is based on total equality. Not only does Vonnegut expose the
negative results of being alike, he also shows that we desire to be different from each other.
In the year 2081, all people are created or forced to be equal mentally, socially, and physically. You are
NOT allowed to be different, whether it is better or worse, than anyone else. If you are intelligent, you
must wear a handicapping radio in your ears at all times. This radio blasts a sharp noise, every 20
seconds or so, so you would not use your brain. If you are good looking, you must wear masks, and if
you are strong and athletic, you are weighed down with heavy weights. This contradicts everything
that we believe in about our society today. This is also what Harrison Bergeron hated about his society.
George and Hazel Bergeron are husband and wife and the parents of Harrison Bergeron. Harrison was
jailed at the age of 14 due to
... Get more on HelpWriting.net ...
12. Modern Film On Our Rational And Critical Thought Processes
Frankfurt School philosophers fiercely debated the effects of modern film on our rational and critical
thought processes. Max Horkheimer and Theodor Adorno assert film is an oppressive technology that
makes us intellectually docile, while Walter Benjamin contests their assertion by recognizing film s
liberatory potential. Although Horkheimer and Adorno make important points about the current
relationship between film and the masses, they fail to acknowledge any possible changes to it. In the
context of futurity, Benjamin presents a convincing argument the technology of film can create
subjectivities that will help the masses assimilate into modernity. Horkheimer and Adorno s
understanding of film reflects our current reality. Although Benjamin acknowledges film s current
state, he envisions a future where film trains us to cope with the pressures of modernity. In The
Culture Industry: Enlightenment as Mass Deception, Horkheimer and Adorno argue film oppresses
our ability to think critically. They base their argument on how culture today is infecting everything
with sameness (Horkheimer 94). That is, the ubiquitous nature of film infects everyone with
identically diseased notions. The connotations of infection are clear: affliction, contamination, and
disorder. For Horkheimer and Adorno, the infection (film created by the bourgeois cultural elite)
forces us into a state of mental lethargy the masses uniformly accept film content with little resistance
... Get more on HelpWriting.net ...
13. Carl Jung s Theory Of Collective Unconscious
Villa 1
Jesus Villa
Professor Carrera
World Class Literature 4351
09 December 2015
Essay 3 For my last and final essay of this semester I chose to answer questions number five, six and
seven. I simply chose these series of questions due to the fact that I ve had all of the Freud I could
possibly take for one semester. All the questions I ve selected are involving Carl Jung and not
Sigmund Freud. To begin with my essay let s start with question number five which asks to explain
Jung s notion of collective unconscious . I very strongly believe that Jung s concept of collective
unconscious is mainly based on his personal experiences with people who suffer from schizophrenia
which he gained form when he worked with them at the Burgholzli hospital. At first Jung chose to
follow the Freudian theory of unconscious, but later on Jung eventually chose to go down his own
path and decided to develop his own theory on unconscious which would feature totally new concepts.
Most importantly being the archetype. Archetypes constitute the structure of the collective
unconscious, which are the psychic innate dispositions to experience and represent the basic human
behavior and situations. For example, Mother and child relationship which is mainly governed by the
mother archetype. The Father and child relationship is mainly governed by the Father archetype. Birth,
death, power and failure are controlled by archetypes.
Villa 2
The religious and mystique experiences are also governed
... Get more on HelpWriting.net ...
14. Analysis Of What You Pawn I Will Redeem By Sherman Alexie
1. Primary source
Alexie, S. (2003). What You Pawn I Will Redeem. NEW YORKER NEW YORKERMAGAZINE
INCORPORATED , 168 177.
The New York magazine first published the story in April 2003 featuring spiritualist Alexie holding
modern sentiments on the neo classical quest tale. The tale speaks of a man named Jackson who took
on a journey to recover a family treasure that was stolen from his grandmother. The priceless object
was dance regalia which were placed in a pawn shop after it were stolen. In his quest to reclaim and
repossess the family treasure Jackson reunites with several friends in an attempt to save money that
will facilitate the repurchasing of the regalia and get it back to the family. To reclaim the regalia
Jackson was needed to raise an amount of $999 and buy making an initial payment of $20. In his
meetings with friends instead of saving the money to reclaim the dance ... Show more content on
Helpwriting.net ...
A. (2008). Dialogue and Discourse Structure: A Speech Move Analysis of Sherman Alexie s Story
What You Pawn I Will Redeem . The State of Stylistics: PALA 26, 5, 303.
The scholastic research paper illustrates a comprehensive framework that is applicable in coursing a
fiction dialogue. It intends to exploit the Halliday s functional approach on the basis of elaboration to
initiate a conversational interaction and merged with a traditional discourse analysis to develop an act
for speech theory.
The study has put focus on analytical techniques that provides descriptive apparatus that presents a
simple and intricacy and dependency on an individual s capability to capture the disoriented speech
acts. However, course an interactive nature of conversation. Troyer provides a peer reviewed resource
by correlating the connection to the subject issue presenting firsthand. Tentatively, it offer insights
concerning Jackson and the building characters representing the Indian culture and offering diverse
perspectives and making it an ideal reference to analyze the quest tale and its
... Get more on HelpWriting.net ...
15. The Differences Between Hellenic Or Classical Ages And The...
This paperwork examines how the differences amongst the Hellenic along with the Hellenistic ages
might appear in the artistic r cultural production of every era. The ideas presented in this article bases
its focus on the Ancient period such as Ancient Greeks. Besides, the report also focuses on studying
the impact that Hellenic had on other times like the medieval period, the Renaissance, together with
modern times in appearing in the cultural production of each era. The presentation has the principal
objective of examining the differences between the Hellenic or classical ages and the Hellenistic ages
(Cicarma, 2014). This paperwork focuses on how the differences in these two generations influence
daily lives of people in the society. Besides, the illustrations on this article examine how the
differences between the ages reflected in the literature, art, art philosophy of the two periods. The
paper shows how the shift from Hellenic together Hellenistic era represents the changes from the
civilization dominated by ethnic Greeks. It, however, illustrates that scattered geographically to the
culture are disseminated by natives and speakers of Greek of whatever ethnicity and from the
dominance of political issues in the city state to that of larger monarchies (Holladay, 2011). This
presentation remains constrained in degree to Ancient culture between 510 BCE and 323 BCE, a
period that alludes to as Classical Greece.
Introduction
Hellenic continues to refer to the individuals
... Get more on HelpWriting.net ...
16. Pride And Prejudice Narrative Analysis
Jane Austen was and still is a very accomplished writer from the nineteenth century. The question I am
going to answer asks about Austen s narrative techniques and how they contribute to the overall
meaning of the novel. Pride and Prejudice is written at a time of contemporary historical change in the
world and yet Austen writes a novel where the main man changes his manners and a young lady
changes her mind. (Tanner 103). I am going to focus on her extensive archive of narrative techniques
specifically in chapter one of her novel, Pride and Prejudice, to show these changes. Throughout the
novel Austen uses third person narrative, omniscient narration, a dramatic narrative using dialogue,
letters and dramatizing of the consciousness of the ... Show more content on Helpwriting.net ...
An omniscient narrator is sometimes silent during events but also has the ability to direct us in what
we are thinking. A narrator who sometimes comments can sometimes feel like a character. It is not
right to assume that the narrator in this case is Jane Austen. The main theme does suggest a female
with a keen eye for fashion, it is also noticed that there are always women around when mentioning
men and lots of talk about weddings, of course it is possible that it is a male narrator, men can enjoy
fashion and play a key role in wedding
... Get more on HelpWriting.net ...
17. What Is The Impact Of Joe Louis Rematch On American Society
What was the Affect of the Joe Louis Versus Max Schmeling Rematch on American Society?
Word Count: 2,861
Abstract
In the late 1930s Joe Louis and Max Schmeling were two of the world s best boxers. Joe Louis was
the American brown bomber and Schmeling was the black man of the Rhine. Joe Louis was the world
heavyweight champion in 1938 and Max Schmeling was the man who took away his undefeated
record in 1936. When Louis was named the heavyweight champion he felt that he needed to beat
Schmeling to prove that he truly was the best boxer in the world. On June 22 1938 the two boxers
would fight a rematch. This fight had much greater social and racial meaning to Americans than just a
simple boxing match. How did the Joe Louis ... Show more content on Helpwriting.net ...
He was almost impossible to dislike even for the staunchest racists. He was famed for his Personal Ten
Commandments , which included rules like never being seen with a white woman and never gloating
over a fallen opponent. He was incredibly humble with the press. He was viewed as a self made boxer
coming from a family that lived in a shack; formerly share croppers, to the man that he became. He
represented the American dream for most Americans, that anyone can make something of himself or
herself. In Germany he was viewed as a dumb black man who did not deserve the title belt. He was
hated but not hated with only anger. He was also hated with sheer contempt. He was viewed as
inherently inferior simply because of his skin color. In America Max Schmeling was seen as purely a
villain. He was seen as compliant with Hitler s Nazi views. He was the stereotypical Aryan race
member. America saw his previous match against Joe Louis as a fluke. He was one of Hitler s best
friends and therefore the boxing extension of Louis. Hitler had previously said a black man could
never beat a German boxer. America hated Hitler and therefore hated
... Get more on HelpWriting.net ...
18. Bosnia V. Holocaust Essay
Genocide is the systematic and planned extermination of an entire national, racial, political, or ethnic
group. In Germany during World War II a man named Hitler tried to eliminate any race except for
what he called the quot;Arian quot; race. In the process he committed genocide by killing off 6 million
Jews and a total of 8 million people in all. Europe was going through some very hard times during the
mid 1900 s so that no one was able to see a disaster such as the Holocaust coming. Many things led to
the weakening of Europe at the time. The Ottoman Empire was breaking up plus they were still trying
to get over the devastation of WW I. Bosnia and Herzegovina had been having many problems as
well. They were a witness to much change and ... Show more content on Helpwriting.net ...
The Serbs then dominated Yugoslavia so they then decided to try and expand by setting up Serbian
regions in Bosnia. The Bosnian government did not allow that, thus leading to armed conflicts
between the Serbs and the non Serbs. Another major difference was the fact that Hitler started the
mass murder within his own country and expanded outward through Imperialism, Bosnia however did
not. When the Serbs got control of Yugoslavia they became more of a nation banded together than the
Croats and the Slovenes were, so what started off as a war became blown up into a mass murdering
spree.
In Bosnia the people who were doing the killing was not one person, it was the whole nation of Serbs.
Meanwhile in Germany the people committing murder were all looking up to one person. They
followed Hitler s ideas and not their own. Hitler was able to manipulate the minds of the community
and make them believe that what he was doing was good and was only for the good of the nation. In
Bosnia the people knew that they what they were doing was murder and bad and that they were killing
off the people just to gain power but that didn t stop them, their goal was to be the leading ethnic race.
In Bosnia it wasn t until the early 1990 s that the Croats and Muslims decided to fight together against
the Serbs. All the years of war before that took place with all three groups at odds with each other, and
the Serbs trying to kill them all off with
... Get more on HelpWriting.net ...
19. Fragile X Syndrome Essay
There are many forms of mental retardation. Webster s New World Dictionary defines mental
retardation as a condition, usually congenital, characterized by subnormal intelligence (Agnes, p404).
Mental retardation can be caused by a certain birth defect due to a traumatic event during the mother s
pregnancy, or mental retardation can also be inherited. The most common inherited form of mental
retardation is Fragile X Syndrome. Fragile X Syndrome was identified in the year 1991. This
disability affects more males than females. Approximately 1 in 4,000 males are affected, however only
1 in 8,000 females are affected (Lombroso, 2003). Fragile X generates in the FMR1 gene. Fragile X is
caused by an excessively repeating tri nucleotide, ... Show more content on Helpwriting.net ...
POF can lead to early menopause or infertility in females with Fragile X. Speech and language can be
two strengths in girls with Fragile X. Verbal skills in girls with FX are also generally good with no
speech problems. The area of conversational skills could be a weakness for girls with Fragile X
(NFXF, 2005). There are many characteristics as you look at both the male and female side of the
disability. One main characteristic is that many people with Fragile X also have autism, or possess
many behaviors that are autistic like (NFXF, 2006). Autism is defined as a developmental disorder
marked by impaired social interaction, communication difficulties, etc (Agnes, p43). About 2 to 6% of
children with Autism have Autism because of Fragile X. About one third of children with Fragile X
have Autism (NFXF, 2006). Also, many people with Fragile X can be confused to have Downs
Syndrome. The physical characteristics of Fragile X can be similar to Downs Syndrome. These
Fragile X Syndrome 5
characteristics can consist of prominent ears and forehead, high palate, flat feet, and flexible finger
joints (FX Syndrome, 2007). Although many characteristics are similar to Downs Syndrome, children
with Fragile X have been found to have fewer mistakes in many areas of speech than the children with
Downs Syndrome (Roberts, et al., 2005). Other characteristics can range from learning disabilities to
more
... Get more on HelpWriting.net ...
20. Origins And Roles Of B Cells And T Cell
1) How does the body respond when it first encounters a foreign particle or bacterial pathogen?
The way the body responds when it encounters foreign particles of bacterial pathogens is by it having
some cells called phagocytes that will recognize these pathogens, therefore a large number of
phagocytes will be sent to the location of where the pathogens were encountered and the defense
genes will activate, having proteins go through transcription and translation in order to kill the
pathogens in the body.
2) Compare and contrast the origin and roles of B cells and T cells.
B cells come from the bone marrow having a short life span defending against any bacteria or viruses
entering through the blood stream and lymph.
T cells come from
... Get more on HelpWriting.net ...
21. Performance Enhancements In Sports Research Paper
Forms of performance enhancement have been filling the world of athletics since the beginning of
time. Humans, driven by their natural competitive instinct, have always craved the thrill of winning.
Morals become questioned, abilities become enhanced, records begin to be set and all athletes want is
more. Many believe that the severity of performance enhancing drugs in the world of athletics is a
fairly new concept. What they don t realize is that even as far back as 100 AD the Roman Gladiators
were finding different stimulants and hallucinogens to prevent fatigue and injury. In fact, performance
enhancements are not limited to just the human athletes in competition either. During the times of the
incredible gladiators, they would feed trusted steeds a substance called hydromel; an alcoholic
beverage made from honey that would make them run even faster than before. There s never been a
time that gaining that extra edge hasn t been on the mind of our beloved competitors.
It s no secret, people love a good show. For thousands of years people from near and far would gather
to watch incredible athletes exhibit their super human abilities. But why, as spectators, do we find
such entertainment in watching muscle ridden hulks of men throw around extreme amounts of weight?
Or why do we enjoy watching ... Show more content on Helpwriting.net ...
Why do men and women set aside the knowledge of potential physical damage, public humiliation
and legal consequences all for that extra edge? Well, of course, the first thing that comes to mind, also
being the item that makes the world go around is: Money. Money leads too worth and worth leads to
fame. And what more does and an athlete want than to be famous? Many believe that the easiest way
to fulfil the life long dream that so many of us possess to become a super hero is to become a
professional athlete; kids will idolize you until the day you die. Or maybe in this case the day your
USADA administered drug test turns up positive and you re found out to be a
... Get more on HelpWriting.net ...
22. Doping Testing Should Not Be Banned
Steroids were introduced to the world by the Nazis because they needed aggressive soldiers (Sports in
America: Recreation, Business, Education,;Controversy., and Performance enhancing Drugs). Doping
was introduced into sports because people wanted to have an extra advantage on their opponents
(Sports in America: Recreation, Business, Education,;Controversy., and Performance enhancing
Drugs). Drug testing was introduced to the world in 1968 at the Olympics (Sports in America:
Recreation, Business, Education,;Controversy., and Performance enhancing Drugs). This paper is
meant to teach the world and yourself why doping in general is banned. Doping should not be allowed
for anyone, no matter their condition because it would give them an unfair advantage in their
performance, it may also have harmful effects on their health, and does not benefit our economy.
Doping should not be allowed because it would give them an unfair advantage in their performance.
Steroids offer an increase in body mass and strength. All these performance enhancers increase your
odds of obtaining your goals. These augmentations can range from body mass, strength, alertness and
decreasing appetites. Steroids also help athletes train harder and recover quickly from strenuous
workouts (CNN) the athletes who like to go beyond their limits and enjoy their time training for them,
they constantly use anabolic steroids because it allows them to have repeated strenuous workouts and
recover quickly. It takes a
... Get more on HelpWriting.net ...
23. Losing Teeth Research Paper
However, there are also children who are afraid of their teeth coming out and they might think that it
is painful and really uncomfortable. In this case, it is very important for parents to know when do kids
start losing teeth as well as the important do s that a parent should do for their little totes.
Parent s to do list
As a parent, it is very important to support your child every step of the way. Mothers and fathers alike
find great pleasure when they witness the different milestones in their children s life, and one of these
many milestones is losing their baby teeth to make way for the permanent ones.
Most children are fearful at the thought of losing their baby teeth because it will not only alter their
appearance but it will also make them feel uncomfortable when eating. Thus, parents should ensure
that they have prepared their children ... Show more content on Helpwriting.net ...
Your child may become shy of going out in the public with one or two teeth missing. However, it is
important for him to develop his social skills during that particular stage to assure that he will be able
to deal with different crowds as he grow older. You can bring him to different places for fun and
exposure.
When do kids start losing teeth?
When do kids start losing teeth? The answer to this one particular question may vary from child to
another depending on how they have grown their first baby tooth as well.
Normally, most kids start to lose their primary teeth when they hit the age between kindergarten and
first grade. The average age is between 5 to seven years old. However, do not stress yourself out if it
starts to wobble at the age of 4 or has not yet fall out by the age of 8. There are some children whose
teeth start to wobble months after their 4th birthday, and there are also children who do not lose their
tooth even after they hit their 8th birthday. These are still normal, so to speak. Generally, the younger
your child is when his first teeth came in, the earlier that they will fall out
... Get more on HelpWriting.net ...
24. Memorial Day Business Plan
If you and the family are going to be cooking out for Memorial Day, you may want to come up with
an original menu for your family and friends to enjoy. You can also include some timeless classics that
have always been a hit at Memorial Day barbeques and parties; here are a few recipe ideas that will
keep you from spending all your time in the kitchen, and more time enjoying the festivities. If you
want to go with a more patriotic theme, you can incorporate red, white, and blue into your foods by
creating a fruit parfait using strawberries, blueberries, and cream. You can layer these items in a clear
large parfait bowl, or you can make individual servings for each guest using plastic bowls or martini
glasses. Or, you can create tasty nachos ... Show more content on Helpwriting.net ...
What is Batik? Is that a specialty store that you go to for designer clothes? No! Its a beautiful
Indonesian artform used to put some bold and intricate designs in their cloth. The crafter puts a resist
of some nature, usually wax, upon the cloth in a design and then applying dye to the cloth. Wherever
there is no wax, the cloth will be dyed, but where the cloth is protected will remain the original color.
It is a fun and relaxing new craft that has other crafty applications. Honestly, the approach that I am
coming to favor is a bit different. My children are still young and enjoy crayons, which means they
enjoy BREAKING crayons! I had pure white delicious cloth and a bunch of broken crayons. There
was a small metal paint tray with little divits for the paint in my crafting drawer. Perfect. I broke up
each crayon into little pieces and filled several divits. Warming the whole tray in a steamer basket
double boiler on my stove. As soon as I achieved liquid wax, dipping a paintbrush in and painting
quickly I achieved a beautiful and colorful desgin. They key was to do it in very short strokes so the
wax would stay very HOT upon the brush. I have tried adding pariffin to the crayon for a more
diffused color and using just straight clear paraffin resist and dying the cloth too. I plan on picking up
some beeswax from a local beekeeper and trying that for a resist. After the wax cooled, I placed the
cloth between newspaper (I keep a roll of newsprint paper purchased cheap from my local
newspaper)and cardboard and then used my iron to warm the wax,wicking it onto the newsprint. It
took several changes, but finally I had bold colors and beautiful designs and wax free cloth . Once the
fabric has the wax free, it can be used in a variety of ways. Custom quilting designs, clothing design,
framed for artwork, creating pillows or even fabric for slipcovers! This is a completly customized
cloth for you to
... Get more on HelpWriting.net ...
25. Encore
Misheailia Neil
Which performances contained the greatest value in performance content (style, genre) and
characteristics (audience response, performer interaction, company size, training; length of
performance, structure, technique)? Identify 3 performances to build the content of your argument.
(Noises Off, Orchesis, and Vivo Flamenco Carlota Santana) The performing arts has always had trivial
meaning within the academic and artistic portions of my life, but after being continuously exposed to
the Elmira College Encore Program for two consecutive semesters my creative side has truly ... Show
more content on Helpwriting.net ...
The characteristics of this production certainly gave it a greater value. Another production that I felt
contained the greatest value in performance content and characteristics was Elmira College s very own
Orchesis. The content of Orchesis was also unlike any other production that I attended all semester
because it wasn t limited to just one genre of dance. The several performances embedded within the
show comprised of several diverse genres of dance ranging from ballet, to hip hop, to tap, to jazz, to
contemporary. This increased the production s vale because we rarely get to attend a show that
consists of a variety of styles with each one triggering a different mood. The characteristics of
Orchesis, which consisted of audience response, performer interaction, training, and length of
performance, also enhanced the show s value. The audience found enjoyment in each dance routine,
showing their gratification by singing along to the music selection, cheering for their friends, and
clapping at the end. The audience s actions and excitement surely gave the performers more
encouragement and filled the theater s atmosphere with enthusiasm. The performer s interactions also
escalated the audience s enthusiasm by dancing with us. They would either come off stage or come
from different places in the theater into the isles making the audience feel as if we were part of the
show. The training that
... Get more on HelpWriting.net ...
26. Rebel Without A Cause Character Analysis
Blood makes you related, but loyalty makes you family. Family is a key part of everyone s life and
makes a person who they are. Family gives people somewhere to go to when they are struggling or
cannot figure out what to do. Nicholas Ray directs the 1955 award winning drama film, Rebel Without
a Cause. Jim Stark (James Dean), Plato (Sal Mineo), and Judy (Natalie Wood) are not all friends at the
beginning, but through a series of events their friendships create a mini family. Rebel Without a Cause
shows a couple of rebellious teens who have little to no guidance at home trying to be themselves in a
society that will not allow it to happen. Jim Stark is a problematic teen who constantly gets into
trouble which makes his family move from place to place. Judy catches Jim s eyes and they seem to
have a connection, but she already has a boyfriend. Jim starts out the school year at a new High
School and has no friends. He gets into trouble with some tough guys led by Buzz (Corey Allen),
which creates inconvenience for Jim and his family. He befriends an odd boy named Plato. Buzz
challengers Jim to a competition which ends with Buzz dying. Jim befriends Buzz s girl, Judy after
this dramatic event and makes sure she is okay. Jim, Plato, and Judy now are on the run from the
tough guys and the police for the death of Buzz. It ends with Plato dying because of a police man
shooting him. The mini family will never be back together.
The Starks are a middle class family living in a
... Get more on HelpWriting.net ...
27. Self-Esteem And Self Esteemcy
Build their self esteem, self determination and efficacy
From the different challenges identified, it was established that adolescent girls were often confronted
with many identity conflicts and low self esteem. It was during the adolescent stage that many girls
experience new societal expectations and responsibilities, which often resulted in identity confusion or
internal conflict that needed to be resolved during adolescence. Consequently, the best ways of
engaging girls were to first build their self esteem, self determination, self efficacy and confidence.
According to Powell (2004), by being supportive and giving tasks and challenges that raise self
esteem, adolescent girls may be able to have success in school and develop self motivation. Powell
(2004) stressed the need for supportive environments and the need to allow adolescents to develop
their own unique identities. According to Erickson (1968), adolescents were often at the fifth
psychosocial stage of human development. This stage was called Identity versus Identity Confusion.
According to Erickson, if adolescents were not allowed to explore their new roles and follow a future
positive path, they may remain confused about their identity. Resolving conflicts during adolescence,
according to Erickson, assists adolescents to become who they would be, unique individual,
progressing further into higher developmental stages. Erickson noted that for adolescents to become
autonomous, their self concept and self esteem
... Get more on HelpWriting.net ...
28. Comparing Alienation In The Scarlet Letter And Easy A
In both the fiction romance novel, The Scarlet Letter, composed by American novelist, Nathaniel
Hawthorne and the romantic movie comedy Easy A, administered by American film director, Will
Gluck, the topic of alienation can be detected throughout the plot in order to show how the main
female characters in each work, have experienced the state of being isolated from a group or
community. Both creators and organizers of each piece of work, establish an ambivalent tone towards
the main female character. One of the most prominent topics found throughout both Easy A and The
Scarlet Letter, is that of alienation. In The Scarlet Letter, before the plot of the novel even begins, we
learn that the main female character, Hester Prynne, has been alienated ... Show more content on
Helpwriting.net ...
. . . The scarlet letter was her passport into regions where other women dared not tread. Shame,
Despair, Solitude! ( ) In The Scarlet Letter, Hester is brandished by the Puritan community, with a
scarlet letter A in which she must wear upon her chest. This scarlet letter represents her transgression
of adultery which she must wear at all times. This letter immediately creates a negative distinction
against her and everyone else in the town. To explain the quote, due to the fact that she wandered into
sin, she is singled out for criticism by those and women of the Puritan society leaving her to feel
alienated from everyone. Alienation can aswell be seen in Easy A through the letter A when Nina
Howell references The Scarlet Letter and tells Olive Perhaps you should embroider a red A on your
wardrobe, you abominable tramp. She says this to Olive after she has heard about the dirty rumors
about Olives so called sins, amongst the high school society. Nina references the letter A, to affirm the
fact that Olive is no different than Hester Prynne. Olive then fires back, Maybe you should get a
wardrobe, you abominable twat. She says this with intentions to stick up for herself after Nina tries to
make Olive feel alienated when she isnt the only girl, to say, who has committed acts of infedelity
with many guys in school. Throughout the movie, Olive lies for all boys that cannot get a date based
on their body type, race, etc. and in response they will give Olive gifts in exchange for her consent of
lying about their acts with her. Olive changes her wardrobe to look more unsuitable and embroiders a
red A on everything she owns, learning from her sins. Both characters experienced alienation through
the letter A, which is noticed in each of these
... Get more on HelpWriting.net ...
29. The Effect Of Photosynthesis On The Environment Of...
Photosynthesis is defined as the process by which green plants manufacture their food (organic
compounds) making use of carbon dioxide and water in the presence of sunlight.
It is also the synthesis of carbohydrate from sunlight, water and CO2 by the green plants. It is an
endergonic and anabolic process. Bacteria show an oxygenic photosynthesis as they do not use water
and do not evolve oxygen. Cyanobacteria (blue green algae) evolved oxygen first time in evolution as
they show oxygenic photosynthesis.
Photosynthesis is an endothermic reaction and it consists of a series of complex reactions. This
reaction during photosynthesis is grouped into two stages called Light reaction and Dark reaction.
This stage occurs during the day or in the presence of sunlight. The light energy or solar energy is
captured by the chlorophyll and electrons are excited. The energy so trapped is used to split water into
hydrogen ion (H+) and hydroxyl ion (H ). The splitting of water into hydrogen ion (H+) and hydroxyl
ion (H ) is called photolysis of water.
Water combines with carbon dioxide in the presence of sunlight within the chlorophyll of leaves to
manufacture food (glucose) and oxygen is liberated as a by product. Photosynthesis occurs in all green
plants. Photosynthesis is an endothermic reaction and it consists of a series of complex reactions. This
reaction during photosynthesis is grouped into two stages called Light reaction and Dark reaction.
During this process, oxygen is given
... Get more on HelpWriting.net ...
30. The Prisoner s Dilemma
This semester so far in Core 5, we have learned about the Prisoner s Dilemma. It is a situation in
which people each have options as to how to react to something. However, what is unique about this
decision, is that each person s decision is directly affected by the other person s decision, and vice
versa. The outcome of their reaction is dependent on what the other person decided to say. The popular
example is of two prisoners who each must separately decide on whether or not to confess to a crime.
Each prisoner has the choice as to confess to the crime or to deny their own involvement. This is just
an example, though, as the Prisoner s Dilemma can be applied to many different scenarios. As it
relates to climate change, each party has the ... Show more content on Helpwriting.net ...
Even stated by Dr. Rice, The evidence is there: nearly 100% of scientists agree (Rice). It is alarming
that millions are ignoring this problem they are just making it worse. Climate change is, a rapid
increase in temperature caused by increased carbon dioxide levels (Rice). When people choose to
ignore this, they continue to release careless levels of carbon dioxide without any care in the world
and continue to ruin our planet. We, as inhabitants of earth, have an obligation to take action and start
taking care of our home. Some people, perhaps, choose not to take action because it would be too
difficult or too expensive but that is simply not true. You can take a stand at home by simply adjusting
your thermostat, recycling, and monitoring your electrical use (Take). Taking action does not mean
you must buy a new vehicle or a new home you can make a change in many small ways. It does not
take a lot of time or money to protect our planet and those that live here. If everyone chooses to just
do something small, it will make a big
... Get more on HelpWriting.net ...
31. Pixar s Principles Of Economics In Monsters Inc
Monsters Inc. might just be seen as a Pixar animated kids movie when you first see it, but when you
look deeper into it, you can see many similarities to the general economic concepts; such as our
economy today. In the film, several principles of economics were covered. The film illustrated the
truth behind the difficult decisions common people have to make every single day. Which included
Scarcity, Choices, and Opportunity Costs, The Factors of Production, and the Supply, Demand, and
Market Equilibrium; are all involved in the story a lot of decision making, made by the main
characters. There is a scarcity of light energy when everything goes dark due to not generating enough
terror in children. A choice is seen when Sully is forced to balance
... Get more on HelpWriting.net ...
32. Evidence Based Practice Essay
In order to develop nursing knowledge and establish evidence based practice (EBP) in nursing, there
needs to be a concept model, one or more theories and one or more empirical indicators (Fawcett
DeSanto Madeya, 2013, p. 26). The theoretical framework can be advantageous in guiding and
supporting the design and execution of an EBP change. Using a conceptual model (C) theory (T) and
empirical research (E) provides the foundation for an intervention to an identified clinical problem.
Known as C T E structure, the application of this system in nursing practice involves an elevated level
of critical reasoning, which assists in knowing what data is important and how it relates to practice
change (Chinn Kramer, 2011; Fawcett DeSanto Madeya, 2013; Mazurek Melnyk Fineout Overholt,
2015). The doctoral level of nursing necessitates the need to combine the understanding and
knowledge gained from using the C T E structure, and then integrate the concepts and theories into
daily practice.
Concept
The concept of this EBP change project is compassion fatigue as it relates to nurses working in an
emergency department (ED) dealing with secondary trauma causing symptoms of compassion fatigue
(CF). Compassion is defined as the empathetic awareness of another s distress, united with a desire to
alleviate it (Merriam Webster s online dictionary, n.d.). Fatigue is the physical or mental depletion that
can be the result of strain, overwork, or disease (The Free Medical Dictionary,
... Get more on HelpWriting.net ...
33. Single Mothers In New Mexico
Family structure is a critical factor for a progressive society. If gender gap must be reduced
significantly in New Mexico, the size of single mother families must be reduced. This has the added
advantage of reducing poverty and allowing more women to participate effectively in the labor force.
Outreach programs should be broadened to identify young single mothers at the grassroots level and
not to single them out for social stigmatization but to support them develop skills that will empower
them. In addition, girls should be engaged through various programs to catch them young. These
approaches will help to define the problem of single mothers as economic rather than a moral one.
Thus, it becomes easier to leverage public support by the stakeholders ... Show more content on
Helpwriting.net ...
The most successful programs include the Colorado Family Planning Initiative (CFPI) and the Texas
Healthy Adolescent Initiative (THAI). The CFPI is the best know program across the country because
it led to a rapid decline in teenage pregnancy than any program in any state. The program lowered the
cost of long acting reversible contraceptives such as intrauterine which has been proven to be more
effective than the short acting contraceptive because it is not taken every day. Often, the long acting
contraceptive is provided free of any charge by the program. The Texas experience has been quite
successful too. THAI focuses on the six Texas communities with the highest teenage pregnancy rate.
The goal of the THAI program is to build a collective, local and action oriented comprehensive local
youth system to promote healthy youth development to allow young people reach their full potential.
The THAI program has achieved positive outcomes in reducing teenage pregnancy rate, childhood
poverty and school dropout
... Get more on HelpWriting.net ...
34. Tetrahymena Lab Report
In order to test the rate of phagocytosis in tetrahymena, the tetrahymena need to ingest particles that
are visible under a light microscope. The substance used in this experiment was India ink. India ink is
deep black colored ink containing dispersed carbon particles. The trethymena treat the India ink as if it
were food and ingest it. There were three concentrations of India ink that were fed to the eukaryotes
The percent s that were used are: 1%, 5% and 10% of India ink. After certain time intervals, the
tetrahymena were fixed with a compound called 3% paraformaldehyde (PFA).On the first day six
different mixtures of tetrahymena and ink concentrations were made to test which conditions would
express the best rate of phagocytosis. The well fed tetrahymena were fed with 1% India ink, the
another group was fed 5% India ink, the last group was fed 10% India ink. Then the starved
tetrahymena were fed in the same manner as the well fed tetrahymena. After adding the ink to the
microcentrifuge, we prepared a slide for each mixture at the following time intervals 2 minutes, 5
minutes, 10 minutes, 20 ... Show more content on Helpwriting.net ...
My partner and I choose glucose, colchicine, cold temperature (0 degrees Celsius), and warm
temperature (37 degrees Celsius) as the addition factors. The tetrahymena were exposed exposed to
their condition for ten minutes before the India ink was placed in their microcentrifuge. The
tertrahymena were fixed on a slide every ten minutes after the ink was placed in the microcentrifuge.
In this experiment there are two controls. There is positive control and a negative control. The
untreated sample is tetrahymena that did not have any other conditions besides the ink. Then before
the sample was placed on the slide they were fixed. The treated sample was tetrahymen mixed with
... Get more on HelpWriting.net ...
35. Appropriation Of Mindfulness
Mindfulness has slowly crept into modern day America and has become commonly thought as
unattached from its Buddhist origin. In order to attract customers and adherents, writers and teachers
of mindfulness separated it from Buddhism. Secular practitioners still benefit from mindfulness, not as
a religious meditative ritual, but as a concentration and thinking technique that can improve their
wellbeing and efficiency. Even if mindfulness is used as an improved thinking tool and health
practice, it remains linked to the Buddhist religion and ideals, and a clear ignorance of that
relationship is wrong no matter the benefits. The appropriation of mindfulness into secular America
also definitely waters down core Buddhist principles such as the ... Show more content on
Helpwriting.net ...
To secular teachers it is reasonable to completely ignore mindfulness Buddhist roots in order to
propagate it further. And one could argue that in fact that applies well to the idea of stopping the
suffering and the open approach to different beliefs that is an attribute of Buddhism. Yet, however true
that might be, it would be quixotic to think that modern secular mindfulness is being distributed solely
for its benefits to society. The advertisers and magazines sell out mindfulness as a product. They have
commercialized it into sessions, trainings and therapies for profits a complete shift away from the
principles of Buddhist teachings. If the real goal was to promote mindfulness for its health and
productivity benefits then its Buddhist roots would not be an issue. Most people would arguably want
to practice mindfulness to improve themselves regardless of the source. So in truth, it is the act of
selling mindfulness that, seeking to maximize its outreach, requires mindfulness as a completely
secular
... Get more on HelpWriting.net ...
36. Egg Lab Report
Did you know that eggs can be used for things other than eating? They can be used to show examples
of some scientific processes. These processes include, but aren t limited to, osmosis and diffusion. The
experiment I did is an example of eggs being used to show these processes in an experiment called
Eggsperiment . To do this I got four equal containers big enough to fit and egg in. Next, I put ¾ a cup
of several liquids in the containers with the eggs and checked it every 24 hours over a 48 hour period.
I started my egg speriment on October 16, 2015 with 4 eggs. Egg one was 145 millimetre(mm), Egg
two was 135 mm, Egg three was 130, and Egg four was 141 mm. They all had similar characteristics;
smooth, solid, white, with no imperfection that were visible. The first liquid that my eggs were soaked
in was distilled white vinegar. After two days of soaking in vinegar the shell was completely
disintegrated due to the acetic acid in the vinegar. Also, the vinegar had foam at the top with small
white fragments of the shell. When I was done soaking my eggs in vinegar Egg one became 147mm,
Egg two became 138mm, Egg three became 131mm and Egg four became 143mm and all the eggs
had become soft with a pale ... Show more content on Helpwriting.net ...
At the end of these 2 days Egg one had grown 3mm, Egg two had grown 2mm, Egg three had grown
4mm and Egg four had grown 3mm which was an anomaly because it was supposed to get smaller due
to the process of osmosis. Osmosis is the process in which water molecules are diffused over a
selectively permeable membrane. I noticed while measuring my egg that the yolk was starting to
become more visible and I could see it moving. At this time my eggs were soft and the liquid, water
was
... Get more on HelpWriting.net ...
37. Theories Of Tuckman s Stages Of Development
STAGES OF DEVELOPMENT the model presented by Tuckman and Jensen studies ... theory groups,
human relations training or T Groups, and natural and laboratory task groups have two realms task and
interpersonal (Tuckman Jensen p. 280). It suggests that team s growth occurs in stages with each
dissimilar through each level of development. Tuckman, identifies four stages of team development
referred to as, forming which occurs when individuals are introduced and brought together for a
purpose. Storming members strained relationships and conflict, about disagreement about a task,
vision and/or approach of a shared purpose, norming where unconsciously or consciously working
relationship members come to a consensus. Finally, performing team expecting
... Get more on HelpWriting.net ...
38. Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been utilized for tumor
targeting. Anti epidermal growth factor receptor (EGFR) Affibody protein (e.g., Ac Cys ZEGFR:1907,
amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQAPK
NH2) is used to target EGFR that is overexpressed in a wide variety of human tumors. Cheng and co
workers used anti EGFR Affibody protein as tumor targeting ligand on 64Cu Au IO nanoparticles
(PET component: 64Cu, MRI component: iron oxide, specific for EGFR) surface.[63] In their work,
A431 tumor cells were subcutaneously implanted in the right shoulders of nude mice; and 64Cu
NOTAAu IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive A431 (human
epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after injection, significantly higher
than that obtained from the blocking experiment (1.9% ID/g) indicating the specificity of the probe.
This difference in % ID/g values corroborated with 44% drop in MRI signal intensity that was
observed for the tumor. In this study, the use of an Affibody protein as ligand for EGFR expressing
tumor in small animals was demonstrated to be successful; however, the benefit of multimodality was
not demonstrated. The unique chemistry of this dumbbell shaped Au IO nanoprobe could pave the
way for targeted drug delivery into EGFR expressing tumors
... Get more on HelpWriting.net ...
39. Who Is Dr. Gachet
Vincent Van Gogh is a widely known painter throughout the world for multiple reasons. His paintings
weren t just paintings, they were life experiences. Van Gogh s life was an emotional and mental
rollercoaster. Every single one of his paintings contained a story behind them. The visual aspect
seemed as if they were full of motion. His painting techniques seemed to be impeccable. During the
time period in which he was working on art, there was a big movement called the Impressionism
Movement. This movement inspired artist to draw more landscapes and incorporate motion into their
art. Van Gogh took full advantage of this movement. Van Gogh s hard life and painting strategies are
what made him so amazing as an all around artist. One of Van Gogh s ... Show more content on
Helpwriting.net ...
When looking at the painting, dark blues consume most of the image. The portrait of Dr.Gachet is
painted with a sad, gloomy expression on his face. The painting, by Van Gogh, has a strong
connection to Vincent s personal life and relationships. This allows Vincent to apply his feelings and
experiences through the art. Dr.Gachet was a close friend of Vincent s brother Theo. Dr.Gachet was an
actual doctor that focused on homeopathic cures. He brought Vincent into his own home to try and
assist with his severe condition of depression as much as he possibly could. With living in a house
together Vincent and Dr.Gachet became close friends. Dr.Gachet even began painting as a side hobby.
Vincent would often show Dr.Gachet some small techniques when it came to painting. Dr.Gachet
became a man the Van Gogh became slightly attached to. The look on Dr.Gachet s face in the portrait
is supposed to resemble the sadness that Van Gogh had felt. Vincent felt as if his depression may have
worn off on the doctor. In the article Portrait of Dr.Gachet(July 2006) by Sandra Bertman, it states,
Van Gogh felt particular affinity for him on account of their similar bouts with depression and their
dependency on their vocation for emotional and intellectual fulfillment (para.3). With knowing the
background of Dr.Gachet s
... Get more on HelpWriting.net ...
40. Lady Of Shalott Comparison
The selections in this Echo: The Quest for an Ideal, all present alike themes in various perspectives.
The theme, reaching for a goal we desire to achieve can encourage us to grow and evolve, although, if
that goal is for perfection the outcomes can be devastating, is displayed in multiple selections. Two
selections that will be explored are the poem The Lady of Shalott by Alfred Tennyson and the song
Candle in the Wind by Elton John and Bernie Taupin. These selections provide sufficient evidence to
support the overall theme of The Quest for an Ideal.
The poem, The Lady of Shalott by Alfred Tennyson, provides an allegorical meaning of an artist
trying to perfect their work and sacrificing a great deal in order to achieve perfection, ... Show more
content on Helpwriting.net ...
This song is a eulogy that was written for Marilyn Monroe after her tragic passing due to an overdose.
Marilyn Monroe s goal was to be famous and to be the image of perfection, but when she obtained the
fame that she believed she wanted, she felt troubled as she felt like she was playing a role and not
being true to herself. In the line, And they made you change your name, it displays the pressure that
she was under in order to achieve her goal of fame. Marilyn Monroe was told to change her name
from Norma Jean to Marilyn Monroe in order to become the perfect person that everyone wanted her
to become. This made her feel as if she was constantly playing a role and lead to a source of
discontentment in her life which led to her untimely death, a devastating consequence of reaching for
perfection. Another reference to the song is, Never knowing who to cling to, this represents the
loneliness in her life when she achieved her goal of fame. Although, she had accomplished her goal
and was what many considered to be perfect, she had no one around her to give her support and when
times were hard she had no one that she could rely on. To the outside world, it seemed like Marilyn
Monroe was the essence of perfection, but, she had her demons and felt lonesome in her own life. This
again is a devastating consequence of having a goal of perfection. A lyric of the song, And pain was
the price you paid, summarizes the theme of the unit as while she was reaching to obtain her goal of
perfection, in the end all she felt was pain and loneliness. The result of Marilyn Monroe s goal of
perfection was ultimately destructive as it was a factor in her
... Get more on HelpWriting.net ...
41. Hair Blonde Stereotypes
Better Than a Blonde?
Do you think brunettes and redheads are superior? Well, think again. For years, blondes have been
associated with words such as dumb , needy , promiscuous and other unflattering adjectives. Even
with these unfortunate stereotypes, research proves that blondes may be the exact opposite. Those with
blonde hair are smarter, wealthier, and are genetically predispositioned to have attractive qualities.
Blondes have been proven to be the most intelligent when compared to other hair shades. In a study
conducted by the Ohio State University where 10,878 females were surveyed, blonde women enjoyed
an average IQ of 103.2. Those with brown hair mustered a mere 102.7. Redheads managed 101.2. And
what s with black haired women? Theirs was an average IQ of 100.5 (Matyszezyk 2016). Blondes
typically have a stigmatism associated with them, such as being dumb and having little common
sense. This stereotype often appears in the media, with numerous movies focused around blonde
women with little intelligence. While this doesn t automatically equate directly to genetics, it can
mean that blonde women are better set up for success. Research by the National Longitudinal Survey
of Youth shows that people with naturally blond hair were found to have typically grown up in
environments with more reading materials available to them, allowing for more intellectual
stimulation during their early growth period than people with other hair colors had (Ricevuto 2016).
... Get more on HelpWriting.net ...
42. Traditional American Family Essay
When the idea of a family life first began, the man was supposed to be the sole breadwinner while the
wife stayed home to cook or clean or take care of the children. A traditional American family used to
be a mom and a dad, with a few kids. However, that white picket fence lifestyle has become almost
abnormal now. Ever since the choices of divorce, homosexuality, even role reversal have been offered
to families things have never been quite the same. In the early days, divorce was an extremely
shameful thing. The concept of for better or worse truly held it s meaning. A man and a woman would
almost never split up, no matter how bad things got. Today, divorce papers can be mailed and signed
with virtually no hassle, making the ending of a marriage ... Show more content on Helpwriting.net ...
A century ago, homosexuality would have been a taboo thought. A family was made of a man and his
wife, with their natural children. With the choice of homosexuality being introduced, people can now
marry whoever they want to and have kids from a surrogate, from adoption, or even from artificial
insemination has greatly expanded familial bounds. A century ago, the man of the household was the
one that brought home the bacon. His wife would be waiting for him at home with a cold beer or other
beverage and have his favorite show on if a radio or TV was available. Fast forward a century and stay
at home dads are becoming more common. Single parents are almost normal to see, and the woman of
the house is now allowed to earn a paycheck. By giving families a choice in how they want to go
about daily life has greatly changed how families work now. As Pew Research Center states it, Parents
today are raising their children against a backdrop of increasingly diverse and, for many, constantly
evolving family forms. By contrast, in 1960, the height of the post World War II baby boom, there was
one dominant family
... Get more on HelpWriting.net ...
43. Essay Making Management Decisions
Making Management Decisions
ASSIGNMENT 1
Lewandowska Santhirasekaran
1. Principles of business planning and decision making
Decision Making is A commitment to action (Mintzberg, H., 1983, p. 188) ; Management decisions
are made for a lot of different reasons, mainly because decision making is a fundamental aspect of the
management functions and management decision making which makes it a key management role. (M.
Teale, V.Dispenza, J. Flynn, D.Currie, 2003, p. 10) (D. Boddy, 2008, p. 209)
Now a day s making management decisions has become more and more difficult, they need to be
made more and more quickly; have to be made in increasingly complex and unpredictable situations.
... Show more content on Helpwriting.net ...
(www.balancedscorecard.org, Paul Arveson, 1998 2013)
According to the situation the LiveShows Ltd is at now, all of the decisions will be programmed , it
can be assumed that once programmed decision has been made, then the consequences will be known.
These decisions are normally characterised by a known set of objectives, and can lend themselves to
programmed decision making methods. Management science offers tools and methodologies that
enable the organisations to deal with managerial problems. It deals with collection, interpretation and
presentation of data; however it is important to remember and understand the limitations, assumptions
and specific applicability of the methods in question. (M. Teale, V.Dispenza, J. Flynn, D.Currie, 2003,
pp. 228, 229)
The decisions are based on business objectives and context; decision making types can also divide into
three, depending on how much the decision made will affect the business in terms of time and
direction; these include:
Strategic Decisions long term decisions that affect the direction of the business
Tactical Decisions medium term decisions based around how to implement a strategy
Operational Decisions short term decisions, also known as administrative decisions about how to
implement the tactics. (T. Hannagan, 2008, p. 425)
2. Possible constraints and problems that may hinder effective decision making
Once the decision recognition phase has occurred,
... Get more on HelpWriting.net ...
44. Grendel And Beowulf Comparison
Beowulf and Grendel are two well written pieces of literature that feature a monster like figure and his
struggle to overcome his urge to kill. Based on the passages read, the poem and book feature the same
basic plot line. However, the stories reflection of the main character show both similarities and
differences due to Beowulf s third person point of view compared to Grendel s first person point of
view. Ultimately, the change of perspective between the two stories does not not impact the outer
appearance of Grendel, but rather the inner personality.
The two excerpts introduce us to the main character Grendel, who is displayed as a monster on the
outside. Both passages give some deep insight on the character developed throughout
... Get more on HelpWriting.net ...
45. The Role Of Churches During The Medieval Era
During the Medieval era, countless cathedrals and churches were built as religion became popular and
widespread around Europe. Back in the Medieval period, churches gained an absurd amount of money
in various ways, such as people would travel to church to observe relics and donate to be blessed or
healed, people would buy indulgences, and people would donate their land to church when they died.
Firstly, citizens back in the Medieval era would travel to churches to see the relic or relics there or to
be blessed and healed. Numerous amounts of people would go to church to be blessed by the relics.
Consequently, Many churches were built around reliquaries to bring people in. Reliquaries hold a
piece of a religious figure, usually a bone of a
... Get more on HelpWriting.net ...