Essay Integrity

Essay Integrity
Writing an essay on the topic of "Essay Integrity" poses a unique challenge due to the abstract
nature of the subject matter. Integrity encompasses a multitude of dimensions including honesty,
moral principles, consistency, and authenticity, making it a complex topic to dissect and discuss
thoroughly.
One of the primary difficulties in writing such an essay is defining the boundaries of integrity
itself. It's a concept that varies greatly depending on cultural, societal, and individual
perspectives. Therefore, attempting to provide a comprehensive definition that resonates
universally is a daunting task.
Furthermore, maintaining coherence and clarity while navigating through the myriad aspects of
integrity can be challenging. Addressing its applications in various contexts such as personal
integrity, academic integrity, professional integrity, and societal integrity requires a nuanced
approach to ensure that each dimension is adequately explored and analyzed.
Moreover, discussing the importance and implications of integrity inevitably leads to
philosophical inquiries about the nature of right and wrong, ethical dilemmas, and the balance
between individual values and societal expectations. This adds another layer of complexity to
the essay, as it demands a deep dive into ethical theories and principles.
Additionally, crafting an essay on integrity necessitates a high level of introspection and self-
awareness from the writer. It's not merely an academic exercise but a reflective process that
requires honesty and sincerity in exploring one's own beliefs, behaviors, and values in relation to
integrity.
In conclusion, writing an essay on "Essay Integrity" is a challenging endeavor that requires
grappling with abstract concepts, navigating diverse perspectives, delving into ethical theories,
and engaging in introspective reflection. However, despite its difficulties, such an essay offers
an opportunity for profound exploration and understanding of a fundamental aspect of human
behavior and society.
Similar essays and much more can be ordered on HelpWriting.net.
Essay Integrity Essay Integrity

Neil Gaiman s The Graveyard Book
In Contempt of the Book
Neil Gaiman Wrote, The Graveyard Book Published by HarperCollins September
30, 2008. The book contains 320 pages and illustration copyright 2008 by Dave
McKean. This is a children s book containing the genre of fantasy and fiction of the
dead and supernatural. I choose this book based on the choices of horror in the
selection of children stories.
Introduction to the Author
Neil Gaiman is an English author of short fiction, novels comic books, graphic
novels and audio theater films. Most of his works take interest in fantasy, horror,
science fiction, dark fantasy, and comedy. Neil Gaiman wrote this book in the setting
of the graveyard based on the availability of his own child s interaction with his
playtime. Relying ... Show more content on Helpwriting.net ...
After his parents and sister were murdered, he ended up crawling to a nearby
graveyard which ghost chose to adopt him. Most of what was going on with his
killer s purpose was not revealed until close to the very end. Although through his
years of growing up he has befriended many of the dead and living and was granted
the ability to have close to the same powers as his ghost guardians. His guardian,
apart from his parent Silas was the only being between the death and the living,
and is a most important role to Bods life. Unlike the other ghost, he has the ability
to go out into the world outside of the graveyard to give Bod lessons and to give
him food to survive. Bod has restricted rules to keep him safe and protected from
the distant killer called Jack to always stay in the graveyard. The most he has
gotten out of the graveyard was befriending a living girl when he was little and
meeting her again after departing. He also was caught by strangers outside of the
graveyard and of those strangers who have known and allied with Jack was close
enough to danger. He has also experienced the bright side of the outside world
discovering that the living and dead do get acquainted. And importantly
experiencing like other kids his age a period of going to school to grant more
experience of the outside world. However, those experience was short and vivid as it
may be important to him, but not to

How Is Catherine The Great Controlled Russia
Catherine the Great also known as Catherine II, (who was the most longest ruling
female in Russia) had ruled Russia form 1762 to 1796. During her time in throne,
Catherine had made Russia a more developed country in many different aspects.
Catherine the Great had effected nobility, peasantry, military, religion and taxes
/ government spendings. She controlled all of these aspects of Russiaand these are the
main reason why she is the absolute monarch.
Like i said Catherine controlled Russia nobility. Nobles were a class of people with
high political static and Catherine the Great had power over them. When Catherine
was in throne the nobles called it the Golden age of Russian nobility, this is because
Catherine the great authorized a new law that would free the nobles form
compulsory military. She not only did that, she build many mansions for them (and
there were designed in western designs due to that that was the main style back
then). Finally Catherine wrote manuals for the education for the young noble girls
and she also assigned a charter to the nobles. As you can see Catherine s relations
with the noble is strong and you see how much control over she as on them. ... Show
more content on Helpwriting.net ...
Catherine the great wan t much of a fan of peasants, intact in 1766 she declared
that peasants should not get paid and have a one meal plan a day, of course this was
then reenforced by the nobles persuasion. And in 1775 most of the Russia military
force were mostly peasants who were forced to take part. Catherine the great thought
of peasant as you would think of pawns in a chess

Social Connectivity And Its Effects On Society
Imagine if everything in the world around you existed only in theory but didn t really
exist at all. How much would you have to worry about the consequences of your
actions? This kind of nihilism isn t practical when you go out in public, but
computation and social connectivity may be the closest thing, in the real world, to the
construction of an actual nihilistic landscape. When you go online, you often won t
have to worry about tarnishing your identity and reputation because, with anonymity,
it never really existed to your audience in the first place. There are many places
where you don t have to worry about saying the wrong things because there aren t any
authority figures to effectively enforce them. The internetdoesn t so much... Show
Here you have two major American political candidates from both the Democratic
and Republican parties emphasizing the need for authority and moderation for the
dangerous aspects of the World Wide Web
. In one sense, it s easy for people to mock
just how vague, naГЇve, and impractical this idea sounds, as shutting something
down online doesn t necessarily prevent it from being built up again. In another
sense, it s long overdue for politicians to start taking the issue of toxicity in global
internet activity and reactivity very seriously. This issue is not so much about
terrorism itself. Fundamentally speaking, it is about the downsides of the internet s
global reach and the lack of exclusivity that dangerous ideas have because of social
media s accessibility. In can be argued by the social contract theory that people, in
general, will submit to their governments under a common law to live in a civil
society. In other words, the authority of the law, and its ability to dish out
consequences for actions, is what can ensure communal peace and security among
people. But legislation has a notorious lag time in its ability to properly keep up with
technology and its sociological uses. There arguably isn t a clearly defined social
contract on the internet. Overall, this is an issue about how internet rhetoric seems to
be fueling a contagious toxic culture,

Sterigmatocystin Essay
Sterigmatocystin (ST) is a carcinogenic polyketide [12] produced by species in
several fungal genera. Microfungi capable of producing ST are common food, feed
and indoor contaminants, and may also be plant and mammalian pathogens, thus
having a large economic impact for the biotechnological, agricultural and food
industry [12, 13]. Nanotechnology plays an important role in the fabrication of
different nanoparticles that can exhibit novel antimicrobial properties [14]. The nano
scale of metals play roles in understanding the ability to manipulate biological
processes which will be the central theme for present biomedical and biological
issues that need a nanoscience or nanotechnology approach [15]. Shahverdi et al [14]
... Show more content on Helpwriting.net ...
Moreover, selenium has also been found to trigger the generation of ROS, with both
elements capable of reacting with intracellular thiols and forming intermediates that
cause oxidative stress as a consequence of the formation of superoxide radicals [21,
22]. Nanoparticles can contribute to functional damages of cell membrane or wall by
disrupting the integrity of these important envelopes [23]. Selenium nanoparticles
(SeNPs) have become the focus of intensive research owing to their wide range of
applications in areas such as antioxidants [14, 24 26], antibacterial activity [16] and
anticancer [16, 27] applications. However, so far not much has been reported on the
evaluation of antifungal activity of SeNPs. Studies of Shahverdi et al [14] have
shown that antifungal formulations in the form of nanoparticles could be used as
potential fungicidal material. It has been found that SeNPs exhibit low cytotoxicity
compared with selenium compounds and possess excellent anticancer and therapeutic
activities making them apt for medical applications [28, 29]. SeNPs have anticancer
activity against kidney, breast, and lung [30, 31] and hence, can be used as
chemopreventive and chemotherapeutic agents. On the other hand, SeNPs
synthesized from a biological source possess a significant antimicrobial activity
against pathogenic bacteria, microfungi and yeast [32].
The aim of this study was to investigate the complete inhibition of three toxigenic

Comprehensive Legislation Of Social Media Privacy
Comprehensive Legislation to Protect Social Media Privacy Reading and Writing
Workshop II, Section 007 Qiu Jin (Rachel) August 11, 2014 Comprehensive
Legislation to Protect Social Media Privacy Abstract The article makes a research
on both the present situation of social media users privacy, and the work of the
FTC and other federal departments to protect social media privacy. However,
without a comprehensive legislation in the federal level, the fragmentation of such
trial cannot arise enough and active attention to privacy issues in the industry and in
public. So the article suggests comprehensive legislation and gives recommendation
on primary elements the legislation should take into consideration. Key Words
Social Media, Privacy, Legislation, The FTC Introduction Social media is a digital
communication process that connects people in the creation and exchange of
dialogue, content and communities. Nowadays, social media have been playing
more and more important roles in public communication. However, some issues
have aroused accompanying the popularity of social media, for example,
information overload and easy access to obscenity, but the most important issue
about social media is the sacrifice of personal privacy. Everything you do on social
media is public by default, and you have to change the personal settings to make it
private. What is more serious, once information gets revealed to public, it will soon
spread to the whole

The Power Of Dark Love
The Power of Dark Love The speaker in Porphyria s Lover says, That moment she
was mine, mine, fair, perfectly pure and good (Browning, lines 36 37). Both Robert
Browning and Edgar Allan Poe share a love for the themes of obsession, desire, and
complicated love. Each of those three themes play an important role in dark love
poetry. Each poet describes the main character in their poems as a woman worthy of
the speaker s obsessive, complicated, and desirable love. Both Robert Browning s
tragic Porphyria s Lover and Edgar Allan Poes mysterious Annabel Lee explore the
theme of dark and obsessive love through their use of imagery, alliteration, and
mood throughout the poems. At the early age of five, Robert Browning was a
very profound child being that he was already extremely knowledgeable in the arts
of reading and writing. He was a very anxious student and continued to learn many
languages by the age of fourteen. In 1833, Browning published Pauline and in
1840 he published Sordello but both were sadly known as a failure. He even
attempted to publish several plays but they were all unsuccessful. Browning did
not become successful until he published his collection of poems Men and Women
in 1855. In 1842, Browning published Porphyria s Lover, which is also a successful
poem ( Robert Browning ). In Porphyria s Lover, the speaker is watching and
waiting for Porphyria on a cold, stormy night. Once Porphyria has returned, she lights
the fire, takes off her warm

Copeland s Essay Is Facebook Making USd,
In today s world, technology is at its peak. However, there was a time when things
were getting evolved and websites were created to connect and socialize. For
example, Facebook was created with the intent of connecting with people, but it
rather forced people to compare each other s live, which made some people sad. It
became successful, but not completely successful. Libby Copeland s essay, Is
Facebook Making us Sad, addresses a key factor in how Facebook makes us sad,
according to research and some expert testimony. One key factor that I would like to
address in the essay, how humans compare their lives with others on Facebook,
making themselves lonely and sad.
Copeland writes, according to a paper published in January 2011, that Misery has
more company than people think (Copeland 541). She lists some research that was
done by Alex Jordan, a Ph.D. student at Stanford University and got ... Show more
content on Helpwriting.net ...
However, there are also some parents who have their account on Facebook and they
keep sharing videos and photos of their child. This is keenly making us aware of
the resulting disconnection from the reality Copeland says. Copeland writes.
Parenthood this way creates a story line of delightfully misspoken words, adorably
worn hats, and blown kisses (Copeland 543). If you compare your own decisions to
those of other women, then you are actually likely to increase your own sense of
inadequacy. As Copeland reported from the research, women are more active users
on Facebook than men. A study from the University of Texas at Austin, supports
Copeland s point that men are more likely to use the site for news or current events,
but women tend to use the site to get into personal communication such as, posting
photos, sharing content related to friends and family (Copeland 543). These is where
the problem comes in, as it makes harder for women to avoid the comparisons that
make it

China Anne Mcclain Essay
China Anne McClain Bio, Wiki, Dating, Net worth, Boyfriend, Ethnicity, Sisters
Short Bio Who is China Anne McClain?
NAMIC Vision Awards winner China Anne McClain is an American actress and
singer. She has already started her acting career at the age of seven. She rose to fame
with a notable role of Jazmine on Tyler Perry s House of Payne. She is also known as
Chyna Parks in Disney show A.N.T. Farm and as Uma in Disney Channel movie
Descendants 2. As a singer, she is a band member of McClain. Her song Calling All
the Monsters reached the eighty sixth spot on the Billboard Hot 100. She has also
sung her own version of Taio Cruz s Dynamite .
Dating Know more about China Anne McClain boyfriend
Reflecting on a personal life of China Anne McClain, she is possibly single. She is
currently just 19 years old and she is more focused towards her career goal rather
than being in a married relationship. Previously, she had a boyfriend Jake Short.
They started dating since 2012 but their romantic relationship soon came to an end in
2013. After onwards, she didn t have any boyfriends. There isn t other information
about her going out on a dating with someone else that we know of.
Ethnicity Know more about China Anne McClain origin ... Show more content on
Helpwriting.net ...
On 23 July 2011, Disney Channel premiered her first music video for Dynamite
which got more than 1 million views on YouTube within a week. She has won the
first season of ABC s Sing Your Face Off. Her success in career path has paid her
well financially within a short period of time. Her actual annual salary isn t
disclosed to people in general whereas her net worth is estimated to be $600
thousand. As a young artist she became successful to achieve such a huge sum and
as she grew up there is no doubt that her salary and net worth will increase to
another figure. In 2018, she will appear with the lead role of Jennifer Pierce in the
television series Black

Essay about Analyzing and Improving Multimodality in
the...
The purpose of my memory artifact is to argue that epic poetry is a form of
memory representation used to portray the collective memory of a nation and a
civilization. An Epic poem is a long narrative poem that deals with an event
significant or important to a culture or nation. I believe my presentation was quite
successful since I was able to get my message across and make a connection with
the audience. However, my presentation only incorporated the visual and oral
components of WOVEN and failed to stand alone by itself. My presentation could be
enhanced by fully utilizing the Prezi s features by highlighting key ideas, adding
colored fonts and by elaborating on definitions and historical contexts.
I wanted to do my presentation with ... Show more content on Helpwriting.net ...
My Prezi mainly used two modes of communication. It was an interaction between
oral and visual form of communication. My Prezi began with the topic of my
memory artifact. The presentation was constructed on two images, which were
posters of Beowulf and Sir Gawain. These two images served as a background. I
had a lot of zooming features in my presentation, which zoomed into different parts
of the background to show the minimized images and the key point to take away
from the illustration. So, the Prezi first discussed key characteristics of an epic poem.
For each characteristic there was a picture or an example explaining what the
characteristic was talking about. For example, my presentation touched on how epic
poetry always started in medias res (middle of things) and to illustrate the
characteristic I had a picture of Satan burning in hell after losing his battle to god,
which was how Paradise Lost began.
After going through the characteristics, the Prezi just had some key points that
helped me make my point. So, I elaborated on how epic poetry was a representation
of collective memory, which tied with the beginning of my presentation (I started off
by stating my thesis). Also, in my conclusion, I achieved a closure to my presentation
by not only addressing key points to the presentation but by also further expanding
the thesis by discussing the importance of collective memory and how epic poetry
successfully captured the importance. I made sure I was talking to the

Modern Accumulation Of Property And The Scarce
Employment...
Modern accumulation of property and the scarce employment opportunities in Kenya
Elphas Kiprotich Ngeno (Master of Arts student)
B.A (Political Science and Public Administration, Moi University, Kenya)
Abstract
This paper is a brief highlight on the process of property ownership in Kenya, from
the colonial period to the present day. It begins by explaining property allocation and
ownership from the colonial periods from the perspective Karl Marx Primitive
accumulation . It further points on the character of leadership after independence and
the insensitivity to people s problems that governed property allocation in the
independence leadership. In the second section, it explains the capitalist nature in the
country, characterized by endless acquisition of property by the powerful and control
of the upward mobility. Education remained the only means to succeed at one time
but again the rate of unemployment, deplorable working conditions and policies has
made education meaningless. The only means to own property that gives opportunity
to every boy is using skills and become self employed or turn to talents. These
however still rely on government s efforts and willingness to provide a conducive
environment, financial and training.
Introduction
A critical analysis on the works of Karl Max primitive accumulation of property
(DeAngelis, 2001), serves to explain the post independence Kenya and the transition
to capitalism. Patron client relationships are clearly supported by

Chelsea Manning Research Paper
There is perhaps no whistleblower in the United States more well known than
Chelsea Manning. A hero to some, her leaks have been credited as being a catalyst
for the Arab Spring, exposing the support of the US government for corrupt dictators
all throughout the Middle East. She is also credited for exposing the misdeeds of the
US military in its campaigns in Iraq and Afghanistan. She also has a large number of
detractors, many of whom claim her leaks endangered the national securityand
foreign policy interests of the United States. Some go so far as to call her a traitor
an allegation so serious that there have been calls for Manning to be executed. It is
not surprising that the person responsible for the largest leak of classified
intelligence in the history of the United States would be a very controversial figure.
This essay will explore the life of Chelsea Manning, the classified material that was
made public as a result of her leaks, and her eventual arrest and imprisonment. Upon
close analysis, it can be shown that while Manning leaked classified material in an
improper manner, the American people have a... Show more content on
Helpwriting.net ...
Born the son of two alcoholics, Manning s older sister claims that their mother
drank during her entire pregnancy with Chelsea. Manning says she had a very
difficult childhood, with two alcoholic parents who did little to care for her, and
depression due to what she would later identify as gender identity disorder. Her
parents divorced in 2000, and in late 2001 she and her mother moved to Wales,
where her mother was originally from. Manning says she was bullied extensively
while attending school in Wales. The other students teased her relentlessly for being
overly feminine acting, as well as being the only American in the school. In 2008,
Manning graduated high school and returned to the United States and moved in with
her father and

Components Of The Value Chain
Manufacturing Blog Manufacturing, the process responsible for producing any
goods manipulated from their raw form, whether transforming steel into an
automotive vehicle or grains into cereal, this fundamental component of the value
chain plays a central role in the world economy. Born during the industrial revolution,
many of the processes remain the same, with executives running the factory,
supervisors overseeing operations, shop floor workers creating the product, and
maintenance workers ensuring the smooth running of equipment. While these
processes have transcended time relatively unchanged, the technology and tools
employed by workers to complete these processes has changed, albeit slowly in some
cases. Driven by executive pressure to reduce costs and improve margins, factories
through the ages have engaged in strategic moves to diminish the expenses of labor.
Moving to areas with less stringent regulations and lower labor costs or investing in
technologies that automate human tasks, competitive pressures has made the
manufacturing sector one of the most technologically evolved. Assembly line
equipment/technologies have reduced lead times and cost by automating processes
and taking the place of a variable cost (labor). These capital investments in equipment
will continue, especially as better access and distribution of information improves the
efficiency of their use. Responding to market conditions and cutting or increasing
production rapidly just in time

Examples Of Abigail s Monologue For The Crucible
As I have stated earlier Abigail wants John Proctor, She and John proctor had an
affair in his household as she served them in it. She was so desperate she tried to
kill John Proctor s wife basically using witchcraft, aka drinking blood. Betty says,
You did, you did! You drank a charm to kill John Proctor s wife! You drank a charm
to kill Goody Proctor! (919); Abigail already has a bad image going for her since
she was fired from her job for no reason . If we are counting the girl already has a
terrible reputation, she had her fun with a married man but after getting kicked out,
but she is STILL pursuing him. You are young there are many single young men out
there, get something better to do with your life, you are out here letting people...
Show more content on Helpwriting.net ...
I want the light of god, I want the sweet love of Jesus! I danced for the Devil; I saw
him; I wrote in his book; I go back to Jesus; I kiss His hand. I saw Sarah Good with
the devil! I saw Goody Osburn with the Devil! I saw Bridget Bishop with the
Devil! (934). This statement was made by Abigail basically to put more attention
on her, the more attention she got the closer she is to being so believable she can
insult the best person there is and people will still believe her. It will take a lot of
innocent people s lives to get exactly what she

Dr Mcmahon Character Analysis
A story to consider Epic needs to have a heroic character, like The history of the
Kings of Britain, demonstrated by describing each king and his adventures during
their lifetime. Indeed, most of the epic stories are realistic, but like Dr. McDonie
described in his lecture notes, the book was mostly invented. Indeed, about 99 of the
kings that seen in the story, 70 were invented by Geoffrey of Monmouth.
Additionally, the introduction of romance to the story will change the perspective of
women and question the reader, where they have been in the entire book. As a
matter of fact, I agree with my classmate Dung Dinh with his point of view, of whom
the book was written to. Considering that Britain was conquest in 1066 by the
Normans, the book

Polarimetrc Imaging Technique For Analysis
Polarimetrc Imaging Technique for analysis of Breast Tissue
Abstract:
Polarimetric imaging is an emerging technique that uses polarized generated light to
probe the acceptance of the tissue with the predefined different independent variable
states. The potential of Mueller decomposition images to discriminate the Breast
tissue to generate scattering intensities images with different optical setup states of
seven and four independent variables and with this technique we can characterize the
soft matter breast tissue we has selected. We report the potential of Mueller
decomposition images to discriminate the Breast tissue to generate expected
scattering intensities images with different optical states of different seven and
different four independent variables. Polarimetric imaging is an new emerging
technique that uses polarized light to probe the acceptance of the tissue with the
different predefined independent variable states. A polar decomposition technique
reveals the polarization parameters of the soft matter breast tissue effectively. It is
observed there is a change in the Mueller matrix that which is used to obtain from the
Breast tissue with the states of expected seven and four independent analyzed
variables.
Keywords: Muller decomposition; Scattering polarization; Imaging through tissue.
Introduction: Biological Tissue being an optical anisotropic material has gained its
importance in exhibiting unique optical polarization identity (signature), a

Drama Activity Lesson Plan For Children With Autism
Essay
Drama Activity Lesson Plan Name: Saqlain Abbas Game Title: 3 Changes Page #:
62 Target Audience: Children aged 10 12 Purpose: To improve students powers of
observing and identifying KSA/CAP Objectives: 1)The player is able to
demonstrate a clear understanding of the game and is able to follow the
directions and has the ability to provide insight during post game discussion.
2)Through physical change, the player can accept the changes within themselves
and the other person (shown by vivid facial expression, tone, body language) 3)The
player is able to use the 5 human senses (taste, smell, touch, sound, sight) correctly
to identify changes in the other player given a short time frame (15 seconds) How
appropriate? This game is appropriate for children with Autism, ADHD, and ADD
(Attention Deficit Disorder) as it allows them to focus on the other player and
focus on the changes made. This game is also appropriate for children who have a
visual, auditory, or physical disability as the game incorporates the use of all 5
senses allowing them to take part and identify the changes. Description: (steps
necessary to play game): 1)Students are required to form groups of two 2)Each will
be numbered Player 1 and Player 2 . 3)Observe each other in time frame given (Note
clothing, sounds made, hair etc.) 4)Turn around facing opposite direction of the
other player and perform changes within 30 seconds 5)Face player again and observe

Maribel Fierro s Report
Maribel Fierro s book Abd al Rahman III: The First Cordoban Caliph was first
published in 2005, then again in paperback in 2007. The paperback version is 140
pages, not including the bibliography and index, and the cost of the paperback
book was 19.95, in the US. It was originally published by Oneworld Publications in
Oxford England, as an Islamic History book. The back cover, which I believe
coincides with the author s goal, of the book claims this is meant to be a
biographical work and a perfect introduction with an emphasis on readability .
However, the fact that Fierro did away with citations to make the book more
palatable to the general audience takes away from the credibility of the work. And
while I do agree that the book is

Analysis Of We Wear The Mask
The title of Dunbar s We Wear the Mask (1896) emphasizes the essential idea of the
poem, which is deception and illusion. The title is repeated in all three stanzas. This
tells the reader to keep the title in mind while reading the poem. The persona of
Dunbar is conveyed to the reader in first person, which has a strong contributed to the
message of the poem along with the rhythm and word choice. It shows the repulsive
worldDunbar lives in and the masking of his own true emotions throughout the poem.
Dunbar s emotional appeal enhances every mood in the poem from the need to hide
the true self, to the deep sorrow behind the mask, and to connecting the mask to how
humans must lie.
In the first stanza, Dunbar uses irony to express what the mask symbolizes. The
mask can represent several things from someone hiding behind a false expression
to the things people say and do that aren t honest. The main point of the poem
which describes the mask as a grin, but can lie . It hides our cheeks and shades our
eyes (Line 2) gives the reader a mental picture with the use of imagery. As well, the
extra spacing at the beginning of line two emphasizes the word hiding . This mask
hides its own existence, of agonizing misery and hardship. Many people put it on to
fit into society. When Dunbar says, With torn and bleeding hearts we smile , (Line
4) it explains the worldly power of the mask. The debt we pay to human guile, (Line
3) means the unhappiness they feel is related to them deceiving others. Both lines are
hyperboles that emphasize the struggle behind the mask. The figurative language not
only shows the theme of discernment, but shows its impact. In addition, applying the
words, we and our gives the poem an all inclusive feel which creates an auxiliary
meaning.
In the second stanza, Dunbar asks a rhetorical question to prove a point. One should
not let others make them suffer by hiding all feelings and emotions from society.
When he says, Why should the world be overwise, / In counting all our tears and
sighs? (Line 6 7), it contradicts the idea that this poem is universal with the phrase the
world . Throughout the poem, the time frame of the publication does not shift the
poem at all. But one would

Dodger Game-Personal Narrative
There was this one time my parents and my family went to LA, and I was here.
They went to go watch the Dodger game. They left and I was here with my
grandma. They stayed for a week in LA. It was actually pretty good without them.
They were there on a nice vacation. The last thing they did is go watch the dodger
game. After they watched the game, they went straight on the car and hit the road.
I know for a fact that none of my siblings like wearing their seatbelts, so they don t
ever put them on. What my father told me was he was stuck in traffic for almost 2
hours. After he got out of traffic, he then started accelerating the gas because he was
relieved that he got out of traffic. Then a car comes out of an exit and he cuts off my
dad. My dad

12 O Clock Boys Poem
12 O clock Boys was released in 2014 by Lofty Nathan and We Real Cool was
written in 1960 by Gwendolyn Brooks. After reviewing each of the works
carefully, I noticed that they contained interesting similarities as well as major
differences. 12 O clock Boys plays like two separate films that are joined. One of
them focuses on a group of young African American men (most appear to be in
their late teens, 20s and 30s) who ride their motor bikes around the inner city
Baltimore. They are depicted as rebellious on their roaring motorbikes while
ignoring the traffic laws putting the citizen s life in danger. They often defy the
police since the police can t do much to stop them since their main concern is public
safety. However, the 12 O clock boys didn t think it was that bad since it kept... Show
We Real Cool utilized a lot of repetition to emphasize the point that the characters in
the poem are cool. The poem also utilized rhyme in the middle of the couplets
effectively. For instance, cool/school in the first couplet and late/straight in the
third and fourth lines. At the end of the many lines, We is tacked on put all the
emphasis on what matters the most We. The whole poem is like a song that I can
picture a bunch of cocky arrogant high school kids composing. Most people just get
to watch flashes of such neighborhoods through the media outlets such as news. The
media often associates the people from these neighborhoods as being bad. However,
the movie did a great job showing the various perspectives and the differences among
them. The perspective of the news was significantly different than that of the
YouTube. According to YouTube, 12 O clock Boys were depicted as free and happy.
However, according to the news, they are shown as menace to the society. Both, the
author and the director, used great elements of craft and content to support their

Goal Of The Abolitionist Movement
The goal of the abolitionist movement to look into the slaves condition and to end the
racial discrimination and segregation. Number of abolitionists participated before
Civil War for abolitionist movement and they fought against slavery conditions. By
1830s, the abolitionists Theodore D. Weld, William Lloyd Garrison, Arthur and
Lewis Tappan, and Elizur Wright, Jr. put their efforts to reduce the slavery
conditions
of African American as they supported to free African American and played
prominent role in the movement. They all races their voice against races and genders
inequality for that they met Philadelphia and found the Anti Slavery Society. Their
goal was to determine slavery as sin that should be eliminated immediately,
encouraged people

Nationalism And The Imagination Sparknotes
Nationalism and the Imagination by Gayatri Chakravorty Spivak has being the
hardest text I have read during my theory class at Sydney College of the Arts in
2014. My task was to read and explain the text to my theory class and my lecturer Dr
Adam Geczy in 8 minutes as a YouTube video. This was an almost impossible task
because Spivak s Nationalism and the Imagination is a small book of 75 pages and at
Sydney College of the Arts s library we are only able to borrow the book for 2 hours.
I later found the book online as a pdf file. I have decided to leave my video
presentation on YouTube to help some lost and desperate sole searching for the
meaning of Spivak s Nationalism and the Imagination, before contemplating on
killing your self... Show more content on Helpwriting.net ...
During the course of understanding Spivak s Nationalism and the Imagination, I had
to look at other texts to begin to comprehend the purpose of Spivak s talk on
nationalism, Indian sovereignty, marginalized women, subaltern, comparative
literatures oral formulaic, postcolonialism, etc. One of the best texts I came across
was an e book by Stephen Morton entitled Gayatri Chakravorty Spivak. It was first
published in 2003 by Routledge and you can find it online as a pdf file.
Morton analysis several of Spivak s works and then he explains in an uncomplicated
manner the reasons for Spivak s comments and her writing in general. Although
Morton does not directly comment on Spivak s Nationalism and the Imagination you
will be able to understand Nationalism and the Imagination because Spivak draws
from previous works that Morton includes in his e book Gayatri Chakravorty Spivak.
Another way of understanding Spivak s Nationalism and the Imagination is by
reading the book reviews on the book. There are several book reviews on Spivak s
Nationalism and the Imagination online or you can find it through your university s
library. I was using ProQuest to find articles on Spivak s Nationalism and the
Imagination.
Last but not least, I watched several videos by Dr Jason J Campbell, user
drjasonjcampbell. He was great, easy to understand and he includes notes with all his
videos that you can download if you wish. What I liked the most about Dr

24 Hours in Amman
The City So you made it to Amman. Really! You re only spending a day here. Let
me get you up to speed then since time is of the essence. Amman is the capital and
heart of Jordan, the modern city is less than 100 years old, however,
archaeological discoveries proved that it was inhabited as early as 10000 BC!
Persians, Macedonians and Romans are only but few of the nations that ruled they
city. Amman is often dubbed The City of 7 Hills because it was originally built on
7 hills, but now it spans over an area of 19 hills. Best time to visit is definitely
between March and May, which is the brief Spring season when it s warm but not
scorching! Must See A few nations left their mark on Amman, so there a few sites
that are worth seeing. But since your stay is somewhat brief, let s limit it to two
historical landmarks. Start off by going to the Roman theater in downtown, a
spacious, majestic structure reminiscent of the times when gladiators battled in the
arena, if you listen intently, you might still hear the cheers of spectators and the
sound of swords clashing in a fierce duel. Roman theater also houses the Jordanian
Museum of Popular Traditions on the one side, and the Amman Folklore Museum on
the other. If you walk uphill for a little while, on one of the 7 hills the city originally
was built on, you ll find the Citadel. A national historical site that endured the test of
time, and evidence that Amman knew civilization centuries and centuries ago,
making it one of the

What Is Von Moltke s Military Alliance
Von Moltke s second advantage (arguably the major military innovation) was the use
of the telegraph (in 1866) to link the headquarters of each field army with the
Prussian King and the Chief of the General Staff. No such means of rapid, secure
communications had previously existed in war. Von Moltke, whose job was to give
broad strategic direction and delegate powers, could demonstrate strategic
deployment by remote control, and communicate with the King. He entrusted his
entire correspondence to the telegraph and synchronised the opening moves of the
war from his Berlin office. Only once, on June 30th, did he leave his Berlin office
and travel to Bohemia with the King and the Great Headquarters. The importance of
this telegraph system cannot... Show more content on Helpwriting.net ...
This left Germany to exercise great influence over Europe s interior. However,
Britain and Germany maintained strong relations, aided by the marriage of
Frederick III (of Prussia) to Victoria, Princess Royal in 1858.
The Austro Prussian War did not lead directly to the unification of Italy (because
Italy was almost unified in 1866), but it significantly sped up the process. Rome was
gained in 1870 following the Franco Prussian War (itself a direct consequence of the
Austro Prussian War). When French troops left Rome (under instructions from
Napoleon), Italian forces occupied the city and, after a plebiscite, Rome and the
Papal States were annexed to Italy.
The Seven Years War had long lasting effects that changed the course of European
history. Prussian dominated Germany became a nation that supported war and had
few liberal qualities. After the formal unification of Germany in 1871, the German
population became increasingly bellicose and grew used to autocratic leadership and
to war (actively encouraging war in some cases). Bismarck pursued expansion and
then the stability of that German position (as the dominant continental European
nation), through a series of complex alliances (sometimes better described as
surreptitiousness and trickery). With the effective dismissal of the ageing Bismarck
in 1890, the new King Wilhelm II sought even greater

The Death Of Puerto Rican Immigrants
In 2009 after the retirement David Souter from the Supreme Court president Obama
appointed Sonia Sotomayor as the replacement judge. The judge is the daughter of
Puerto Rican immigrants...She is a first Generation Americans. According to multiple
multiple American news outlets such as CNN, Fox News, Msnbc, etc. To these news
outlets this was the info that was groundbreaking the daughter of immigrants was
both groundbreaking to the media as well as inspiring. The true definition of what
the American dream stands for.The media thought the info was important enough
that they covered this story on the top of the newshour , and relayed this
information to people of the the US as a matter of fact. Yet this claim was false and
the truth being that her parents aren t immigrants didn t it wasn t before 1917. Yes it
is true that Judge Montemayor is born of people who came from Puerto Ricobut
according to US law established 1917 called Jones Shafroth Act people born in
Puerto Rico are US citizen as well as a person from any other state. So this doesn t
make her parents immigrants as multiple news outlets say. So all her parent s did
was move they didn t imigrate to a new country they like a lot of Americans moved
to a different place. Through this spread of false information the pride of puerto
ricans were angered.An example of this angerement came from my father the person
who is hardly takes offense anything. Was infuriated by the 60 Minutes news report
that he made me watch

The United States ( Us )
The United States (US) is a diverse nation; a product of mass immigration from a
variety of nations, race, and cultures. In fact, the US would not exist as it does today
without the influx of immigrants coming to its shores for a better life. Many people
have described the US as a melting pot, which elicits thoughts of everyone coming
together to resemble one another. Rather than having an eclectic mix of different
cultures and beliefs, the nation has sought to assimilate most people into a mold that
reflects the dominant cultureand belief system. However, diverse cultures and people
need to feel as if they are accepted and their beliefs and cultures need recognition and
inclusion (Petrovich Lowe, 2005). The focus of public educationin the US has been
one of assimilation, where people let go of their former culture and adopt an entirely
new identity (Hickey, 2015; Kaestle Foner, 1983). While education has rested in the
hands of individual states, the federal government has pushed a curriculum of
assimilation throughout the history of the US (Carroll, 2009). However, many
educational experts have determined that assimilationist practices were very alien to a
variety of students and were not often beneficial to students who were forced or
prodded to assimilate (Kaestle Foner, 1983). Therefore, education for immigrants can
be better understood through an investigation of the differing perspectives of
assimilation and acculturation. Assimilation has been the

Symptoms And Treatment Of Ptsd Veterans
It is evident that reforms are necessary within the VA system and society in regards
to PTSD and veterans. How can the American veterans be better taken care of? I
will focus on the following four specific issues that are in need of reform,
1.How can wait times be decreased for veterans seeking mental health treatment?
2.How can the stigma attached to PTSD in veterans be eliminated?
3.How can veterans receive immediate assistance in times of crisis?
4.How can we ensure that diagnosed PTSD veterans will continue treatment after
receiving full monetary compensation?
Focusing on these research questions, I propose to conduct research on decreasing
wait times for PTSD related appointments, reducing, or eliminating, the stigma
attached to PTSD in veterans, providing a way for veterans to receive immediate
PTSD crisis help, and a way to ensure that veterans diagnosed with PTSD continue
treatment.
Veterans often experience long wait times to schedule an appointment for PTSD.
Through additional research I have found that according to a study in 2003 by the
American Legion, of approximately 300,000 veterans waiting for health care, over
half of them had been waiting over eight months for an appointment (American
Legion, 2013). I further researched how many VA facilities in the United States
offer specialized treatment for PTSD. In all 50 states, and Washington, DC, there are
a total of 139 facilities (US Department of Veterans Affairs, 2015). I propose to
conduct a telephone

Salsa
I am from Colombia, where dancing is part of our culture. In Colombia each state
has a month where festivals take place. In these types of festivals there is food,
music and a lot dancing. As mentioned in class dancing is ceremonial in these types
of festivals. Our typical dance for Colombians is Cumbia. According to Discover
Colombia, Cumbia brings together three cultures which are Africa, Indigenous and
European. Discover Colombia mentions that Cumbia was born from a cultural mix of
black and indigenous backgrounds, but the music and dancebecame very popular in
the 1950 s in Colombia. Another typical dance for my culture is Salsa. According to
Colombia reports the history of the typical Cali salsa began in the 1930s. This
website also states... Show more content on Helpwriting.net ...
My family would constantly tell me, I cannot believe salsa is not in your blood .
Even though I had many reasons to give up I still loved salsa and eventually I was
able to get good at it. Now, as a young adult I am able to dance and enjoy salsa with
my family. Zumba also got me into dancing. Zumba helped me see dancing in a
different way. It has showed me the true meaning of dancing and has been very
therapeutic for me. The first time I went to a Zumba class I was sixteen years old.
During Zumba, I noticed how happy I was while dancing. It helped me forget
about most of my problems. My Zumba instructor had a positive energy that was
felt throughout the room. During that time, I wanted to become an instructor and
have that much motivation in dancing. Losing weight is another positive outcome
that Zumba brings. I was going to a Zumba class everyday for a year straight until
one day I dislocated my knee. Ever since that day, I still like to dance Zumba but I am
more cautious for a fear that I will dislocate my knee again. In the end, dancing has
always been a big part of my life, especially being from a country where dancing is
part of the

Factory Workers And The Poor Conditions Of The
Industrial...
Initially, the Industrial Revolution instigated poor conditions for the working class,
but with progress, the conditions of the working class improved. Upon the
industrialization of Manchester, the priority of factory owners was to reach mass
production, and was not the conditions and safety of workers. To begin with, factory
owners resolved that in order to make the greatest profit from mass production,
they would need to employ as many workers as possible, in order to ensure that
production needs were met. With the limited space in factories, workers were
cramped together using machines that were dangerous. The wages for workers was
just a pittance, leading to the cramped streets for workers unable to afford better
living spaces. The filth of the streets exposed workers to diseases by the atmospheric
conditions, killing many off (Document 6). As these conditions of living in cramped
spaces and having exposure to illnesses affected workers, many of them died. In fact,
the average life span at the beginning of the industrial revolutionfor workers was just
17 years (Document 6). Considering that this is less than the average lifespan of a
skilled worker, it is evident that the poor conditions of workers actually shifted the
population. For many years, these conditions continued to negatively affect the
working class and the population of cities. As journalist William Alexander Abram
observed, gradually, as Factory Acts were passed, such as the Factory Act of 1844,
which

Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been
utilized for tumor targeting. Anti epidermal growth factor receptor (EGFR)
Affibody protein (e.g., Ac Cys ZEGFR:1907, amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQ
NH2) is used to target EGFR that is overexpressed in a wide variety of human
tumors. Cheng and co workers used anti EGFR Affibody proteinas tumortargeting
ligand on 64Cu Au IO nanoparticles (PET component: 64Cu, MRI component: iron
oxide, specific for EGFR) surface.[63] In their work, A431 tumor cells were
subcutaneously implanted in the right shoulders of nude mice; and 64Cu NOTA Au
IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive
A431 (human epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after
injection, significantly higher than that obtained from the blocking experiment
(1.9% ID/g) indicating the specificity of the probe. This difference in % ID/g values
corroborated with 44% drop in MRI signal intensity that was observed for the tumor.
In this study, the use of an Affibody protein as ligand for EGFR expressing tumor in
small animals was demonstrated to be successful; however, the benefit of
multimodality was not demonstrated. The unique chemistry of this dumbbell shaped
Au IO nanoprobe could pave the way for targeted drug delivery into EGFR
expressing tumors

Letter From Birmingham Jail By Martin Luther Ruler Jr.
Through the span of Letter from Birmingham Jail (1963), the creator, Martin Luther
King Jr., makes stretched out references to different rationalists, among them Aquinas
and Socrates. His examination would appear to show that he imparts a fondness to
them. Notwithstanding, the clearness with which he makes his contentions and the
devotion to a solitary start strikes most unequivocally of Kant. Similarly, as Kant s
artful culmination, Investigate of Unadulterated Reason, endeavored to totally
overturn a formerly acknowledged method of thought, so likewise was the best s
work committed to a solitary target: the assurance of common rebellion as a type of
dissent with the end goal that the Social Equality Development could proceed in
uncompromised shape. Notwithstanding this peculiarity of reason, the
unpredictability of the circumstance implied that a more nuanced reaction to the
announcement A Call for Solidarity as distributed by eight Alabama Pastors was
essential. Along these lines, Ruler s letter in certainty filled a fourfold need: to build
up himself as a real specialist according to his group of onlookers, to demonstrate the
trials of the dark in America, to legitimize his motivation, and to contend the need of
prompt activity. In Martin Luther Ruler Jr s. letter, composed to the Pastors from
Birmingham Jail, he utilizes the logical interest of ethos to set up his believability
regarding the matter of racial separation and shamefulness. He begins off the letter
with

The Importance Of Video Games
Video games are generally seen as a waste of time and nothing good can come out
of playing them. People usually associate video games with nerds and adults who
stay in the basements of their parent s house. With all these negative associations
with video games, it is hard to see that video games can actually be helpful and
beneficial to an individual s mental and physical health. The negative associations of
video games started from the Video gamecrash of 1983. The crash led to bankruptcy
of numerous companies that were producing computers and video game consoles.
Due to the bankruptcy, the majority of the population believed that working for
computer companies and video games would be a waste of time since job security
was not high. Presently, both computer and video games companies are successful,
but the majority of the population still believes the negative aspect of video
games. While it was about job security before, the negativity aspect associated with
video games has changed. The big negative aspect associated with gaming is that it
is a waste of time and can only negatively affect an individual s mental and physical
health. Chris Regal, an author of Health Central who wrote 8 Ways Video Games
Are Bad For Your Health, argued that video games increases obesity, increases
aggressive behavior, and more likely to become less educated. While these claims
can be true, these claims also focus on individuals who have spent the majority of
their time playing video games. I can see Regal s conclusion because there are
cases that prove that his points. The increase in obesity is true because individuals
are more and more of their time playing video games instead of exercising. People
believe it increases aggressive behavior because most action games are usually
aggressive, but in reality, individuals with high aggressive behavior are usually the
ones who play aggressive action games. Individuals are also more likely to be less
educated because children who go to school would not focus on studying or doing
their homework because they want to play video games more. Since the majority of
the population believe these claims, a new derogatory was created to describe gamers
which is NEET. NEET is short for Not in

Research Paper On Collaborative Learning
Collaborative
According to Barbara et al. (1992) Collaborative learning is an umbrella term for a
variety of educational approaches involving joint intellectual effort by students, or
students and teachers together. Usually, students are working in groups of two or
more, mutually searching for understanding, solutions, or meanings, or creating a
product. Collaborative learning activities vary widely, but most center on students
exploration or application of the course material, not simply the teacher s presentation
or explication of it.
Henneman et al. (2013) Collaboration is acknowledged as an important component of
team processes. He identified that collaboration requires competence, confidence and
commitment on the part of all parties. Respect and trust, are both for one self and
others, is key to collaboration. As such, patience, nurturance and time are required to
build a relationship so that collaboration can ... Show more content on Helpwriting.net
...
Totten et.al (1989) proponents of collaborative learning, the fact that students are
actively exchanging, debating and negotiating ideas within their groups increases
students interest in learning. Importantly, by engaging in discussion and taking
responsibility for their learning, students are encouraged to become critical thinkers
For collaborative learning to be effective, there should be both group goals and
individual accountability . This means that the collaborative learning task must have
a common goal that the group must be attain. Collaborative ensure that every group
member has learnt something. Ideally, a collaborative learning task would allow for
each member to be responsible for in their

The Condition Of Iraq s Demographic State Is Not Good
Domenic Bettinelli Human Geo Scanlan 11/20/15 Dear Mr. President of Iraq Fuad
Masum, The condition of Iraq s demographic state is not good. The literacy rate,
especially for women is very low and could be improved upon. The population
growth shows the characteristics of a poor country because of the low amount of
elderly and the low median age. There are also problems like the low life expectancy.
Compared to the United StatesIraqs life expectancy is low. These problems can be
fixed to improve your country s status and raise the standard of living and earn
respect from other countries that have listened to my advice. To fix the problems like
populationthe female literacy rate and the low life expectancy and the low median
age, you... Show more content on Helpwriting.net ...
The benefits of having a longer lifespan is that the natural increase will get smaller
because the death ratio will rise. If the natural increase rate rises the population
doubling time will become a longer time, therefore the population will eventually
get smaller. Another important aspect of keeping your citizens alive longer is
sanitation. The sanitation of your people is not good compared to the level of the
United States. The percentage of people in the country of Iraq that does not have
access to clean water is 14.6%(CIA) of the entire population. The percentage that do
not have the proper sanitation in Iraq is 14.4%(CIA) which is very high. The
United States people according to the CIA have 100% of their people that can
access proper sanitation and 98.2%(CIA) that can access clean fresh water. This
means that almost в…™ of the population does not have access to water or
sanitation and this is not good. One way to fix this is to set up places that give out
clean water in places that clean water is not common. A series of hospitals could
also be set up to give people access to being examined for health issues especially in
areas that need it most. Education is very important for the future of a country
because the children will be in charge of the country some day and their choices are
based off what they were taught in school. The definition of literacy is the ability to
read and write. Iraq has a low literacy rate compared to the rest

Essay On Proteasome
Recent findings have focused on developing effective proteasome inhibitors as anti
proliferative agents because previous reports strongly suggest that abnormal or
impaired functions of proteasome aggravate the accumulation of aberrant proteins in
cells, which consequently stimulate apoptosis in cells (Chhangani et al., 2013;
Chhangani and Mishra, 2013; Huang and Figueiredo Pereira, 2010). Although, the
role of proteasome is well established in clearance of misfolded aggregation of
proteins linked with neurodegeneration and aging,still critical examination of
previous studies suggest that inhibition of proteasome activities can be auseful
therapeutic strategy to induce apoptosis in cancercells, due to their high metabolic
demands and... Show more content on Helpwriting.net ...
Mitochondrial Membrane Potential Detection JC 1 Kit (BDTMMitoScreen) and
FITC Annexin V Apoptosis Detection Kit I (BD PharmingenTM) were obtained
from BD Biosciences. LipofectamineВ® 2000, OptiMEM, and JC 1 (5,5 , 6,6
tetrachloro 1,1 ,3,3 tetraethylbenzimidazolocarbocyanine iodide) were purchased
from Life Technologies and Molecular Probes respectively. TUNEL assay kit, Dual
luciferase reporter gene assay kit and Proteasome GloTM assay reagents were
obtained from Promega. Anti ubiquitin, anti GFP, anti 20S proteasome, anti p53, anti
p27, anti p21, anti Bax, anti IkB О±, anti ОІ actin and anti HA antibodies were
purchased from Santa Cruz Biotechnology. Horseradish peroxidase conjugated anti
rabbit IgG and anti mouse IgG; anti rabbit, and anti mouse (IgG fluorescein
isothiocyanate and IgG rhodamine) were obtained from Vector Laboratories. Plasmid
pcDNAв„ў 3.1 was purchased from Life Technologies. pcDNA3 EGFP (Addgene
13031), pRK5 HA Ubiquitin WT (Addgene plasmid 17608), pEGFP Hsp70 (Addgene
plasmid 15215) and Luciferase pcDNA3 (Addgene plasmid 18964) plasmids were
purchased from Addgene.
2.2. Cell Culture, Transfection, Reporter Gene And Cell Viability Assays
COS 7 and A549 cell lines were maintained at 37В°C, 5% CO2 in Dulbecco s
modified Eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS)
and 1% (v/v) streptomycin/penicillin (Gibco, Invitrogen). For various transfection
and treatment experiments, cells

Braxton L. Wages . Mrs.Scott. English 8. 3 March,...
Braxton L. Wages
Mrs.Scott
English 8
3 March, 2017
Elijah McCoy
Elijah McCoy was an African American who had may inventions that changed the
world of train travel, but faced many hardships along the way. Elijah McCoy was
born in Colchester, Ontario, Canada, and was later sent to Edinburgh, Scotland by
his parents to study mechanical engineering, he then moved to Detroit, Michigan.
Due to racism he could only get a job as a fireman or oilman on a steam engine train.
McCoy s first invention the automatic lubricator was a revolutionary way of
lubricating steam engines without having to shut them down for long periods of time
which saved an enormous amount of time and effort in transportation.
And the people of Detroit have ... Show more content on Helpwriting.net ...
With the train industry growing the need for bigger trains and freight cars were a
must and James J. Hill builder of the Great Northern Railroad he made this happen
building trains 4 times the size of the old ones. They used a super heated steam
system that made Elijah McCoy s first patent of the lubricating system not compatible
with these newer trains. These trains were lubricated with a mix of oil and
powdered graphite so that the trains parts could be lubricated properly. The
problem with Elijah s first patent is that with the new mix of graphite the
lubricator would clog up. This all changed in April of 1915 when he received a
patent for a new and improved lubricator in which he called Locomotive Lubricator
with this patent he stated that it permitted the use of graphite without clogging.
Hayden Cites a railroad superintendent states We have found the McCoy Graphite
Lubricator to be of considerable assistance in lubrication of locomotives equipped
with superheaters. There is a decided advantage in better lubrication and reduction
of wear in valves and piston rings, and as a well lubricated engine is more
economical in the use of fuel, there is unquestionably a saving in fuel. When Elijah
McCoy was younger his parents ran away from the United States using the
underground railroad due to racism and them being slaves. Elijah McCoy and his
eleven

Piggy Failure
While the young men in William Golding s Lord of the Flies return to chaos, a
thick, insightful, outcasted character whom everybody refers to as Piggy, emerges
as the most levelheaded, reason arranged kid on the isolated island. For such clear
sightedness, he endures first by the insensitive Ralph, and after, by the heartless
Jack Merridew and his brainless hunters. He has great goals, yet tragically his
appearance and identity causes him to be disregarded in the young men s new
formed society. His failure to work and hunt is because of his physical shortcoming
which makes him pointless and helpless. While Piggy has the knowledge of a grown
up, he did not have the capacity to identify with the young men on the isolated island.
Piggy stands... Show more content on Helpwriting.net ...
The most telling scenes that propose the cost for such reason in compelling
circumstances focus upon maybe the most grounded image in the novel: Piggy s
specs. Even though Piggy is not the one to understand that his glasses will serve as
the way to nurturing and saving fire, he rapidly and rightly judges the
circumstance once the signal flame has been lit: there wasn t any smoke; only
flame (Golding, 42). Piggy, along these lines, turns into an unmistakable kind of
society, the supplier and objective observer, much to the delight of the others, who
are respecting the viciousness of Jack s tribalism, which is not balanced and gives
only to itself. Much like the conch, articulation of authority and a totem for the
privilege to speak, Piggy knows wisely how to utilize the instrument however is
not the discoverer: he blew from down here, says Piggy, instructing Ralph as to his
observation of one he witnessed blowing a conch (Golding, 17). So as well, his
own ownership, his specs, offers a positive means yet rapidly turns into the
ownership of others. On the off chance that the conch is an image of force, his
glasses as of then symbolize

Persuasive Essay On Medical Marijuana
Recent studies have proven that medical marijuana can be extremely beneficial to
the overall health and well being of individuals, especially those who suffer from
medical ailments. Consequently, the usage of marijuana has been a widespread
debate for decades throughout Nevada. For instance, Nevada was the sixth state in
the country to outlaw the use of cannabis in 1923, this was partly due to a nationwide
prohibition on drugs during 1911 1933 (Davenport Hines, 2004). Essentially, this
amended the NevadaConstitution outlawing the use of cannabis. However, as time
passed, the residents of Nevada decided it would be wise to allow the usage of
marijuana for medical purposes. Specifically, the usage of medical marijuana was up
for debate in 1998 and again in 2000, under Question 9, where the residents of
Nevada had voted on an initiativeto amend the previous legislature to the Nevada
Constitution, which allows the residents to use marijuana ...for the treatment or
alleviation of certain illnesses (Raybuck, 2010). It s worth noting that in order to
amend the state constitution in Nevada requires, ... via the ballot initiative process to
pass by a majority of voters in two consecutive general elections (Raybuck, 2010). In
other words, for the residents to amend the state constitution they needed to approve
the proposed ruling by a majority for two consecutive ballots. Furthermore, once the
initiative passed allowing the use of marijuana for medical purposes, Nevadans had a

Automated External Defibrillator ( Aed )
AED Research 1. How does an AED work? Automated external defibrillator (AED)
is a small computerized device used to analyze heart rhythms and provide an
electric shock, if needed, to restore the normal electrical activity of patients heart.
When a patient is suspected of having a sudden cardiac arrest CPR is performed
until an AED device is available. If the device is available, when turning the
machine on the voice of the device will guide the first responder through the process.
There are adhesive pads with electrodes sensors that are required to stick onto the
chest of the unconscious patient. Once the pads are stick onto the chest, the
electrodes then send information about the person s heart rhythm to the AED. The
devices will then analyzes the heart rhythm and determine if an electric shock is
needed. Once the device detect that a shock is needed the device will warn first
responders to stand clear, then the machine will automatically delivered the shock. If
the person is still not breathing, continue on with CPR while the machine recharge.
Once the machine is ready it will again analyze the heart rhythms then provide an
electric shock. (U.S. Department of Health and Human Services [HHS], National
Institutes of Health [NIH], National Heart, Lung, and Blood Institute [NHLBI],
2011). 2. What are the shockable rhythms an AED recognizes and describe each?
There are two shockable rhythms an AED is able to recognize. The first shockable
rhythms is ventricular

African Elephant Impact On Animals
Out of the 8.7 million types of species on Earth, 5,689 of them are endangered.
That only seems a tiny number compared to all of the species on earth, but what
would happen if all of those 5,689 species were to die? The African Elephant is the
largest land animal on Earth, weighing up to 6 tons and growing as tall as 10 feet.
They are mostly known for their giant ivory tusks that they use for digging, fighting,
and foraging. We happen to see their ivory tusks as a way to make money. The
African elephants habitat/lifestyle and features are not the reason they are
endangered, . it is tThe poaching and the resources poachers and collectorswe are
taking from them. are causing the world s largest land animal to die off.
As stated in Animal Fact Guide, the African Elephant herds range from sub
Saharan Africa, to the rainforest in Central and West Africa, to the Sahel desert in
Mali. The herds are lead by a matriarch, the oldest female in the group
(Livescience). AlthoughAs female elephants live in family herds with their young,
male elephants tend to roam in herds and leave their family behind. The elderly
elephants also tend to stay in the herd instead of roaming. When the male wanders
off into new herds, the female elephant ends up with a 22 month gestation stage.
They give birth every two to four years and are born weighing 200 pounds and as tall
as three feet. The elephant can eat up to 300 pounds a day and drink up to 50
gallons a day. They eat roots, grasses, fruit and

Chapter 14 End Of Case Exercises
HADM 5132: MANAGERIAL EPIDEMIOLOGY INSTRUCTOR: Dr. Mitchell
Jordon Chapter 14 end of case exercises [Page: 405 407] Uday Sekhar Reddy
Mareddy Thaddeus Wesley Question 1: a.Benefit of the treatment is Difference in the
outcome for diseased patients who receive treatment compared to those who don t
take treatment. Benefit of treatment = 6% b.Harm of treatment is the difference in
the outcome for patients without the disease who receive treatment compared to
those who do not. Harm of treatment = 2% c.Treatment Threshold = Harm/ (harm +
Benefit)... Show more content on Helpwriting.net ...
Treatment Threshold = 0.05/ (0.05+ 0.20) = 0.2 or 20 % If prevalence of Acute
Myocardial Infarction is greater than 20% indicates that bypass surgery procedure
will outweigh the risks associated with AMI, so immediate bypass surgery should be
provided. d.Positive likelihood ratio associated with the CT angiogram: LR+ =
sensitivity / (1 specificity) = 0.95/ (1 0.90) = 9.5 e.Negative likelihood ratio
associated with the CT angiogram: LR = (1 sensitivity) / specificity = (1 0.95) / 0.9 =
0.0556 f.Pre test odds = pretest probability / (1 pretest probability) = 0.06/ (1 0.06) =
1.5 g.Post test odds of MI with a positive CT angiogram: = pretest odds x LR+ = 1.5
x 9.5 = 14.25 h.Post test odds of MI with a negative CT angiogram: = Pretest x LR =
1.5 x 0.0556 = 0.0834 i.Post test probability of MI with a positive CT angiogram: =
post test odds / (1+ post test odds) = 14.25/ (1+ 14.25) = 0.934 j.Post test probability
of MI with a negative CT angiogram: = 0.0834/ (1+ 0.0834) = 0.077 k.No treat test
low threshold= Harm x (1 specificity)/ harm x (1 specificity) + benefit x sensitivity =
0.05 x (1 0.9)/ 0.05 x (1 0.9) + 0.2x

Pain And Treatment Of Shoulder Pain
Introduction
The shoulder is one of the largest and most complex joints in the human body(1)The
shoulder is not a single joint; it is an intricate arrangement of bones, muscles and
ligaments, which provides strength and range of motion to the arm(1, 2). Shoulder
pain accounts for between 16 21% of all musculoskeletal complaints(3, 4). There are
many causes of shoulder pain such as: repetitive movements and overuse, trauma, and
degenerative changes.
Shoulder pain and associated glenohumeral joint movement dysfunctions are common
and debilitating conditions(5). The most frequently occurring problems include:
shoulder impingement, rotator cuff associated disorders, glenohumeral joint
instability and adhesive capsulitis(5). Proper scapular motion and stability are
considered to be crucial for the shoulder to function normally(6, 7). The scapular
must serve as first, a stable base for glenohumeral function, second, a site of muscle
attachment and third, a link for proximal to distal transfer of energy(2, 6, 8).
Therefore abnormal functioning of the scapular will decrease normal shoulder
function and predispose the shoulder to injury ((2, 5, 9). This essay aims to review
the importance of scapular control during shoulder movements, and will discuss the
evidence for scapular control to rehabilitate Glenohumeral joint injuries.
Anatomy of the shoulder
The shoulder complex is made up of four different joints. These are the articulations
of the clavicle, the humerus, the

My Trip At Las Vegas Essay
My trip to Vegas was a great one. I d like to especially thank The Kess Group
(TKG) for everything that they did to ensure that I had a memorable experience. I
can confidently say that I was in the best clubs in Vegas. Being in the Las Vegas
clubs made this trip a complete joy. Of course, it was expensive to plan my Las
Vegas night clubs trip. However, that s typical of planning anything in Sin City,
particularly if you want to enjoy the prestigue of being at the best nightclubs Las
Vegas boasts of on the strip. Vegas is a world of its own, characterized by an
unmistakable display of its extravagant lifestyle. This lifestyle makes me wonder if
the word expensive really exists in their dictionary. These were the thoughts that
went through my mind as I planned my first visit to Vegas. We were to have a get
together party in Vegas. Most of us needed travel in from different parts of the
globe and had spent hours in transit. But that didn t really matter because our minds
were preoccupied with the anticipation of the Vegas party atmosphere and the catch
ups we looked forward to. Life is beautiful with friends and loved ones. Many of us
were friends from high school and some from before then. Just a few of us have
been friends from college. So this was a very special occasion which I personally
looked forward to. Like I did mention earlier, about Vegas extravagant lifestyle... The
trip bothered my mind a little. Not because I couldn t handle the possible unplanned
expenses that

The Core Of Any Successful Health Service System
Introduction
The core of any successful health service system s mission is improving health,
guarantee quality, patient care and satisfaction. Health service executives are
responsible for clearly defining, tracking, communicating, and measuring the key
performance indicators (KPIs) that indicate how well their organization is achieving
its vision and mission. To do this well, leadership require a 360 degree perspective of
their organization s business performance to view and quickly understand where their
organization compares universally.
The Business Intelligence dashboard is a streamlined, easily accessible, and more
accurate and significant reporting process. It presents the ability to gauge
performance, understand the impact of ... Show more content on Helpwriting.net ...
In the beginning of the 20th century, statisticians dismissed data visualization until
the latter half of the 20th century when computers were invented. The 1960 s and
1970 s researchers, John W. Tukey and Jacques Bertin developed the science of
information visualization and in the 1980 s Edward Tufte, whose work of The
Visual Display of Quantitative Information helped introduce the Sparkline, the
general shape of a trend in a small amount of space. The last two decades have had
an explosion of discovery and in analytics, research, and tools. Alberto Cairo,
Stephen Few, and Colin W., are a few of the distinguished writers and educators in
the refining of science and the art of data visualization. (Hazell J., 2014)
What are Dashboards today?
Dashboards today, are interactive visualizations of several rows of secured data
sometimes millions of rows that are related and are transformed into an at a glance
picture. Data are facts connected to any object inconsideration, for example, a name,
age, sex, height, weight, picture, file, or an image to name a few. The data are stored
in a database, a systematic collection of organized data.
The navigational path of the dashboard, designed to be intuitive and interactive this
guides the user through the functionality in a graceful and predictive manner. The
visualizations are graphs, maps, indicators, controls, tab sets, charts, templates, art,
spreadsheets, gauges, etc, and have the ability

Macro Sociological Perspectives
The conflict perspective views society less as a cohesive system and more as an
arena of conflict and power struggles. Compare and contrast the main tenets of the
functionalist and conflict perspectives. The conflict perspective views society less
as a cohesive system and more as an arena of conflict and power struggles . This
perspective was founded by sociologist Karl Marx (1818 1883) and serves to
introduce the concept that inequality and specifically inequality under capitalism
exists between two main classes in society namely the proletariat and the bourgeoisie.
The functionalist perspective another major sociological theory was founded by
Auguste Comte (1798 1857) and also includes contributions by Herbert Spencer...
The expected patterns of behaviour are imposed on the individual through the
socialisation process. According to Durkheim, Social facts are ways of acting,
thinking and feeling, existing outside the individual . Parsons believed that a social
system must fulfil four prerequisites in order for it to function. These are
Adaptation, Goal Attainment, Integration and Latency. Similarly, the conflict
perspective seeks to explain change in society. This concept, however, highlights a
Capitalist view, where two classes exist in society namely the Proletariat and the
Bourgeoisie. The founder of the conflict perspective, Karl Marx, believed that
social change can only be attained through conflict that will arise once the working
class or proletariat realised the state of false consciousness that they were subject to
by the bourgeoisie and developed a state of class consciousness which recognises
that all individuals within a society are equal. Thus, the inequalities that exist with
respect to the distribution of wealth, power and the resources will now be
eliminated since classes will no longer exist. Marx saw conflict relations as being
characterised by conflict in intergroup relations, borne out of the relationship
between the forces of production and the relations of production. Conflict between
these two processes in Marx s view, provided the catalyst for social

Rome Bad Things
15 Things to do in Rome that are all free
A trip to Rome may sound like a dream to many but it actually doesn t have to break
the bank! With a little local knowledge, there is plenty to do in this city that you
don t need to pay for. Here are 15 things to do in Rome that are all free...
1)Trevi Fountain
The Trevi Fountain is one of the most famous spots in Rome. It s good luck to toss a
coin into the fountain if you want to return one day, but apart from that you won t
have to part with any money here!
2)Gianicolo
This hill in Rome is the perfect place to come if you want unspoilt and free views of
the city. Try to come at night for a particularly breathtaking experience.
3)Santa Maria del Popolo
Come to this free church if you want to see the Caravaggio s on display. Many of
them dot the city in ... Show more content on Helpwriting.net ...
It is not one of the best known in Rome but is worth a visit for this legend alone.
8)St Peter s Basilica
Arguably the most famous Catholic Church in the world, St Peter s Basilica is one of
the main reasons that many people visit Rome. Considering it is such a tourist
attraction it is completely free to visit.
9)The Spanish Steps
Visitor s to Rome flock to the Spanish Steps to take pictures of this iconic stairway,
and if you are looking for something that won t cost you a penny then this is a great
place to get some souvenir photographs of Rome.
10)Villa Borghese
The gardens of Villa Borghese are some of the most stunning in the city and can
come as a welcome stretch of greenery. Here you will find fountains, flower gardens,
and the art collection of Villa Borghese in the centre.
11)Stadio dei Marmi
This athletics stadium is free to visit and the big draw here are the statues which
show various ancient sports as well as rippling muscles and trim figures of the

sportsmen who would have played them.
12)San

Juno Research Paper
Nasa s space probe, Juno, has many interesting information about it. Juno s
manufacturers were very skilled and thoughtful when they created it. Juno s scientific
instruments were a great feat. Juno is still working on gathering information to help
us better understand our world.
Juno was built by one of four main business divisions of Lockheed Martin, the
LMSSC (Lockheed Martin Space Systems Company). Lockheed Martin was founded
on March 15th, 1995. LMSSC has their headquarters located in Denver, Colorado.
Other areas of operation include Sunnyvale, California, Santa Cruz, California and
Huntsville, Alabama. LMSSC has built other famous products such as, commercial
/military satellites, other space probes, missile defense systems and space ... Show
Juno is measuring the composition, gravity field, magnetic field, amount of water in
the deep atmosphere, mass distribution and polar magnetosphere of Jupiter. Along
with measuring parts of Jupiter, Juno is currently trying to find clues on how the
planet was formed and whether or not it was a rocky core and studying Jupiter s
deep winds. The main goal is to find the story of Jupiter s formation and evolution.
Juno studies the bright auroras at Jupiter s poles. Juno launched on August 5th,
2011 at Cape Canaveral Air Force Station and is set to decay in February 2018. On
August/September 2012, Juno use deep space maneuvers to get to try to get
Jupiter. In October 2013, Earth assist Juno with a gravity assist. Using Earth s
gravity, it altered Juno s path/speed so it could get to Jupiter. July 4th, 2016 was a
joyous day for many people; for it was the day that Juno successfully arrived at
Jupiter s orbit. The current plan for Juno is for it to orbit Jupiter for 20 months,
which is roughly 37 orbits and deorbit Jupiter on February

American Indian Immigration
Indian Immigration
Sudipta Das is a professor at the Southern University at New Orleans and in their
academic journal Loss and Gain? A Saga of Asian Indian Immigration Das goes in
depth on the South Asian immigration trends. While immigration has always
occurred in the United States, different groups of people immigrated in mass amounts
at different times. The majority of the first phase of Southern Asian immigration
occurred during 1904 to 1917, and thousands of Southern Asians entered the United
States from Canada. This was due to there being anti Indian sentiments in Canada at
the time, and soon after most immigrants arrived through San Francisco. This phase
ended when the United States passed an immigration act in 1917, that only allowed ...
One explanation for how Indian Chic culture came to be is through the different
popular culture movements that the United State underwent from the 1920s to
modern day and its correlation to the immigrant groups arriving throughout the
decades. The book Inventing American: Ethnic Identity and American Popular
Culture outlines the six most important popular cultural eras; within those six eras,
two of them are directly related to Asian and South Asian immigration; ...the Vietnam
era hippie love affair with Ravi Shankar in the late 1970s...and the 1990s Asian
American webzine subculture (Oren 91). Ravi Shankar is still today a very popular
classical Indian musician. In the 1970s, what occurred was that Indian culture was
popularized for being exotic with the fame of Ravi Shankar, and of other Indian
professionals. Ravi Shankar specifically performed at the Monterey Jazz Festival and
this made him gain national fame (Oren 92). The appearance of an Indian celebrity
popularized Indian music, fashion, and even spiritual practices. Soon Indian customs
started becoming appropriated around the United

Individualism And Ralph Waldo Emerson
Ralph Waldo Emerson was an American poet during the 1800 s who identified
himself as a Transcendentalist. Self Reliance is one of Emerson s most famous
works that is widely known and was published after his death in 1882. Emerson s
works influenced other writers like Henry David Thoreau who was a close friend
of Emerson. Resistance to Civil Government is one of Thoreau s most famous
works. Although Emerson influenced Thoreau with his works and they were
close friends, both of them had two different ideas on the individuality of humans
and their way of life. Emerson believed that individuals conform to society and
others when they should follow their own way of life, instincts, and ideas. Thoreau
thought less towards society and more towards the government. He believed that
individual conscience is more important than an unjust government and the laws
they created. Self Reliance is an essay on the lack of individualism in a person in
society and the reasons behind why individuals do not think for themselves. He
states that because of our consciousness of how others will react towards us is one
of the reasons we do not think for ourselves and let our individuality show. We but
half express ourselves, and are ashamed of that divine idea which each of us
represents, (Emerson 1164). As humans, we only show a few of our emotions or
hardly explain how we feel to others because we feel ashamed of our emotions and
our thoughts. He does not say it, but mostly anyone who

Marketing Mix Tools when Going from America into China
Essay
Consumers consider price, brand, time of delivery, and the quality of the product in
making choices on which products to use in the market place, hence the reason it is
important to focus on fulfilling the elements in marketing products to consumers. In
moving a product from the American market to the Chinese market, similar
considerations are necessary since similarities and differences exists in the response
of consumers on the use of different marketingmix tools in promoting products in the
two countries. Due to the complexity in marketing luxury products in China, it is
advisable for marketers to analyze the market in China in order to identify the critical
elements for consideration in marketing prior to introducing the commodity... Show
Furthermore, it is easier to convince a consumer in the high end segment of the
market to purchase a highly priced commodity from a recognizable brand like Sabon
as opposed to purchasing highly priced products for unknown brands. The focus of
sabon should be pricing their products effectively in order to motivate the consumers
in the high end market to purchase items of high quality in large quantities.
Market assessment
In order to capitalize on the existing opportunity, the marketer should first conduct a
survey to establish the relationship between pricing and increase in sales in the
Chinese market before selecting the appropriate pricing technique for use in
marketing the soap (Xu Susan 308). The researcher might use existing information on
the performance of Western manufacturers in the domestic market from magazines
and online sites in addition to monitoring the trends in the market in china. After the
assessment, a comparison of the findings should be made after which the relationship
between increase in sales and the use of pricing as a marketing tool should guide the
marketers in setting up price for Sabon products in China.
Marketing techniques
The researchers will use advanced technological tools in measuring the satisfaction of
consumers form the use of different commodities in the marketplace. In particular, the
company will design a website

A Research Study On Global Variables
Above you see an extract from the log in page, showing the heavy dependence on
$_SESSION variables. These are required so much because they allow other pages to
access the data. If I just used local variables I d have no ability to transfer data
between pages, and this is necessary to keep track of things like who is logged in
or if even anyone is logged in. All SQL queries come back as associative arrays too,
with each column entry being an element in the array, so they are very prominent.
There are many algorithms implemented in this project throughout to do various
things, from checking passwords securely to generating tables for the admin. I will
analyse some of these at a later point.
Programming Techniques
Global Variables
Usually, ... Show more content on Helpwriting.net ...
The more difficult questions require more time since they are harder and will take
longer. The time setting adjusts the time defined by the difficulty slightly.
You can see what the one and two letter codes mean by looking at the getqcode
function on page 4.
Parameter passing
A good example of parameter passing by reference is with the SQL queries,
particularly the connection and result. Consider the following:
$con2 is a connection variable that provides access to the MySQL database. This is
therefore clearly passed by reference as well as $r, the result since they can have
their contents modified by a function and then be used afterwards. On the other hand,
in the example above (get_time), the variables $time and $diff are passed by value.
They are disconnected from the original when they get passed, changes to them will
not affect the original.
Programming practice
One of the most important things in programming is readability and code style in
general. It is good if your code runs efficiently and correctly but if anything ever
goes wrong with it, it will be a nightmare to deal with if the code isn t formatted or
named correctly. I have therefore tried to give all variables meaningful names so
that if I ever look back over the code or make changes, I will know what each bit
does. Commenting is also quite important. An algorithm you understood when
programming it may end up just looking

The Theory Of The Mind
The mind is both rational and consciously aware in situations that demand a reactive
response. It acts as a control system that communicates between the external world
and the spiritual being, allowing reasoning to take play. For years, philosophers have
hypothesized ways to identify the minds function and capabilities. Causing both
controversy and accord, these philosophers center their theories on rationalismand
take a methodical approach towards understanding the complexity of the mind.
RenГ© Descartes believed that the mind is free Cogito ergo sum, I think, therefore I
am. The mind involves thinking, which consists of an imagination, logic, and doubt.
This relates to the concept that one actually exists and they have absolute certainty of
the truth. The thinking thing, Ras Cognitus, is separate from the physical things, Res
Extensa. Everyone is innately born with ideas; these ideas are a priori from before,
which help people conceptualize what is real and what is not. Nonetheless, Descartes
explained that there is no actual certainty of the senses because it might fool the eye
and can cause an underlying deceit of the hidden truth of what is actually real.
Descartes was an intriguing philosopher because he believed that the human body
was dualistic. He believed that the mind, the nonphysical substance, cannot affect the
physical world. In other words, the mind is separate from the body; therefore one
cannot affect the other. Notably, he emphasized that the body

The Sufjan Stevens Concert Of Brooklyn, New York
Concerning the Sufjan Stevens Concert in Brooklyn, New York On the train there
we listen simultaneously, one bud in either ear, middle school style, to a gingerly
prepared selection of what I call gateway indie . Songs like Rather Be or Somebody
I Used to Know , anything by Ed Sheeran or Ingrid Michaelson. Songs that could be
considered traitors to the genre arguably built on eternal invisibility, or, more
positively, songs that have broken free from the mostly underappreciated genre s net
of obscure lyrics, changing time signatures, unpopular instruments like the oboe or
guitalin, and small spurts of unexpected electronica that sound awkward to the
previously unexposed mind. Then again, I think as the train gives a tiny lurch and...
I ve been listening to Sufjan Stevens since 2012, before I even learned the two octave
C scale on the piano. The first song I heard was Chicago, part of an album that won
a great many awards in 2005. I came across it on the computer that no longer works
and sits in a pile of like junk behind the house, and I didn t know it then, but
Chicago was becoming the catalyst for an uncontrollable, unapologetic obsession.
That winter, I picked up songs one by one from Illinois, adding them to a mental
collection second came The Tallest Man, the Broadest Shoulders (I remember
wanting to dance to it, but not being able to because of its relentlessly inconsistent
time signature), third Concerning the UFO Sightings Near Highland, Illinois. There
was is magic in the runs of the flute, in the broad trumpet hoots that make their
home in the background, and in Concerning , the only song whose difficulty has
prevented me from learning it, the moving chords on the piano that go peculiarly
unresolved at the end and with each listen inspires in me some profound question
whose sole purpose seems to be not having an answer. I played it on repeat as the
night grew slowly dark and the candles flickered during Hurricane Sandy, sitting on
the deck under the cloud obscured stars and in the wind chill while a distant thunder
proclaimed itself from far away.
I listened to

Essay on Transportation and How it Affects Logistics
Transportation is one of the largest industries in the world. It is the most costly and
time consuming of the supply chain. Transportation refers to the movement of
products and raw materials from one destination to another. This process begins from
the supply chain to the shipping of the finished product to the consumer. For we
know that products are rarely produced in the same location. We as people depend on
transportation because it moves goods and people from one place to another.
Transportation is a key element in the logistic chain. It joins together those
components that are considered to be separated. In order for transportation and
logistics to work together successfully, there must be good management between
them. It plays a ... Show more content on Helpwriting.net ...
To achieve the lowest total cost means that financial and human assets committed to
logistics must be held to an absolute minimum (Pieplow, Daniel, Calhoun [Pg. 29]).
SCM can be divided into three main groups: purchase, manufacture, and transport
(Thomas et al., 1996). The focus is on transportation. There are different modes of
transportation. These modes of transportation fall under three basic types and they
are: land (road, rail and pipelines), water (shipping) and air. Transportation plays a
connective role among the several steps that result in the conversion of resources into
useful goods for the ultimate consumer. It is the planning of all these functions and
sub functions into a system of goods movement in order to minimize cost and
maximize service to the customers that constitutes the concept of business logistics.
The system, once it s put in place, must be effectively managed (Fair Williams,
1981). What are the advantages and disadvantages of these modes of transportation in
logistics?
Initially, there is the mode of land transportation. Roads, rails and pipelines fall
under this category. These land logistics are very important because they extend the
delivery services for air and water transport from airports and seaports. The main
transport mode of land logistics are railway, road freight and pipeline transport. The
advantage of railway transport is that it has carrying capacity and lower influences by
weather conditions

Political Parties And Its Influence On The Political Party
Since the founding of our country and the government we live by, political parties
have been present. These parties have had many influences on our government from
their formation. Some of these influences that the parties have had were good, other
were bad. Within our modern government, parties, have become a major impact and
have had much influence. These parties are present to push their agendas and
accomplish what they can through their influence on the government. The affect that
these parties have had on our government can be seen through their influence on the
three branches of government; the Executivebranch, the Legislative branch, and the
Judicial Branch. Political parties have a massive influence on the Executive branch,
or the president. The two party political system is the fore ground of our modern
presidential elections. This system determines the two major candidates that the
country ultimately chooses from for the presidency, either Republican or Democrat.
As the American Government textbook states the political parties kept a tight control
on the selection of a candidate (Krutz 454). This excerpt from the American
Government textbook shows that the influence the party system has on the Executive
branch is so great that it goes as far as to choose the candidates that the country gets
to vote for. The party chooses the candidates for the presidential electionby holding
primary elections where multiple people are put out for the states to vote, the

Essay Integrity

Recommended

Recommended

More Related Content

Similar to Essay Integrity

Similar to Essay Integrity (20)

More from Ashley Bonham

More from Ashley Bonham (20)

Recently uploaded

Recently uploaded (20)

Essay Integrity