Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Apolo Taller en BIOS

691 views

Published on

Estas son las diapositivas del entrenamiento durante el taller de Apollo en BIOS. 2015-09-21

Published in: Science
  • Be the first to comment

Apolo Taller en BIOS

  1. 1. Editando anotaciones con Apollo
 Un taller para la comunidad científica reunida en BIOS Monica Munoz-Torres, PhD | @monimunozto
 Berkeley Bioinformatics Open-Source Projects (BBOP)
 Lawrence Berkeley National Laboratory | 
 University of California Berkeley | U.S. Department of Energy 
 BIOS, Manizales, Colombia | 21 Septiembre, 2015
  2. 2. APOLLO DEVELOPMENT APOLLO DEVELOPERS 2 h" p://G e nom e Ar c hite c t. or g /     Nathan Dunn Eric Yao JBrowse, UC Berkeley Christine Elsik’s Lab, University of Missouri Suzi Lewis Principal Investigator BBOP   Moni Munoz-Torres Stephen Ficklin GenSAS, Washington State University Colin DieshDeepak Unni
  3. 3. OUTLINE
 Web  Apollo  Collabora(ve  Cura(on  and     Interac(ve  Analysis  of  Genomes   3OUTLINE •  Hoy   descubriremos   cómo   sortear   obstáculos   para   extraer  la  información  más   valiosa  en  un  proyectos  de   secuenciación  &  anotación   de  genomas.  
  4. 4. 4 BY THE END OF THIS TALK
 you will
 v BeAer  understand  genome  cura(on  in  the  context  of  annota(on:     assembled  genome  à  automated  annota=on  à  manual  annota=on   v Become  familiar  with  the  environment  and  func(onality  of  the  Apollo   genome  annota(on  edi(ng  tool.   v Learn  to  iden(fy  homologs  of  known  genes  of  interest  in  a  newly   sequenced  genome.   v Learn  about  corrobora(ng  and  modifying  automa(cally  annotated  gene   models  using  available  evidence  in  Apollo.   Introduction
  5. 5. ¿Cómo  se  traza   el  mapa  de  un  genoma?  
  6. 6. 6 El mapa del genoma Introduction Diseño & muestreo Análisis comparativos Colección consenso de genes Anotación manual Anotación automatizada Secuenciación Ensamblaje Síntesis & publicación
  7. 7. 7 El mapa del genoma Introduction Diseño & muestreo Análisis comparativos Colección consenso de genes Anotación manual Anotación automatizada Secuenciación Ensamblaje Síntesis & publicación QC QC QC QC QCQC QC
  8. 8. CURATING GENOMES
 steps involved 1  Genera=on  of  Gene  Models   calling  ORFs,  one  or  more   rounds  of  gene  predic(on,   etc.     2  Annota=on  of  gene  models   Describing  func(on,   expression  paAerns,   metabolic  network    memberships.   3  Manual  annota=on   CURATING GENOMES 8
  9. 9. ANOTACION DE GENOMAS
 requiere precisión y profundidad Anotando Genomas 9 La  colección  de  genes  de  cada  organismo  informa  una  variedad  de  análisis:   •  Número  de  genes,  %  GC,  composición  de  TEs,  áreas  repe((vas   •  Asignar  función   •  Evolución  molecular,  conservación  de  secuencias   •  Familias  de  genes   •  Caminos  metabólicos   •  ¿Qué  hace  único  a  cada  organismo?     ¿Qué  hace  “abeja”  a  una  abeja?   Marbach et al. 2011. Nature Methods | Shutterstock.com | Alexander Wild
  10. 10. Refresquemos  nuestra   memoria.  
  11. 11. REVIEW ON YOUR OWN
 for manual annotation To  remember…  Biological  concepts  to  beAer   understand  manual  annota(on   11FOOD FOR THOUGHT •  GLOSSARY   from  con1g  to  splice  site     •  CENTRAL  DOGMA   in  molecular  biology     •  WHAT  IS  A  GENE?   defining  your  goal   •  TRANSCRIPTION   mRNA  in  detail     •  TRANSLATION   and  other  defini(ons   •  GENOME  CURATION   steps  involved  
  12. 12. 12BIO-REFRESHER What is a gene? v  The  defini(on  of  a  gene  paints  a  very  complex  picture  of  molecular  ac(vity   and  it  is  a  con(nuously  evolving  concept.     •  From  the  Sequence  Ontology  (SO):   “A  gene  is  a  locatable  region  of  genomic  sequence,  corresponding  to  a  unit   of  inheritance,  which  is  associated  with  regulatory  regions,  transcribed   regions  and/or  other  func(onal  sequence  regions”.       “Evolving  Concept”  at  hAp://goo.gl/LpsajQ  
  13. 13. 13BIO-REFRESHER What is a gene? v  In  our  life(me,  the  Encyclopedia  of  DNA  Elements  (ENCODE)  project   updated  this  concept  yet  again.  Long  transcripts  &  dispersed  regula1on!       “A  gene  is  a  DNA  segment  that  contributes  phenotype/func(on.  In  the  absence  of   demonstrated  func(on,  a  gene  may  be  characterized  by  sequence,  transcrip(on  or   homology.”     https://www.encodeproject.org/
  14. 14. 14BIO-REFRESHER What is a gene?
 let’s think computationally! v  Think  of  the  genome  as  an  operating system for  a  living  being   •  Considering  that  the  nucleo(des  of  the  genome  are  put  together  into  a   code  that  is  executed  through  the  process  of  transcription  and   translation… •  …  think  of  genes  as  subroutines  that  are  repe((vely  called  in  the   process  of  transcription Gerstein et al., 2007. Genome Res.
  15. 15. 15BIO-REFRESHER What is a gene?
 considerations v  Also  consider  :   •  A  gene  is  a  genomic  sequence  (DNA  or  RNA)  directly  encoding   func(onal  product  molecules,  either  RNA  or  protein.   •  If  several  func(onal  products  share  overlapping  regions,  we  take  the   union  of  all  overlapping  genomics  sequences  coding  for  them.   •  This  union  must  be  coherent  –  i.e.,  processed  separately  for  final   protein  and  RNA  products  –  but  does  not  require  that  all  products   necessarily  share  a  common  subsequence. Gerstein et al., 2007. Genome Res.
  16. 16. 16BIO-REFRESHER “El  gen  es  la  unión  de   secuencias  genómicas   que  codifican  una   colección  coherente   de  productos   funcionales  que   pueden  o  no   superponerse.”     Gerstein et al., 2007. Genome Res El  Gen:  un  blanco  en  movimiento.   ¿QUÉ ES UN GEN?
  17. 17. 17BIO-REFRESHER TRANSLATION
 reading frame v  Reading  frame  is  a  manner  of  dividing  the  sequence  of  nucleo(des  in  mRNA   (or  DNA)  into  a  set  of  consecu(ve,  non-­‐overlapping  triplets  (codons).   v  Three  frames  can  be  read  in  the  5’  à  3’  direc(on.  Given  that  DNA  has  two   an(-­‐parallel  strands,  an  addi(onal  three  frames  are  possible  to  be  read  on   the  an(-­‐sense  strand.  Six  total  possible  reading  frames  exist.   v  In  eukaryotes,  only  one  reading  frame  per  sec(on  of  DNA  is  biologically   relevant  at  a  (me:  it  has  the  poten(al  to  be  transcribed  into  RNA  and   translated  into  protein.  This  is  called  the  OPEN  READING  FRAME  (ORF)   •  ORF  =  Start  signal  +  coding  sequence  (divisible  by  3)  +  Stop  signal   v  The  sec(ons  of  the  mature  mRNA  transcribed  with  the  coding  sequence  but   not  translated  are  called  UnTranslated  Regions  (UTR);  one  at  each  end.  
  18. 18. 18 "Reading Frame" by Hornung Ákos - Wikimedia Commons BIO-REFRESHER TRANSLATION
 reading frame
  19. 19. 19 "ORF" by Thatsonginc - Wikimedia Commons BIO-REFRESHER TRANSLATION
 reading frame
  20. 20. 20BIO-REFRESHER TRANSLATION
 reading frame: splice sites v  The  spliceosome  catalyzes  the  removal  of  introns  and  the  liga(on  of  flanking   exons.   •  introns:  spaces  inside  the  gene,  not  part  of  the  coding  sequence   •  exons:  expression  units  (of  the  coding  sequence)   v  Splicing  “signals”  (from  the  point  of  view  of  an  intron):     •  There  is  a  5’  end  splice  “signal”  (site):  usually  GT  (less  common:  GC)   •  And  a  3’  end  splice  site:  usually  AG   •  …]5’-­‐GT/AG-­‐3’[…     v  It  is  possible  to  produce  more  than  one  protein  (polypep(de)  sequence  from   the  same  genic  region,  by  alterna(vely  bringing  exons  together=  alterna=ve   splicing.  For  example,  the  gene  Dscam  (Drosophila)  has  38,000  alterna(vely   spliced  mRNAs  =  isoforms  
  21. 21. 21 "Gene structure" by Daycd- Wikimedia Commons BIO-REFRESHER TRANSLATION
 now in your mind •  Although  of  brief  existence,  understanding  mRNAs  is  crucial,    as  they  will  become  the  center  of  your  work.  
  22. 22. 22 Text for figures goes here BIO-REFRESHER TRANSLATION
 reading frame: phase v  Introns  can  interrupt  the  reading  frame  of  a  gene  by  inser(ng  a  sequence   between  two  consecu(ve  codons       v  Between  the  first  and  second  nucleo(de  of  a  codon     v  Or  between  the  second  and  third  nucleo(de  of  a  codon   "Exon and Intron classes”. Licensed under Fair use via Wikipedia
  23. 23. 23 "Protein synthesis" by Kelvinsong - Wikimedia Commons CURATING GENOMES TRANSLATION
 in detail
  24. 24. 24BIO-REFRESHER HICCUPS
 in transcription and translation v  The  presence  of  premature  Stop  codons  in  the  message  is  possible.  A   process  called  non-­‐sense  mediated  decay  checks  for  them  and  corrects   them  to  avoid:  incomplete  splicing,  DNA  muta(ons,  transcrip(on  errors,  and   leaky  scanning  of  ribosome  –  causing  changes  in  the  reading  frame  (frame   shiYs).   v  Inser(ons  and  dele(ons  (indels)  can  cause  frame  shios,  when  indel  is  not   divisible  by  three  (3).  As  a  result,  the  pep(de  can  be  abnormally  long,  or   abnormally  short  –  depending  when  the  first  in-­‐frame  Stop  signal  is  located.  
  25. 25. Predicción  &  Anotación  
  26. 26. 26Gene Prediction GENE PREDICTION v  The  iden(fica(on  of  structural  features  of  the  genome:     •  Primarily  focused  on  protein-­‐coding  genes.     •  Predicts  also  transfer  RNAs  (tRNA),  ribosomal  RNAs  (rRNA),   regulatory  mo(fs,  long  and  small  non-­‐coding  RNAs  (ncRNA),   repe((ve  elements  (masked),  etc.   •  Two  methods  for  iden(fica(on.   •  Some  are  self-­‐trained  and  some  must  be  trained.  
  27. 27. 27Gene Prediction GENE PREDICTION
 methods for discovery 1)  Ab  ini,o:     -­‐  based  on  DNA  composi(on,     -­‐  deals  strictly  with  genomic   sequences   -­‐  makes  use  of  sta(s(cal   approaches  to  search  for  coding   regions  and  typical  gene  signals.       •  E.g.  Augustus,  GENSCAN,     geneid,  fgenesh,  etc.   3’   Nat Rev Genet. 2015 Jun;16(6):321-32. doi: 10.1038/nrg3920
  28. 28. 28 Nucleic Acids 2003 vol. 31 no. 13 3738-3741 Gene Prediction GENE PREDICTION
 methods for discovery (ctd) 2)  Homology-­‐based:     -­‐  evidence-­‐based,     -­‐  finds  genes  using  either  similarity  searches  in  the  main  databases  or   experimental  data  including  RNAseq,  expressed  sequence  tags  (ESTs),  full-­‐length   complementary  DNAs  (cDNAs),  etc.       •  E.g:  fgenesh++,  Just  Annotate  My  genome  (JAMg),  SGP2  
  29. 29. 29 GENE ANNOTATION Integra(on  of  data  from  computa(onal  &  experimental  evidence  with  data   from  predic(on  tools,  to  generate  a  reliable  set  of  structural  annota=ons.       Involves:   1)  ab  ini1o  predic(ons   2)  assessment  of  biological  evidence  to  drive  the  gene  predic(on  process   3)  synthesis  of  these  results  to  produce  a  set  of  consensus  gene  models   Gene Annotation
  30. 30. 30 In  some  cases  algorithms  and  metrics  used  to  generate   consensus  sets  may  actually  reduce  the  accuracy  of  the  gene’s   representa(on.   GENE ANNOTATION Gene  models  may  be  organized  into  “sets”  using:   v  automa(c  integra(on  of  predicted  sets  (combiners);  e.g:  GLEAN,   EvidenceModeler   or   v  tools  packaged  into  pipelines;  e.g:  MAKER,  PASA,  Gnomon,   Ensembl,  etc.   Gene Annotation
  31. 31. ANOTACION
 un arte imperfecto No one is perfect, least of all automated annotation. 31 Nuevas  tecnologías  traen  nuevos  retos:     •  Errores  en  el  ensamblaje  pueden  causar   fragmentación  en  las  anotaciones   •  Cobertura  limitada  dificulta  la   iden(ficación  con  certeza   Image: www.BroadInstitute.org
  32. 32. ANOTACION MANUAL
 mejorando predicciones Schiex  et  al.  Nucleic  Acids  2003  (31)  13:  3738-­‐3741   Predicciones Automatizadas Evidencia Experimental Manual Annotation – to the rescue. 32 cDNAs,  búsquedas  con  HMM,  RNAseq,     genes  de  otras  especies.   Entonces,  es  necesario  refinar  las   predicciones  de  elementos  biológicos   codificados  en  el  genoma,  lo  que  requiere   una  cuidadosa  revisión.  
  33. 33. 33 BIOCURACION
 ajustes estructurales y funcionales Iden(ficar  los  elementos  del  genoma   que  mejor  representan  la  biología   subyacente  y  eliminar  los  elementos   que  reflejan  errores  sistémicos  de  los   análisis  automa(zados.   Asignar  funciones  a  través  de  análisis   compara(vos  entre  elementos   genómicos  similares  de  organismos   cercanamente  relacionados  usando   literatura,  bases  de  datos,  y  datos   experimentales.   BIOCURACION hAp://GeneOntology.org   1   2  
  34. 34. MANUAL ANNOTATION 34 PERO, EN CURACION
 no siempre era posible ampliar estos esfuerzos Researchers  on  their  own;   may  or  may  not  publicize   results;  may  be  a  dead-­‐end   with  very  few  people  ever   aware  of  these  results.   Elsik  et  al.  2006.  Genome  Res.  16(11):1329-­‐33.   Too  many  sequences  and  not  enough  hands.   A  small  group  of  highly   trained  experts  (e.g.  GO).   1   Museum   A  few  very  good  biologists,  a     few  very  good  bioinforma(cians   camping  together  for  intense  but   short  periods  of  (me.   Jamboree  2   Co"age  3  
  35. 35. ANOTACION
 un ejercicio en colaboración COLABORANDO 35 Los  inves1gadores  usualmente  buscamos  las   opiniones  y  percepciones  de  colegas  con   experiencia  en  áreas  específicas  del   conocimiento.     Por  ejemplo,  dominios  conservados     o  familias  de  genes.  
  36. 36. Apollo
 una herramienta para editar anotaciones 36 v  En  la  web,  integrado  con  JBrowse.   v  ¡Permite  la  colaboración  en  (empo  real!   v  Automá(camente  genera  datos  en     formatos  comunes  para  análisis.   v  Anotación  manual  de  genes,  pseudogenes,  tRNAs,     snRNAs,  snoRNAs,  ncRNAs,  miRNAs,  TEs,  y  fragmentos  repe((vos.   v  Funciones  intui(vas  y  menús  desplegables  crean  y  editan  estructuras   de  transcritos  y  exones,  insertan  comentarios  (CV,  texto  libre),  y   términos  de  GO,  etc.   INTRODUCING APOLLO hAp://GenomeArchitect.org/  
  37. 37. ARQUITECTURA
 simple, flexible ARCHITECTURE 37 Cliente  de  web  +  Motor  de  edición  de  anotaciones  +  Servicio  de  datos  en  el  servidor   REST / JSON Websockets Motor de Anotación (Servidor) Shiro LDAP OAuth Annotations Security Preferences Organisms Tracks BAM BED VCF GFF3 BigWig Curadores Google Web Toolkit (GWT) / Bootstrap JBrowse DOJO / jQuery Datos a JBrowse Organismo 1 Carga de datos con evidencia genómica para cada organismo Servicio único de almacenamiento PostgreSQL, MySQL, MongoDB, ElasticSearch Apollo v2.0 Datos a JBrowse Organismo 2
  38. 38. CLIENTE DE WEB
 panel del curador ARCHITECTURE 38 Motor de Anotación (Servidor) Curadores Google Web Toolkit (GWT) / Bootstrap JBrowse DOJO / jQuery Apollo v2.0 BAM BED VCF GFF3 BigWig REST / JSON Websockets Usa GWT/Bootstrap en el frente para proveerle un comportamiento versátil a la aplicación. Panel Del Curador ¡NUEVO! ¡NUEVO!
  39. 39. MOTOR DE ANOTACION
 lógica de edición ARCHITECTURE 39 Motor de Anotación (Servidor) Shiro LDAP OAuth Datos a JBrowse Organismo 2 Datos a JBrowse Organismo 1 Servicio único de almacenamiento Apollo v2.0 Controladores Grails (J2EE servlet) llevan las solicitudes al directorio de datos apropiado para cada organismo en JBrowse Carga de datos con evidencia genómica para cada organismo ¡NUEVO! Cliente de web REST / JSON Websockets
  40. 40. SERVICIO DE DATOS EN EL SERVIDOR
 servicio único de almacenamiento ARCHITECTURE 40 Anotaciones Seguridad Preferencias Organismos Pistas de datos Servicio único de almacenamiento PostgreSQL, MySQL, MongoDB, ElasticSearch Motor de Anotación (Servidor) Un solo servicio de almacenamiento, consultable, para guardar las anotaciones. ¡NUEVO! Apollo v2.0
  41. 41. ¡COLABOREMOS!
 Apollo tiene código abierto y es expandible HIGHLIGHTED IMPROVEMENTS 41 The Genome Sequence Annotation Server (GenSAS) Annotate Los  usuarios  pueden  adicionar  programas  para  permi=r  sus  propios  procesos  de   trabajo.   Ejemplos:     •  GenSAS:  plataforma  para   anotación  estructural  del   genoma.     •  i5K:   -­‐  Espacio  en  NAL  para  compar(r   ensamblajes  y  conjuntos  de   genes,  y  para  anotación  manual.   -­‐  Proyecto  Piloto  >40  genomas:   47  charlas,  9  posters  en   Simposio  de  Genómica  de   Artrópodos.   Annotate National Agricultural Library
  42. 42. We  train  and  support  hundreds  of  geographically  dispersed  scien(sts  from   diverse  research  communi(es  to  conduct  manual  annota(ons,  to  recover   coding  sequences  in  agreement  with  all  available  biological  evidence  using   Apollo.       v  Gate  keeping  and  monitoring.   v  Tutorials,  training  workshops,  and  “geneborees”.   42 DISPERSED COMMUNITIES collaborative manual annotation efforts APOLLO
  43. 43. LESSONS LEARNED
 What  we  have  learned:     •  Collabora(ve  work  dis(lls  invaluable  knowledge   •  We  must  enforce  strict  rules  and  formats   •  We  must  evolve  with  the  data   •  A  liAle  training  goes  a  long  way   •  NGS  poses  addi(onal  challenges   LESSONS LEARNED 43
  44. 44. ¿Cuál  es  la  tarea  del   curador?  
  45. 45. Becoming Acquainted with Web Apollo 45 | 45 GENERAL PROCESS OF CURATION
 main steps to remember 1.  Select  or  find  a  region  of  interest,  e.g.  scaffold.   2.  Select  appropriate  evidence  tracks  to  review  the  gene  model.   3.  Determine  whether  a  feature  in  an  exis(ng  evidence  track   will  provide  a  reasonable  gene  model  to  start  working.   4.  If  necessary,  adjust  the  gene  model.   5.  Check  your  edited  gene  model  for  integrity  and  accuracy  by   comparing  it  with  available  homologs.   6.  Comment  and  finish.  
  46. 46. 46CURATING GENOMES WHAT ANNOTATORS SHOULD LOOK FOR
 annotators: that’s you! v  Annota=ng  a  simple  case:  WHEN  “The  official  predic(on  is  correct,  or  nearly   correct,  assuming  that  no  aligned  data  extends  beyond  the  gene  model  and   if  so,  it  is  not  likely  to  be  coding  sequence,  and/or  the  gene  predic(on   matches  what  you  know  about  the  gene”:   a.  Can  you  add  UTRs?     b.  Check  exon  structures.   c.  Check  splice  sites:  …]5’-­‐GT/AG-­‐3’[…   d.  Check  ‘start’  and  ‘stop’  sites.   e.  Check  the  predicted  protein  product(s).   f.  If  the  protein  product  s(ll  does  not  look  correct,  go  on  to  “Annota(ng   more  complex  cases”.    
  47. 47. 47CURATING GENOMES WHAT ANNOTATORS SHOULD LOOK FOR
 continued v  Addi=onal  func=onality.  You  may  also  need  to  learn  how  to:   a.  Get  genomic  sequence     b.  Merge  exons     c.  Add/Delete  an  exon     d.  Create  an  exon  de  novo  (within  an  intron  or  outside  exis(ng   annota(ons).   e.  Right/apple-­‐click  on  a  feature  to  get  feature  ID  and  addi(onal   informa(on     f.  Looking  up  homolog  descrip(ons  going  to  the  accession  web  page  at   UniProt/Swissprot    
  48. 48. 48CURATING GENOMES WHAT ANNOTATORS SHOULD LOOK FOR
 continued v  Annota=ng  more  complex  cases:     a.  Incomplete  annota(on:  protein  integrity  checks,  indicate  gaps,  missing  5’   sequences  or  missing  3’  sequences.     b.  Merge  of  2  gene  predic(ons  on  same  scaffold     c.  Merge  of  2  gene  predic(ons  on  different  scaffolds  (uh-­‐oh!).   d.  Split  of  a  gene  predic(on     e.  Frameshios,  Selenocysteine,  single-­‐base  errors,  and  other  inconvenient   phenomena    
  49. 49. 49CURATING GENOMES WHAT ANNOTATORS SHOULD LOOK FOR
 continued v  Adding  important  project  informa=on  in  the  form  of  Canned  and/or   Customized  Comments:   a.  NCBI  ID,  RefSeq  ID,  gene  symbol(s),  common  name(s),  synonyms,  top   BLAST  hits  (GenBank  IDs),  orthologs  with  species  names,  and  anything   else  you  can  think  of,  because  you  are  the  expert.   b.  Type  of  annota(on  (e.g.:  whether  or  not  the  gene  model  was  changed)     c.  Data  source  (for  example  if  the  Fgeneshpp  predicted  gene  was  the   star(ng  point  for  your  annota(on)   d.  The  kinds  of  changes  you  made  to  the  gene  model,  e.g.:  split,  merge   e.  Func(onal  descrip(on   f.  Whether  you  would  like  for  your  MOD  curator  to  check  the  annota(on   g.  Whether  part  of  your  gene  is  on  a  different  scaffold.  
  50. 50. 50 TRAINING CURATORS
 a little training goes a long way! Provided  with  adequate  tools,  wet  lab  scien(sts  make   excep(onal  curators  who  can  easily  learn  to  maximize  the   genera(on  of  accurate,  biologically  supported  gene  models.   APOLLO
  51. 51. Conozcamos  a  Apollo    hAp://genomearchitect.org/web_apollo_user_guide  
  52. 52. 52 Apollo
 ámbito de edición para anotaciones BECOMING ACQUAINTED WITH APOLLO Color  por  marco  de  lectura,   alternar  cadena,  cambiar   esquema  de  color,  resaltador   Cargar  evidencia  experimental   (GFF3,  BAM,  BigWig),  pistas  de   datos  de  combinación  y     búsqueda.   Interrogar  el  genoma   usando  BLAT.   Navegación  y  zoom.   Buscar  un  gen  o  un  grupo   Obtener  coordenadas,  y  hacer   zoom  con  “selección  elás(ca”   Login   Anotaciones   creadas  por  el   usuario   Panel  del   curador   Pistas  de   datos  de   evidencia   Datos   transcriptómicos  de   estadío  y    (po   celular     específicos.  
  53. 53. ¡Ahora  juguemos!  
  54. 54. Instrucciones 54 | 54 APOLLO EN LA WEB
 instrucciones Email:   nombre.apellido@example.com     Contraseña:   nombreapellido   Email   Contraseña   Servidor   Empezar  en   user.one@example.com   userone   1   1   user.two@example.com   usertwo   2   1   user.three@example.com   userthree   3   1   user.four@example.com   userfour   4   1   user.five@example.com   userfive   5   1   user.six@example.com   usersix   1   7   user.seven@example.com   userseven   2   7   user.eight@example.com   usereight   3   7   user.nine@example.com   usernine   4   7   user.ten@example.com   userten   5   7   user.eleven@example.com   usereleven   1   1   user.twelve@example.com   usertwelve   2   1   user.thirteen@example.com   userthirteen   3   1   user.fourteen@example.com   userfourteen   4   1   user.fioeen@example.com   userfioeen   5   1   user.sixteen@example.com   usersixteen   1   7   user.seventeen@example.com   userseventeen   2   7   user.eighAeen@example.com   usereighteen   3   7   user.nineteen@example.com   usernineteen   4   7   user.twenty@example.com   usertwenty   5   7   user.twentyone@example.com   usertwentyone   1   1   user.twentytwo@example.com   usertwentytwo   2   1   user.twentythree@example.com   usertwentythree   3   1   user.twentyfour@example.com   usertwentyfour   4   1   user.twentyfive@example.com   usertwentyfive   5   1   user.twentysix@example.com   usertwentysix   1   7   user.twentyseven@example.com   usertwentyseven   2   7   user.twentyeight@example.com   usertwentyeight   3   7   user.twentynine@example.com   usertwentynine   4   7   Servidor   URL   1  hAp://54.94.132.228:8080/apollo/annotator/index   2  hAp://54.207.71.112:8080/apollo/annotator/index   3  hAp://54.207.106.136:8080/apollo/annotator/index   4  hAp://54.207.113.253:8080/apollo/annotator/index   5  hAp://54.232.217.84:8080/apollo/annotator/index  
  55. 55. Funcionalidad  y  navegación.  
  56. 56. 56 Apollo
 funcionalidad BECOMING ACQUAINTED WITH APOLLO •  Agregar:     –  IDs  de  bases  de  datos  públicas  (e.g.   GenBank,  usando  DBXRef);  símbolo(s)   de  cada  gen,  nombre(s)  común(es),   sinónimos,  el  mejor  resultado  de  BLAST,   ortólogos  con  el  nombre  de  la  especie.   –  Asignaciones  de  función  apropiadas   (e.g.  via  datos  de  RNA-­‐Seq,  búsquedas   de  literatura,  búsquedas  con  HMMs,   etc.)   –  Comentarios  acerca  de  las   modificaciones  que  se  realizaron,  o  si   ninguna  fue  necesaria.   –  Y  otras  notas  que  se  le  ocurran  al   biocurador.     •  Corregir  si(os  de  ‘Inicio’  y  ‘Parada’   •  Arreglar  si(os  de  ayuste  no  canónicos   •  Anotar  UTRs  (e.g.:  usando  RNA-­‐Seq)   •  Obtener  &  corregir  predicciones  de   productos  de  proteínas   -­‐  Alinearlos  con  genes  o  familias  de   genes  relevantes.   -­‐  Usar  blastp  en  RefSeq  o  nr  de  NCBI   •  Revisar  la  falta  de  datos  en  el  ensamble   •  Unir  2  predicciones  de  genes  en  el   mismo  grupo   •  Dividir  una  predicción  de  gen   •  Corregir  desplazamientos  de  la  pauta   de  lectura,  y  otros  errores  en  el   ensamblaje   •  Anotar  selenocisteínas,  errores  de  una   sola  base,  etc.  
  57. 57. REMOVABLE SIDE DOCK
 with customizable tabs HIGHLIGHTED IMPROVEMENTS 57 Annotations Organism Users Groups AdminTracks Reference Sequence
  58. 58. EDITS & EXPORTS
 annotation details, exon boundaries, data export HIGHLIGHTED IMPROVEMENTS 58 1 2 Annotations 1 2
  59. 59. HIGHLIGHTED IMPROVEMENTS 59 Reference Sequences 3 FASTA   GFF3   EDITS & EXPORTS
 annotation details, exon boundaries, data export 3
  60. 60. 60 | 60 Becoming Acquainted with Web Apollo. USER NAVIGATION Annotator   panel.   •  Choose appropriate evidence tracks from list on annotator panel. •  Select & drag elements from evidence track into the ‘User-created Annotations’ area. •  Hovering over annotation in progress brings up an information pop-up.
  61. 61. 61 | 61 USER NAVIGATION Becoming Acquainted with Web Apollo. •  Annotation right-click menu
  62. 62. 62 Annota(ons,  annota(on  edits,  and  History:  stored  in  a  centralized  database.   62 USER NAVIGATION Becoming Acquainted with Web Apollo.
  63. 63. 63 The  Annota(on  Informa=on  Editor   DBXRefs  are  database  crossed  references:  if  you  have   reason  to  believe  that  this  gene  is  linked  to  a  gene  in  a   public  database  (including  your  own),  then  add  it  here.   63 USER NAVIGATION Becoming Acquainted with Web Apollo.
  64. 64. 64 The  Annota(on  Informa=on  Editor   •  Add  PubMed  IDs   •  Include  GO  terms  as  appropriate   from  any  of  the  three  ontologies   •  Write  comments  sta(ng  how  you   have  validated  each  model.   64 USER NAVIGATION Becoming Acquainted with Web Apollo.
  65. 65. 65 | 65 USER NAVIGATION Becoming Acquainted with Web Apollo. •  ‘Zoom  to  base  level’  op(on  reveals  the  DNA  Track.  
  66. 66. 66 | 66 USER NAVIGATION Becoming Acquainted with Web Apollo. •  Color  exons  by  CDS  from  the  ‘View’  menu.  
  67. 67. 67 | Zoom  in/out  with  keyboard:   shio  +  arrow  keys  up/down   67 USER NAVIGATION Becoming Acquainted with Web Apollo. •  Toggle  reference  DNA  sequence  and  transla=on  frames  in  forward   strand.  Toggle  models  in  either  direc(on.  
  68. 68. Anotación  
  69. 69. casos  simples  
  70. 70. “Simple  case”:      -­‐  the  predicted  gene  model  is  correct  or  nearly  correct,  and      -­‐  this  model  is  supported  by  evidence  that  completely  or  mostly   agrees  with  the  predic(on.      -­‐  evidence  that  extends  beyond  the  predicted  model  is  assumed   to  be  non-­‐coding  sequence.       The  following  are  simple  modifica(ons.       70 | 70 ANNOTATING SIMPLE CASES Becoming Acquainted with Web Apollo. SIMPLE CASES
  71. 71. 71 | •  A  confirma(on  box  will  warn  you  if  the  receiving  transcript  is  not  on  the   same  strand  as  the  feature  where  the  new  exon  originated.   •  Check  ‘Start’  and  ‘Stop’  signals  aoer  each  edit.   71 ADDING EXONS Becoming Acquainted with Web Apollo. SIMPLE CASES
  72. 72. If  transcript  alignment  data  are  available  and  extend  beyond  your  original  annota(on,  you   may  extend  or  add  UTRs.     1.  Right  click  at  the  exon  edge  and  ‘Zoom  to  base  level’.     2.  Place  the  cursor  over  the  edge  of  the  exon  un1l  it  becomes  a  black  arrow  then  click   and  drag  the  edge  of  the  exon  to  the  new  coordinate  posi(on  that  includes  the  UTR.     72 | To  add  a  new  spliced  UTR  to  an  exis(ng  annota(on   follow  the  procedure  for  adding  an  exon.   72 ADDING UTRs Becoming Acquainted with Web Apollo. SIMPLE CASES
  73. 73. 1.  Zoom  in  to  clearly  resolve  each  exon  as  a  dis(nct  rectangle.     2.  Two  exons  from  different  tracks  sharing  the  same  start  and/or  end   coordinates  will  display  a  red  bar  to  indicate  matching  edges.   3.  Selec(ng  the  whole  annota(on  or  one  exon  at  a  (me,  use  this  ‘edge-­‐ matching’  func(on  and  scroll  along  the  length  of  the  annota(on,   verifying  exon  boundaries  against  available  data.  Use  square  [  ]   brackets  to  scroll  from  exon  to  exon.   4.  Check  if  cDNA  /  RNAseq  reads  lack  one  or  more  of  the  annotated   exons  or  include  addi(onal  exons.       73 | 73 CHECK EXON INTEGRITY Becoming Acquainted with Web Apollo. SIMPLE CASES
  74. 74. To  modify  an  exon  boundary  and  match   data   in   the   evidence   tracks:   select   both   the   offending   exon   and   the   feature  with  the  expected  boundary,   then  right  click  on  the  annota(on  to   select  ‘Set  3’  end’  or  ‘Set  5’  end’  as   appropriate.     74 | In  some  cases  all  the  data  may  disagree  with  the  annota(on,  in   other  cases  some  data  support  the  annota(on  and  some  of  the   data  support  one  or  more  alterna(ve  transcripts.  Try  to  annotate   as  many  alterna(ve  transcripts  as  are  well  supported  by  the  data.   74 EXON STRUCTURE INTEGRITY Becoming Acquainted with Web Apollo. SIMPLE CASES
  75. 75. Flags  non-­‐canonical   splice  sites.   Selec(on  of  features  and  sub-­‐ features   Edge-­‐matching   Evidence  Tracks  Area   ‘User-­‐created  Annota(ons’  Track   Apollo’s  edi(ng  logic  (brain):     §  selects  longest  ORF  as  CDS   §  flags  non-­‐canonical  splice  sites   75 ORFs AND SPLICE SITES Becoming Acquainted with Web Apollo. SIMPLE CASES
  76. 76. 76 | Exon/intron  junc(on  possible  error   Original  model   Curated  model   Non-­‐canonical   splices   are   indicated   by   an   orange   circle   with   a   white   exclama(on   point   inside,   placed   over   the   edge   of   the   offending   exon.     Canonical  splice  sites:   3’-­‐…exon]GA  /  TG[exon…-­‐5’   5’-­‐…exon]GT  /  AG[exon…-­‐3’   reverse  strand,  not  reverse-­‐complemented:   forward  strand   76 SPLICE SITES Becoming Acquainted with Web Apollo. SIMPLE CASES Zoom  to  review  non-­‐canonical   splice  site  warnings.  Although   these  may  not  always  have  to  be   corrected  (e.g  GC  donor),  they   should  be  flagged  with  the   appropriate  comment.    
  77. 77. Web  Apollo  calculates  the  longest  possible  open   reading  frame  (ORF)  that  includes  canonical  ‘Start’   and  ‘Stop’  signals  within  the  predicted  exons.     If  ‘Start’  appears  to  be  incorrect,  modify  it  by  selec(ng   an  in-­‐frame  ‘Start’  codon  further  up  or   downstream,  depending  on  evidence  (protein   database,  addi(onal  evidence  tracks).       It  may  be  present  outside  the  predicted  gene   model,  within  a  region  supported  by  another   evidence  track.     In  very  rare  cases,  the  actual  ‘Start’  codon  may  be   non-­‐canonical  (non-­‐ATG).     77 | 77 ‘START’ AND ‘STOP’ SITES Becoming Acquainted with Web Apollo. SIMPLE CASES
  78. 78. complex  cases  
  79. 79. Evidence  may  support  joining  two  or  more  different  gene  models.     Warning:  protein  alignments  may  have  incorrect  splice  sites  and  lack  non-­‐conserved  regions!     1.  In  ‘User-­‐created  Annota=ons’  area  shio-­‐click  to  select  an  intron  from  each  gene  model  and   right  click  to  select  the  ‘Merge’  op(on  from  the  menu.     2.  Drag  suppor(ng  evidence  tracks  over  the  candidate  models  to  corroborate  overlap,  or   review  edge  matching  and  coverage  across  models.   3.  Check  the  resul(ng  transla(on  by  querying  a  protein  database  e.g.  UniProt.  Add  comments   to  record  that  this  annota(on  is  the  result  of  a  merge.   79 | 79 Red  lines  around  exons:   ‘edge-­‐matching’  allows  annotators  to  confirm  whether  the   evidence  is  in  agreement  without  examining  each  exon  at  the   base  level.   COMPLEX CASES merge two gene predictions on the same scaffold Becoming Acquainted with Web Apollo. COMPLEX CASES
  80. 80. One  or  more  splits  may  be  recommended  when:     -­‐  different  segments  of  the  predicted  protein  align  to  two  or  more   different  gene  families     -­‐  predicted  protein  doesn’t  align  to  known  proteins  over  its  en(re  length     Transcript  data  may  support  a  split,  but  first  verify  whether  they  are   alterna(ve  transcripts.     80 | 80 COMPLEX CASES split a gene prediction Becoming Acquainted with Web Apollo. COMPLEX CASES
  81. 81. DNA  Track   ‘User-­‐created  Annota=ons’  Track   81 COMPLEX CASES correcting frameshifts and single-base errors Becoming Acquainted with Web Apollo. COMPLEX CASES Always  remember:  when  annota(ng  gene  models  using  Apollo,  you  are  looking  at  a  ‘frozen’  version  of   the  genome  assembly  and  you  will  not  be  able  to  modify  the  assembly  itself.  
  82. 82. 82 COMPLEX CASES correcting selenocysteine containing proteins Becoming Acquainted with Web Apollo. COMPLEX CASES
  83. 83. 83 COMPLEX CASES correcting selenocysteine containing proteins Becoming Acquainted with Web Apollo. COMPLEX CASES
  84. 84. 1.  Apollo  allows  annotators  to  make  single  base  modifica(ons  or  frameshios  that  are  reflected  in   the  sequence  and  structure  of  any  transcripts  overlapping  the  modifica(on.  These   manipula(ons  do  NOT  change  the  underlying  genomic  sequence.     2.  If  you  determine  that  you  need  to  make  one  of  these  changes,  zoom  in  to  the  nucleo(de  level   and  right  click  over  a  single  nucleo(de  on  the  genomic  sequence  to  access  a  menu  that   provides  op(ons  for  crea(ng  inser(ons,  dele(ons  or  subs(tu(ons.     3.  The  ‘Create  Genomic  Inser=on’  feature  will  require  you  to  enter  the  necessary  string  of   nucleo(de  residues  that  will  be  inserted  to  the  right  of  the  cursor’s  current  loca(on.  The   ‘Create  Genomic  Dele=on’  op(on  will  require  you  to  enter  the  length  of  the  dele(on,  star(ng   with  the  nucleo(de  where  the  cursor  is  posi(oned.  The  ‘Create  Genomic  Subs=tu=on’  feature   asks  for  the  string  of  nucleo(de  residues  that  will  replace  the  ones  on  the  DNA  track.   4.  Once  you  have  entered  the  modifica(ons,  Apollo  will  recalculate  the  corrected  transcript  and   protein  sequences,  which  will  appear  when  you  use  the  right-­‐click  menu  ‘Get  Sequence’   op(on.  Since  the  underlying  genomic  sequence  is  reflected  in  all  annota(ons  that  include  the   modified  region  you  should  alert  the  curators  of  your  organisms  database  using  the   ‘Comments’  sec(on  to  report  the  CDS  edits.     5.  In  special  cases  such  as  selenocysteine  containing  proteins  (read-­‐throughs),  right-­‐click  over  the   offending/premature  ‘Stop’  signal  and  choose  the  ‘Set  readthrough  stop  codon’  op(on  from   the  menu.    84 | 84 Becoming Acquainted with Web Apollo. COMPLEX CASES COMPLEX CASES correcting frameshifts, single-base errors, and selenocysteines
  85. 85. Follow  the  checklist  un(l  you  are  happy  with  the  annota(on!   And  remember  to…   –  comment  to  validate  your  annota(on,  even  if  you  made  no  changes  to  an   exis(ng  model.  Think  of  comments  as  your  vote  of  confidence.     –  or  add  a  comment  to  inform  the  community  of  unresolved  issues  you   think  this  model  may  have.   85 | 85 Always  Remember:  Web  Apollo  cura(on  is  a  community  effort  so   please  use  comments  to  communicate  the  reasons  for  your     annota(on  (your  comments  will  be  visible  to  everyone).   COMPLETING THE ANNOTATION Becoming Acquainted with Web Apollo.
  86. 86. Checklist  
  87. 87. 1.  Can  you  add  UTRs  (e.g.:  via  RNA-­‐Seq)?   2.  Check  exon  structures   3.  Check  splice  sites:  most  splice  sites  display  these   residues  …]5’-­‐GT/AG-­‐3’[…   4.  Check  ‘Start’  and  ‘Stop’  sites   5.  Check  the  predicted  protein  product(s)   –  Align  it  against  relevant  genes/gene  family.   –  blastp  against  NCBI’s  RefSeq  or  nr   6.  If  the  protein  product  s(ll  does  not  look  correct   then  check:   –  Are  there  gaps  in  the  genome?   –  Merge  of  2  gene  predic(ons  on  the  same   scaffold   –  Merge  of  2  gene  predic(ons  from  different   scaffolds     –  Split  a  gene  predic(on   –  FrameshiYs     –  error  in  the  genome  assembly?   –  Selenocysteines,  single-­‐base  errors,  etc   87 | 87 7.  Finalize  annota(on  by  adding:   –  Important  project  informa(on  in  the  form  of   comments   –  IDs  from  public  databases  e.g.  GenBank  (via   DBXRef),  gene  symbol(s),  common  name(s),   synonyms,  top  BLAST  hits,  orthologs  with  species   names,  and  everything  else  you  can  think  of,   because  you  are  the  expert.   –  Whether  your  model  replaces  one  or  more  models   from  the  official  gene  set  (so  it  can  be  deleted).   –  The  kinds  of  changes  you  made  to  the  gene  model   of  interest,  if  any.     –  Any  appropriate  func(onal  assignments  of  interest   to  the  community  (e.g.  via  BLAST,  RNA-­‐Seq  data,   literature  searches,  etc.)   THE CHECKLIST for accuracy and integrity MANUAL ANNOTATION CHECKLIST
  88. 88. Example  
  89. 89. Example Example 89 A  public  Apollo  Demo  using  the  Honey  Bee  genome  is  available  at     hAp://genomearchitect.org/WebApolloDemo   -­‐  Demonstra(on  using  the  Hyalella  azteca  genome   (amphipod  crustacean).  
  90. 90. What do we know about this genome? •  Currently  publicly  available  data  at  NCBI:   •  >37,000    nucleo(de  seqsà  scaffolds,  mitochondrial  genes   •  300    amino  acid  seqsà  mitochondrion   •  53    ESTs   •  0      conserved  domains  iden(fied   •  0    “gene”  entries  submiAed     •  Data  at  i5K  Workspace@NAL  (annota(on  hosted  at  USDA)     -­‐  10,832  scaffolds:  23,288  transcripts:  12,906  proteins   Example 90
  91. 91. PubMed Search: 
 what’s new? Example 91
  92. 92. PubMed Search: what’s new? Example 92 “Ten  popula(ons  (3  cultures,  7  from  California  water   bodies)  differed  by  at  least  550-­‐fold  in  sensi=vity  to   pyrethroids.”     “By  sequencing  the  primary  pyrethroid  target  site,  the   voltage-­‐gated  sodium  channel  (vgsc),  we  show  that   point  muta(ons  and  their  spread  in  natural  popula(ons   were  responsible  for  differences  in  pyrethroid   sensi(vity.”   “The  finding  that  a  non-­‐target  aqua(c  species  has   acquired  resistance  to  pes(cides  used  only  on  terrestrial   pests  is  troubling  evidence  of  the  impact  of  chronic   pes=cide  transport  from  land-­‐based  applica(ons  into   aqua(c  systems.”  
  93. 93. How many sequences for our gene of interest? Example 93 •  Para,  (voltage-­‐gated  sodium  channel  alpha   subunit;  Nasonia  vitripennis).     •  NaCP60E  (Sodium  channel  protein  60  E;  D.   melanogaster).   –  MF:  voltage-­‐gated  ca(on  channel  ac(vity   (IDA,  GO:0022843).   –  BP:  olfactory  behavior  (IMP,  GO: 0042048),  sodium  ion  transmembrane   transport  (ISS,GO:0035725).   –  CC:  voltage-­‐gated  sodium  channel   complex  (IEA,  GO:0001518).   And  what  do  we  know  about  them?  
  94. 94. Retrieving sequences for 
 sequence similarity searches. Example 94 >vgsc-­‐Segment3-­‐DomainII   RVFKLAKSWPTLNLLISIMGKTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTEKVTKFKWSQDG QMPRWNFVDFFHSFMIVFRVLCGEWIESMWDCMYVGDFSCVPFFLATVVIGNLVVSFMHR
  95. 95. BLAT search Example 95 >vgsc-­‐Segment3-­‐DomainII   RVFKLAKSWPTLNLLISIMGKTVGALGNLTFVLCIIIFIFAVMGMQLFGKNYTEKVTKFKWSQDG QMPRWNFVDFFHSFMIVFRVLCGEWIESMWDCMYVGDFSCVPFFLATVVIGNLVVSFMHR
  96. 96. BLAT search Example 96
  97. 97. Customizations: 
 high-scoring segment pairs (hsp) in “BLAST+ Results” track Example 97
  98. 98. Creating a new gene model: drag and drop Example 98 •  Apollo automatically calculates ORF. In this case, ORF includes the high-scoring segment pairs (hsp).
  99. 99. Available Tracks Example 99
  100. 100. Get Sequence Example 100 http://blast.ncbi.nlm.nih.gov/Blast.cgi
  101. 101. Also, flanking sequences (other gene models) vs. NCBI nr Example 101 In  this  case,  two  gene   models  upstream,  at  5’   end.   BLAST  hsps  
  102. 102. Review alignments Example 102 HaztTmpM006234   HaztTmpM006233   HaztTmpM006232  
  103. 103. Hypothesis for vgsc gene model Example 103
  104. 104. Editing: merge the three models Example 104 Merge  by  dropping  an   exon  or  gene  model   onto  another.   Merge  by  selec(ng   two  exons  (holding   down  “Shio”)  and   using  the  right  click   menu.   or…  
  105. 105. Editing: correct boundaries, delete exons Example 105 Modify  exon  /  intron   boundary:     -­‐  Drag  the  end  of  the   exon  to  the  nearest   canonical  splice  site.   -­‐  Use  right-­‐click  menu.   Delete  first  exon  from   HaztTmpM006233  
  106. 106. Editing: set translation start Example 106
  107. 107. Editing: modify boundaries Example 107 Modify  intron  /   exon  boundary   also  at  coord.   78,999.  
  108. 108. Finished model Example 108 Corroborate  integrity  and  accuracy  of  the  model:     -­‐  Start  and  Stop   -­‐  Exon  structure  and  splice  sites  …]5’-­‐GT/AG-­‐3’[…   -­‐  Check  the  predicted  protein  product  vs.  NCBI  nr  
  109. 109. Information Editor •  DBXRefs:  e.g.  NP_001128389.1,  N.   vitripennis,  RefSeq   •  PubMed  iden(fier:  PMID:  24065824   •  Gene  Ontology  IDs:  GO:0022843,  GO: 0042048,  GO:0035725,  GO:0001518.   •  Comments.   •  Name,  Symbol.     •  Approve  /  Delete  radio  buAon.   Example 109 Comments   (if  applicable)  
  110. 110. Video  demostración  
  111. 111. APOLLO
 demonstration DEMO 111 Apollo  demo  video  available  at:     hAps://youtu.be/VgPtAP_fvxY  
  112. 112. CONTENIDO
 Web  Apollo  Collabora(ve  Cura(on  and     Interac(ve  Analysis  of  Genomes   112OUTLINE •  BIO-­‐REFRESHER   conceptos  que  neceistamos   •  ANOTACION   predicciones  automá(cas   •  ANOTACION  MANUAL   necesaria,  en  colaboración     •  APOLLO   avanzando  la  curación  en  colaboración     •  EJEMPLO   demonstraciones   •  EJERCICIOS  
  113. 113. Ejercicios  
  114. 114. Exercises Live  Demonstra(on  using  the  Apis  mellifera  genome.   115 1.  Evidence  in  support  of  protein  coding  gene   models.       1.1  Consensus  Gene  Sets:   Official  Gene  Set  v3.2   Official  Gene  Set  v1.0     1.2  Consensus  Gene  Sets  comparison:   OGSv3.2  genes  that  merge  OGSv1.0  and   RefSeq  genes   OGSv3.2  genes  that  split  OGSv1.0  and  RefSeq   genes     1.3  Protein  Coding  Gene  Predic=ons  Supported  by   Biological  Evidence:   NCBI  Gnomon   Fgenesh++  with  RNASeq  training  data   Fgenesh++  without  RNASeq  training  data   NCBI  RefSeq  Protein  Coding  Genes  and  Low  Quality   Protein  Coding  Genes   1.4  Ab  ini,o  protein  coding  gene  predic=ons:   Augustus  Set  12,  Augustus  Set  9,  Fgenesh,  GeneID,   N-­‐SCAN,  SGP2     1.5  Transcript  Sequence  Alignment:   NCBI  ESTs,  Apis  cerana  RNA-­‐Seq,  Forager  Bee  Brain   Illumina  Con(gs,  Nurse  Bee  Brain  Illumina  Con(gs,   Forager  RNA-­‐Seq  reads,  Nurse  RNA-­‐Seq  reads,   Abdomen  454  Con(gs,  Brain  and  Ovary  454   Con(gs,  Embryo  454  Con(gs,  Larvae  454  Con(gs,   Mixed  Antennae  454  Con(gs,  Ovary  454  Con(gs   Testes  454  Con(gs,  Forager  RNA-­‐Seq  HeatMap,   Forager  RNA-­‐Seq  XY  Plot,  Nurse  RNA-­‐Seq   HeatMap,  Nurse  RNA-­‐Seq  XY  Plot     Becoming Acquainted with Web Apollo.
  115. 115. Exercises Live  Demonstra(on  using  the  Apis  mellifera  genome.   116 1.  Evidence  in  support  of  protein  coding  gene   models  (Con=nued).     1.6  Protein  homolog  alignment:   Acep_OGSv1.2   Aech_OGSv3.8   Cflo_OGSv3.3   Dmel_r5.42   Hsal_OGSv3.3   Lhum_OGSv1.2   Nvit_OGSv1.2   Nvit_OGSv2.0   Pbar_OGSv1.2   Sinv_OGSv2.2.3   Znev_OGSv2.1   Metazoa_Swissprot       2.  Evidence  in  support  of  non  protein  coding  gene   models     2.1  Non-­‐protein  coding  gene  predic=ons:   NCBI  RefSeq  Noncoding  RNA   NCBI  RefSeq  miRNA     2.2  Pseudogene  predic=ons:   NCBI  RefSeq  Pseudogene   Becoming Acquainted with Web Apollo.
  116. 116. Instrucciones 117 | 117 APOLLO EN LA WEB
 instrucciones Servidor   URL   1  hAp://54.94.132.228:8080/apollo/annotator/index   2  hAp://54.94.132.228:8080/apollo/annotator/index   3  hAp://54.94.132.228:8080/apollo/annotator/index   4  hAp://54.94.132.228:8080/apollo/annotator/index   5  hAp://54.94.132.228:8080/apollo/annotator/index   Email:   nombre.apellido@example.com     Contraseña:   nombreapellido   Email   Contraseña   Servidor   Empezar  en   user.one@example.com   userone   1   1   user.two@example.com   usertwo   2   1   user.three@example.com   userthree   3   1   user.four@example.com   userfour   4   1   user.five@example.com   userfive   5   1   user.six@example.com   usersix   1   7   user.seven@example.com   userseven   2   7   user.eight@example.com   usereight   3   7   user.nine@example.com   usernine   4   7   user.ten@example.com   userten   5   7   user.eleven@example.com   usereleven   1   1   user.twelve@example.com   usertwelve   2   1   user.thirteen@example.com   userthirteen   3   1   user.fourteen@example.com   userfourteen   4   1   user.fioeen@example.com   userfioeen   5   1   user.sixteen@example.com   usersixteen   1   7   user.seventeen@example.com   userseventeen   2   7   user.eighAeen@example.com   usereighteen   3   7   user.nineteen@example.com   usernineteen   4   7   user.twenty@example.com   usertwenty   5   7   user.twentyone@example.com   usertwentyone   1   1   user.twentytwo@example.com   usertwentytwo   2   1   user.twentythree@example.com   usertwentythree   3   1   user.twentyfour@example.com   usertwentyfour   4   1   user.twentyfive@example.com   usertwentyfive   5   1   user.twentysix@example.com   usertwentysix   1   7   user.twentyseven@example.com   usertwentyseven   2   7   user.twentyeight@example.com   usertwentyeight   3   7   user.twentynine@example.com   usertwentynine   4   7  
  117. 117. Thank you. 118 •  Berkeley  Bioinforma=cs  Open-­‐source  Projects  (BBOP),   Berkeley  Lab:  Apollo  and  Gene  Ontology  teams.  Suzanna   E.  Lewis  (PI).   •  §  Chris1ne  G.  Elsik  (PI).  University  of  Missouri.     •  *  Ian  Holmes  (PI).  University  of  California  Berkeley.   •  Arthropod  genomics  community:  i5K  Steering   CommiAee  (esp.  Sue  Brown  (Kansas  State)),  Alexie   Papanicolaou  (UWS),  and  the  Honey  Bee  Genome   Sequencing  Consor(um.   •  Stephen  Ficklin  GenSAS  Washington  State  University   •  Apollo  is  supported  by  NIH  grants  5R01GM080203  from   NIGMS,  and  5R01HG004483  from  NHGRI.  Both  projects   are  also  supported  by  the  Director,  Office  of  Science,   Office  of  Basic  Energy  Sciences,  of  the  U.S.  Department   of  Energy  under  Contract  No.  DE-­‐AC02-­‐05CH11231   •      •  For  your  a"en=on,  thank  you!   Apollo   Nathan  Dunn   Colin  Diesh  §   Deepak  Unni  §       Gene  Ontology   Chris  Mungall   Seth  Carbon   Heiko  Dietze     BBOP   Apollo:  hAp://GenomeArchitect.org     GO:  hAp://GeneOntology.org   i5K:  hAp://arthropodgenomes.org/wiki/i5K   ¡Gracias!   NAL  at  USDA   Monica  Poelchau   Christopher  Childers   Gary  Moore   HGSC  at  BCM   fringy  Richards   Kim  Worley     JBrowse          Eric  Yao  *  

×