The European Commission for the Control of Foot-and-Mouth Disease (EuFMD), one of FAO’s oldest Commissions, came into being on the 12th June 1954, with the pledge of the sixth founding member state to the principles of a coordinated and common action against Foot-and-mouth Disease.
Covid19 : Economic Impact Assessment of Covid19 with help of CEICVikram Gade
The Covid19 outbreak and the epidemic situations prevailing thereafter are completely unforeseen and anticipated for. With use of high frequency Macroeconomic Indicators, we can attempt to assess the economic impact of Covid-19. Feel free to go though and give your feedback.
Impact of sporadic reporting of poultry Salmonella serovars from selected dev...Danielle Ayyash
This review documents the sporadic reporting of poultry Salmonella serovars in South Africa, Egypt, Indonesia, India, and Romania, five countries selected based on the importance of their distribution in different regions of the world and their cumulative significant population size of 1.6 billion.
Incidence and Impacts of Maize Lethal Necrosis Disease in EthiopiaCIMMYT
Incidence and impacts of MLN in Ethiopia, presented at the International Conference on “MLN Diagnostics and Management in Africa,” organized by AGRA (Alliance for Green Revolution in Africa) and CIMMYT, 12-14 May, 2015
Disease monitoring in wheat through remotely sensed dataCIMMYT
Remote sensing –Beyond images
Mexico 14-15 December 2013
The workshop was organized by CIMMYT Global Conservation Agriculture Program (GCAP) and funded by the Bill & Melinda Gates Foundation (BMGF), the Mexican Secretariat of Agriculture, Livestock, Rural Development, Fisheries and Food (SAGARPA), the International Maize and Wheat Improvement Center (CIMMYT), CGIAR Research Program on Maize, the Cereal System Initiative for South Asia (CSISA) and the Sustainable Modernization of the Traditional Agriculture (MasAgro)
The European Commission for the Control of Foot-and-Mouth Disease (EuFMD), one of FAO’s oldest Commissions, came into being on the 12th June 1954, with the pledge of the sixth founding member state to the principles of a coordinated and common action against Foot-and-mouth Disease.
Covid19 : Economic Impact Assessment of Covid19 with help of CEICVikram Gade
The Covid19 outbreak and the epidemic situations prevailing thereafter are completely unforeseen and anticipated for. With use of high frequency Macroeconomic Indicators, we can attempt to assess the economic impact of Covid-19. Feel free to go though and give your feedback.
Impact of sporadic reporting of poultry Salmonella serovars from selected dev...Danielle Ayyash
This review documents the sporadic reporting of poultry Salmonella serovars in South Africa, Egypt, Indonesia, India, and Romania, five countries selected based on the importance of their distribution in different regions of the world and their cumulative significant population size of 1.6 billion.
Incidence and Impacts of Maize Lethal Necrosis Disease in EthiopiaCIMMYT
Incidence and impacts of MLN in Ethiopia, presented at the International Conference on “MLN Diagnostics and Management in Africa,” organized by AGRA (Alliance for Green Revolution in Africa) and CIMMYT, 12-14 May, 2015
Disease monitoring in wheat through remotely sensed dataCIMMYT
Remote sensing –Beyond images
Mexico 14-15 December 2013
The workshop was organized by CIMMYT Global Conservation Agriculture Program (GCAP) and funded by the Bill & Melinda Gates Foundation (BMGF), the Mexican Secretariat of Agriculture, Livestock, Rural Development, Fisheries and Food (SAGARPA), the International Maize and Wheat Improvement Center (CIMMYT), CGIAR Research Program on Maize, the Cereal System Initiative for South Asia (CSISA) and the Sustainable Modernization of the Traditional Agriculture (MasAgro)
Uganda continues to suffer inadequate food security
Livestock plays a major role with cattle accounting for over 60% of the value of edible products in form of milk and meat
Although very gradual, Uganda continue to achieve increase in milk production
http://www.fao.org/ag/AGAInfo//programmes/en/empres/news_160916b.html
Foot and Mouth Disease in West Africa: What we know and what we don’t know, by the Pirbright Institute
D. King - Headline events from global FMD surveillance activities (2020-2022)EuFMD
Session I - FAST Update
The WOAH/FAO FMD Laboratory Network (https://www.foot-and-mouth.org/) was established in 2004 as a forum to exchange laboratory and epidemiology data for foot-and-mouth disease (FMD), as well as to harmonise and improve the quality of diagnostic testing carried out by international and national FMD laboratories. A key role of the Network is to monitor the spread of viral lineages that are maintained in the seven endemic pools distributed across the world, and continuously review the risks to livestock industries in countries that are free of FMD (with, or without vaccination). In addition to circulation of the pool-specific viruses, long-distance trans-pool movement of FMD viral lineages has been a common theme of recent reports generated by laboratories within the Network.
Presentation by Don King from The Pirbright institute to the 42nd General Ses...ExternalEvents
Presentation by by N.Bulut (Tur) to the 42nd General Session of the EuFMD, 20-21 April 2017
http://www.fao.org/ag/againfo/commissions/eufmd/commissions/eufmd-home/reports/general-sessions/en/
GS42 Item 2 Global FMD surveillance report, D.King, TPIExternalEvents
Presentation by Don King from The Pirbright institute to the 42nd General Session of the EuFMD, 20-21 April 2017
http://www.fao.org/ag/againfo/commissions/eufmd/commissions/eufmd-home/reports/general-sessions/en/
Epidemiology of peste des petits ruminants virus in West Africa: Is lineage ...ILRI
Presentation by Abel S. Biguezoton, Guy Ilboudo, Barbara Wieland, Rahinata Sawadogo, Firmin Dah, Adrien Zoungrana and Michel Dione at the Peste des petits ruminants Global Research and Expertise Network (PPR-GREN) meeting, Montpellier, France, 7–9 December 2022.
This was a prospective cross sectional hospital based study included 117 patients with a definitive history of snake bite and clinical features consistent with the pres¬ence of fang marks at the emergency department, Gadarif Hospital, Eastern Sudan from 1st January 2015 to 1st January 2016 to identify the epidemiological factors of snake bite. The majority of these 117 patients were adult (86.3%) and male gender constituted 85.4%. Most of the patients were of rural residence (65.8%) and were involved in farming related activities (68.3%). A relatively high proportion of snake bite episodes happened in the afternoon times (53.9%) and half of the cases were reported during August (18%) and November. (12.8%). Lower limbs were involved in maximum number of the cases (83.7%). The reported systemic reaction included: swelling (100%), sweating (100%), hypotension (54.7%), nausea (51.%), vomiting (47.8%), local bleeding (13.6%), hymoptysis (1.7%) and neurotoxic symptoms (0.8%). In this study, there were ten (8.5%) deaths; 7 had grade 3 and the other three patients had grade 4 envenomation. In conclusion Snake bites is a real medical threat in Eastern Sudan; thus, it is very important to educate the native people to increase awareness about the risk of snake bites in particular among male, farmers and during the period from August to November.
ASSESSMENT OF FMD VACCINES IN MONGOLIA AND THE ROLE OF BACTRIAN CAMELS (Ulzii...EuFMD
The European Commission for the Control of Foot-and-Mouth Disease (EuFMD), one of FAO’s oldest Commissions, came into being on the 12th June 1954, with the pledge of the sixth founding member state to the principles of a coordinated and common action against foot-and-mouth disease.
The Open Session of the EuFMD, was held during 29-31 October in Borgo Egnazia, Puglia, Italy. The event was held on the theme of 'vaccine security.'
Foot and mouth disease preventive and epidemiological aspectsBhoj Raj Singh
FMD: Menace in India
Discusses problems of FMD Control in India like:
Lack of faith in farmers and veterinarians that FMD can be controlled with vaccination (due to repeated failure of vaccines in quality and vaccination failures resulting in FMD outbreaks).
Lack of infrastructure facilities for maintaining the cold chain and efficient transport to the vaccination site.
Lack of human resources for handling/ vaccinating livestock.
Needs for further researches on diagnosis (Pen-side), disinfection, vaccines and vaccination (affording at least a year immunity, quality vaccine etc.) and control strategies.
No-timely investigation or excessively delayed investigation of FMD outbreaks especially those occurring after vaccination.
Transparency in vaccine quality monitoring and vaccine purchases.
Fear in veterinarians for reporting FMD in their area of operation.
False statistics of the disease and vaccination.
No legal punitive action against suppliers of substandard FMD vaccines even after the supply of multiple substandard batches of vaccine.
Recent Advances in Diagnosis of Foot-and-Mouth DiseasePervaiz Dar
The Lecture was delivered during the training program organised by State Agriculture Management and Extension Training Institute (SAMETI) and SKUAST-Kashmir
Malaria history in Sri Lanka has many milestones. There was a period when thousands of people died due to malaria. At that time, Sri Lanka started official malaria control program and achieved almost eradication in 1960.
Uganda continues to suffer inadequate food security
Livestock plays a major role with cattle accounting for over 60% of the value of edible products in form of milk and meat
Although very gradual, Uganda continue to achieve increase in milk production
http://www.fao.org/ag/AGAInfo//programmes/en/empres/news_160916b.html
Foot and Mouth Disease in West Africa: What we know and what we don’t know, by the Pirbright Institute
D. King - Headline events from global FMD surveillance activities (2020-2022)EuFMD
Session I - FAST Update
The WOAH/FAO FMD Laboratory Network (https://www.foot-and-mouth.org/) was established in 2004 as a forum to exchange laboratory and epidemiology data for foot-and-mouth disease (FMD), as well as to harmonise and improve the quality of diagnostic testing carried out by international and national FMD laboratories. A key role of the Network is to monitor the spread of viral lineages that are maintained in the seven endemic pools distributed across the world, and continuously review the risks to livestock industries in countries that are free of FMD (with, or without vaccination). In addition to circulation of the pool-specific viruses, long-distance trans-pool movement of FMD viral lineages has been a common theme of recent reports generated by laboratories within the Network.
Presentation by Don King from The Pirbright institute to the 42nd General Ses...ExternalEvents
Presentation by by N.Bulut (Tur) to the 42nd General Session of the EuFMD, 20-21 April 2017
http://www.fao.org/ag/againfo/commissions/eufmd/commissions/eufmd-home/reports/general-sessions/en/
GS42 Item 2 Global FMD surveillance report, D.King, TPIExternalEvents
Presentation by Don King from The Pirbright institute to the 42nd General Session of the EuFMD, 20-21 April 2017
http://www.fao.org/ag/againfo/commissions/eufmd/commissions/eufmd-home/reports/general-sessions/en/
Epidemiology of peste des petits ruminants virus in West Africa: Is lineage ...ILRI
Presentation by Abel S. Biguezoton, Guy Ilboudo, Barbara Wieland, Rahinata Sawadogo, Firmin Dah, Adrien Zoungrana and Michel Dione at the Peste des petits ruminants Global Research and Expertise Network (PPR-GREN) meeting, Montpellier, France, 7–9 December 2022.
This was a prospective cross sectional hospital based study included 117 patients with a definitive history of snake bite and clinical features consistent with the pres¬ence of fang marks at the emergency department, Gadarif Hospital, Eastern Sudan from 1st January 2015 to 1st January 2016 to identify the epidemiological factors of snake bite. The majority of these 117 patients were adult (86.3%) and male gender constituted 85.4%. Most of the patients were of rural residence (65.8%) and were involved in farming related activities (68.3%). A relatively high proportion of snake bite episodes happened in the afternoon times (53.9%) and half of the cases were reported during August (18%) and November. (12.8%). Lower limbs were involved in maximum number of the cases (83.7%). The reported systemic reaction included: swelling (100%), sweating (100%), hypotension (54.7%), nausea (51.%), vomiting (47.8%), local bleeding (13.6%), hymoptysis (1.7%) and neurotoxic symptoms (0.8%). In this study, there were ten (8.5%) deaths; 7 had grade 3 and the other three patients had grade 4 envenomation. In conclusion Snake bites is a real medical threat in Eastern Sudan; thus, it is very important to educate the native people to increase awareness about the risk of snake bites in particular among male, farmers and during the period from August to November.
ASSESSMENT OF FMD VACCINES IN MONGOLIA AND THE ROLE OF BACTRIAN CAMELS (Ulzii...EuFMD
The European Commission for the Control of Foot-and-Mouth Disease (EuFMD), one of FAO’s oldest Commissions, came into being on the 12th June 1954, with the pledge of the sixth founding member state to the principles of a coordinated and common action against foot-and-mouth disease.
The Open Session of the EuFMD, was held during 29-31 October in Borgo Egnazia, Puglia, Italy. The event was held on the theme of 'vaccine security.'
Foot and mouth disease preventive and epidemiological aspectsBhoj Raj Singh
FMD: Menace in India
Discusses problems of FMD Control in India like:
Lack of faith in farmers and veterinarians that FMD can be controlled with vaccination (due to repeated failure of vaccines in quality and vaccination failures resulting in FMD outbreaks).
Lack of infrastructure facilities for maintaining the cold chain and efficient transport to the vaccination site.
Lack of human resources for handling/ vaccinating livestock.
Needs for further researches on diagnosis (Pen-side), disinfection, vaccines and vaccination (affording at least a year immunity, quality vaccine etc.) and control strategies.
No-timely investigation or excessively delayed investigation of FMD outbreaks especially those occurring after vaccination.
Transparency in vaccine quality monitoring and vaccine purchases.
Fear in veterinarians for reporting FMD in their area of operation.
False statistics of the disease and vaccination.
No legal punitive action against suppliers of substandard FMD vaccines even after the supply of multiple substandard batches of vaccine.
Recent Advances in Diagnosis of Foot-and-Mouth DiseasePervaiz Dar
The Lecture was delivered during the training program organised by State Agriculture Management and Extension Training Institute (SAMETI) and SKUAST-Kashmir
Malaria history in Sri Lanka has many milestones. There was a period when thousands of people died due to malaria. At that time, Sri Lanka started official malaria control program and achieved almost eradication in 1960.
Three months after the start of the COVID-19 pandemic in Wuhan (China), the African response could be labelled as impressive. Many lessons were learnt by African countries from Ebola epidemic which hit West Africa (2014-2016). Industrial resiliency (mask production at scale), Technological innovations (PCR test local production, machine learning and robotics) and Genomic Prowess (Genome sequence of COVID-19 virus) ; all showed Africa is ready to be part of the global solution to COVID-19. Yet, only 3 clinical trials for vaccine and medicine against the virus were ongoing across the continent at the time of this presentation. The presentation also discusses some of the public health and industrial strategies to build even more resiliency in the continent beyond the pandemic.
In light of the global health crisis, Imperial College Healthcare Club to host the second webinar discussion around Africa’s healthcare system resilience to COVID-19. We are honored to be joined by Dr. Kaouthar Lbiati, who are both currently working on the continent’s response to the pandemic.The event will be a discussion, where the speakers will be presenting their work as well as their views and perspectives around the Healthcare crisis in Africa.
The webinar will focus on :
1. How the healthcare actors based in Africa have been crucial in responding to the pandemic.
3. How the long-term consequences of this crisis can bring major changes in Africa.
Kaouthar Lbiati (MD, MSc) will be emphasising on the wider scope of the healthcare policy & industry and explore the strategies on both that Africa as a continent could
establish to build resilience.
Mapping the risk of Rift Valley fever in UgandaILRI
Poster by Dan Tumusiime, Simon Kihu, Edna Mutua and Bernard Bett presented at a Biological Threat Reduction Program science program review meeting, Warsaw, Poland, 17–20 September 2019.
A brief information about the SCOP protein database used in bioinformatics.
The Structural Classification of Proteins (SCOP) database is a comprehensive and authoritative resource for the structural and evolutionary relationships of proteins. It provides a detailed and curated classification of protein structures, grouping them into families, superfamilies, and folds based on their structural and sequence similarities.
Introduction:
RNA interference (RNAi) or Post-Transcriptional Gene Silencing (PTGS) is an important biological process for modulating eukaryotic gene expression.
It is highly conserved process of posttranscriptional gene silencing by which double stranded RNA (dsRNA) causes sequence-specific degradation of mRNA sequences.
dsRNA-induced gene silencing (RNAi) is reported in a wide range of eukaryotes ranging from worms, insects, mammals and plants.
This process mediates resistance to both endogenous parasitic and exogenous pathogenic nucleic acids, and regulates the expression of protein-coding genes.
What are small ncRNAs?
micro RNA (miRNA)
short interfering RNA (siRNA)
Properties of small non-coding RNA:
Involved in silencing mRNA transcripts.
Called “small” because they are usually only about 21-24 nucleotides long.
Synthesized by first cutting up longer precursor sequences (like the 61nt one that Lee discovered).
Silence an mRNA by base pairing with some sequence on the mRNA.
Discovery of siRNA?
The first small RNA:
In 1993 Rosalind Lee (Victor Ambros lab) was studying a non- coding gene in C. elegans, lin-4, that was involved in silencing of another gene, lin-14, at the appropriate time in the
development of the worm C. elegans.
Two small transcripts of lin-4 (22nt and 61nt) were found to be complementary to a sequence in the 3' UTR of lin-14.
Because lin-4 encoded no protein, she deduced that it must be these transcripts that are causing the silencing by RNA-RNA interactions.
Types of RNAi ( non coding RNA)
MiRNA
Length (23-25 nt)
Trans acting
Binds with target MRNA in mismatch
Translation inhibition
Si RNA
Length 21 nt.
Cis acting
Bind with target Mrna in perfect complementary sequence
Piwi-RNA
Length ; 25 to 36 nt.
Expressed in Germ Cells
Regulates trnasposomes activity
MECHANISM OF RNAI:
First the double-stranded RNA teams up with a protein complex named Dicer, which cuts the long RNA into short pieces.
Then another protein complex called RISC (RNA-induced silencing complex) discards one of the two RNA strands.
The RISC-docked, single-stranded RNA then pairs with the homologous mRNA and destroys it.
THE RISC COMPLEX:
RISC is large(>500kD) RNA multi- protein Binding complex which triggers MRNA degradation in response to MRNA
Unwinding of double stranded Si RNA by ATP independent Helicase
Active component of RISC is Ago proteins( ENDONUCLEASE) which cleave target MRNA.
DICER: endonuclease (RNase Family III)
Argonaute: Central Component of the RNA-Induced Silencing Complex (RISC)
One strand of the dsRNA produced by Dicer is retained in the RISC complex in association with Argonaute
ARGONAUTE PROTEIN :
1.PAZ(PIWI/Argonaute/ Zwille)- Recognition of target MRNA
2.PIWI (p-element induced wimpy Testis)- breaks Phosphodiester bond of mRNA.)RNAse H activity.
MiRNA:
The Double-stranded RNAs are naturally produced in eukaryotic cells during development, and they have a key role in regulating gene expression .
(May 29th, 2024) Advancements in Intravital Microscopy- Insights for Preclini...Scintica Instrumentation
Intravital microscopy (IVM) is a powerful tool utilized to study cellular behavior over time and space in vivo. Much of our understanding of cell biology has been accomplished using various in vitro and ex vivo methods; however, these studies do not necessarily reflect the natural dynamics of biological processes. Unlike traditional cell culture or fixed tissue imaging, IVM allows for the ultra-fast high-resolution imaging of cellular processes over time and space and were studied in its natural environment. Real-time visualization of biological processes in the context of an intact organism helps maintain physiological relevance and provide insights into the progression of disease, response to treatments or developmental processes.
In this webinar we give an overview of advanced applications of the IVM system in preclinical research. IVIM technology is a provider of all-in-one intravital microscopy systems and solutions optimized for in vivo imaging of live animal models at sub-micron resolution. The system’s unique features and user-friendly software enables researchers to probe fast dynamic biological processes such as immune cell tracking, cell-cell interaction as well as vascularization and tumor metastasis with exceptional detail. This webinar will also give an overview of IVM being utilized in drug development, offering a view into the intricate interaction between drugs/nanoparticles and tissues in vivo and allows for the evaluation of therapeutic intervention in a variety of tissues and organs. This interdisciplinary collaboration continues to drive the advancements of novel therapeutic strategies.
Deep Behavioral Phenotyping in Systems Neuroscience for Functional Atlasing a...Ana Luísa Pinho
Functional Magnetic Resonance Imaging (fMRI) provides means to characterize brain activations in response to behavior. However, cognitive neuroscience has been limited to group-level effects referring to the performance of specific tasks. To obtain the functional profile of elementary cognitive mechanisms, the combination of brain responses to many tasks is required. Yet, to date, both structural atlases and parcellation-based activations do not fully account for cognitive function and still present several limitations. Further, they do not adapt overall to individual characteristics. In this talk, I will give an account of deep-behavioral phenotyping strategies, namely data-driven methods in large task-fMRI datasets, to optimize functional brain-data collection and improve inference of effects-of-interest related to mental processes. Key to this approach is the employment of fast multi-functional paradigms rich on features that can be well parametrized and, consequently, facilitate the creation of psycho-physiological constructs to be modelled with imaging data. Particular emphasis will be given to music stimuli when studying high-order cognitive mechanisms, due to their ecological nature and quality to enable complex behavior compounded by discrete entities. I will also discuss how deep-behavioral phenotyping and individualized models applied to neuroimaging data can better account for the subject-specific organization of domain-general cognitive systems in the human brain. Finally, the accumulation of functional brain signatures brings the possibility to clarify relationships among tasks and create a univocal link between brain systems and mental functions through: (1) the development of ontologies proposing an organization of cognitive processes; and (2) brain-network taxonomies describing functional specialization. To this end, tools to improve commensurability in cognitive science are necessary, such as public repositories, ontology-based platforms and automated meta-analysis tools. I will thus discuss some brain-atlasing resources currently under development, and their applicability in cognitive as well as clinical neuroscience.
Seminar of U.V. Spectroscopy by SAMIR PANDASAMIR PANDA
Spectroscopy is a branch of science dealing the study of interaction of electromagnetic radiation with matter.
Ultraviolet-visible spectroscopy refers to absorption spectroscopy or reflect spectroscopy in the UV-VIS spectral region.
Ultraviolet-visible spectroscopy is an analytical method that can measure the amount of light received by the analyte.
Observation of Io’s Resurfacing via Plume Deposition Using Ground-based Adapt...Sérgio Sacani
Since volcanic activity was first discovered on Io from Voyager images in 1979, changes
on Io’s surface have been monitored from both spacecraft and ground-based telescopes.
Here, we present the highest spatial resolution images of Io ever obtained from a groundbased telescope. These images, acquired by the SHARK-VIS instrument on the Large
Binocular Telescope, show evidence of a major resurfacing event on Io’s trailing hemisphere. When compared to the most recent spacecraft images, the SHARK-VIS images
show that a plume deposit from a powerful eruption at Pillan Patera has covered part
of the long-lived Pele plume deposit. Although this type of resurfacing event may be common on Io, few have been detected due to the rarity of spacecraft visits and the previously low spatial resolution available from Earth-based telescopes. The SHARK-VIS instrument ushers in a new era of high resolution imaging of Io’s surface using adaptive
optics at visible wavelengths.
Professional air quality monitoring systems provide immediate, on-site data for analysis, compliance, and decision-making.
Monitor common gases, weather parameters, particulates.
Richard's aventures in two entangled wonderlandsRichard Gill
Since the loophole-free Bell experiments of 2020 and the Nobel prizes in physics of 2022, critics of Bell's work have retreated to the fortress of super-determinism. Now, super-determinism is a derogatory word - it just means "determinism". Palmer, Hance and Hossenfelder argue that quantum mechanics and determinism are not incompatible, using a sophisticated mathematical construction based on a subtle thinning of allowed states and measurements in quantum mechanics, such that what is left appears to make Bell's argument fail, without altering the empirical predictions of quantum mechanics. I think however that it is a smoke screen, and the slogan "lost in math" comes to my mind. I will discuss some other recent disproofs of Bell's theorem using the language of causality based on causal graphs. Causal thinking is also central to law and justice. I will mention surprising connections to my work on serial killer nurse cases, in particular the Dutch case of Lucia de Berk and the current UK case of Lucy Letby.
OS18 - 1.2 Global Status Report for FMD: Tracking the Emergence and Spread of new viral lineages - D. King
1. FMD Reference Laboratory
Global Status Report for FMD:
Tracking the emergence and spread of new viral lineages
Donald King
Acknowledgements: Valerie Mioulet, Nick Knowles, Anna Ludi, Ginette Wilsden,
Mehreen Azhar, Hannah Baker, Kasia Bachanek-Bankowska, Antonello Di Nardo,
Bob Statham, Lissie Henry, Jemma Wadsworth, Clare Browning, Britta Wood,
Alison Morris, David Paton, Abid Bin-Tarif, Ashley Gray, Beth Johns, Mark Henstock,
Nick Lyons, Dexter Wiseman, Julie Maryan, Sarah Belgrave
2. Seven endemic pools
• Maintain specific FMD virus strains
• Control via (tailored) vaccination and supporting diagnostics
• No reported serotype C outbreaks since 2004 (Kenya and Brazil)
Conjectured global status
3. • Global surveillance and
changing patterns in risk
• Harmonised and improved lab
capacity
• MoU now signed by all “core
members”
• Meeting and annual reports
available:
http://www.foot-and-mouth.org/
Pretoria– November 2017
Core Network Members and affiliates:
1.2 Reporting Period
1st January 2016 - 31st December 2016
1.3 Collated input from
Figure 1-1: Participating laboratories
OIE Reference Laboratory for Foot and
Mouth Disease, Dirección de Laboratorio
Animal
SENASA, Argentina
OIE collaborating centre for validation,
quality assessment and quality control of
diagnostic assays and vaccine testing for
vesicular diseases in Europe, and FAO
Reference Centre for vesicular Diseases
CODA-CERVA, Ukkel, Belgium
OIE Regional Reference Laboratory for
Sub-Saharan Africa (RRLSSA)
BVI, Gabarone, Botswana
Centro Panamericano de Fiebre Aftosa
(PANAFTOSA) and OIE Reference
Laboratory for FMD
Rio de Janeiro, Brazil
FAO FMD Reference Laboratory
National Centre for Foreign Animal Disease National
Centres for Animal Disease, Canadian Food
Inspection Agency, Winnipeg, Manitoba, Canada
OIE and China National FMD Reference
Laboratory
Lanzhou Veterinary Research Institute (LVRI),
CAAS, Gansu, People’s Republic of China
OIE FMD Reference Laboratory
French Agency for Food and, Environmental and
Occupational Health & Safety (ANSES), Maisons-
Alfort, Paris, France
FAO Reference Centre for FMD in South
Asia
Project Directorate on FMD (PDFMD), Indian
Council for Agricultural Research, Mukteswar,
Nainital (Uttarakhand), India
OIE/FAO FMD Reference Laboratory
Istituto Zooprofilattico Sperimentale della Lombardia
e dell'Emilia Romagna (IZSLER), Italy
OIE Reference laboratory for Foot and
Mouth Disease
Animal and Plant Quarantine Agency (QIA), Anyang
city, Gyeonggi-do, Republic of Korea
OIE/FAO FMD Laboratory Network
4. Global surveillance
via the OIE/FAO FMD Laboratory Network
• Since 2014 >2000 virological samples tested per year
• High proportion of samples that are ”no virus detected [NVD]”
• Gaps in surveillance remain in West/Central (and East Africa)
• Review geographical distribution and spread of transboundary
FMDV lineages
• new way to highlight future risks Ind-2001d PanAsia
PanAsia-2 Mya-98
EA-3 Conjectured distribution of important
serotype O FMDV lineages. The extent of
current distribution for each of the viral
lineages is represented within the black
lines, while the location of individual
outbreaks (dots) and affected countries
(shaded in red, according to dates) are
shown. NB: Arrows are drawn to highlight
the regions that are threatened by these
lineages
2017 data:
OA
NVD
FMDV serotypes detected
6. • Two sub-lineages (d and e)
• Since 2013, full genomic sequence data
indicates that there have been multiple
“escapes” from Pool 2
O/ME-SA/Ind-2001: a new pandemic lineage?
Libya
(2013)
Tunisia
Algeria
Morocco
Mauritius
(2016)
Pool 2
Saudi Arabia (2015)
UAE (2015)
Jordan (2017)
Vietnam (2016)
Thailand (2016)
Myanmar (2017)
China (2017)
Russia (2016)
Mongolia (2015/17)
South Korea (2017)
Malaysia (2018)
Saudi Arabia (2016) Myanmar (2015)
Myanmar (2017)
Saudi Arabia (2013)
Sri Lanka
(2014/13)
UAE (2014)
Bahrain (2015x2) Vietnam (2015)
Laos (2015)
d
e
(Bachanek-Bankowska et al., 2018)
7. Spread of A/ASIA/G-VII:
(Bachanek-Bankowska et al., 2018)
Pool 2
Saudi Arabia
Turkey
Iran
Armenia
Israel
• Emerged in 2015 from
Pool 2
• Rapid spread into parts
of West Eurasia (most
recently Israel in 2017)
• Poor in vitro and in vivo
responses for vaccines
that are used in West
Eurasia
• Gap in the coverage of
vaccines have led to the
development of new
tailored vaccine strains
A/SAU/1/2015
A/SAU/2/2015
A/IRN/8/2015
A/IRN/12/2015
A/IRN/25/2015
A-Iran-05 0 0 0 0 0
A-Tur-20-06 0.03 0.06 0.01 0.15 0.01
A-22 0.11 0.11 0.13 nd 0
A-Iran-87 0 0.04 nd nd nd
A-Iran-96 0.04 0.06 nd nd nd
A-Iran-99 0.01 0.01 nd nd nd
A-Sau-95* 0.20 0.19 0.26 0.16 nd
A-May-97 0.14 0.23 0.15 0.23 nd
A-Tur-11 0.01 nd 0.10 0.04 nd
A-Tur-14 0 nd 0 0 nd
A-IND-40-2000* 0.26 nd 0.03 0.24 nd
r-values:
Vaccines
8. Pool 2 Myanmar
IND285(640)/2012*
IND/285/2012*100
IND131(255)/2012*
IND157(336)/2013*
IND403(826)/2012*
BD SI 2 2013*
IND/292/2012*
IND/294/2012*
IND413(852)/2012*
IND400(822)/2012*
86IND120(225)/2012*
IND/120/2012*
IND/121/2012*
IND/16/2012*
IND119(223)/2012*
IND118(222)/2012*
IND15(24)/2012*
IND/118/2012*
IND/283/2012*
IND/305/2012*
IND156(335)/2013*
IND/115/2012*
IND/119/2012*
IND119(224)/2012*
IND114(214)/2012*
IND/114/2012*
IND300(655)/2012*
IND/300/2012*
IND115(217)/2012*
IND/306/2012*
IND288(643)/2012*
88IND411(846)/2012*
IND411(845)/2012*
IND/288/2012*
IND/291/2012*
IND163(334)/2012*
IND163(333)/2012*
IND162(331)/2012*
IND109(208)/2012*
86 IND/303/2012*
IND303(658)/2012*
BAN GA Sr-187 2013*
MYA/14/2017*93
90
• Serotype Asia 1 not reported in
Southeast Asia since 2006/7(?)
• February 2017: FMD outbreaks
in cattle in Myanmar
• Sequence data from RRL-SEA in
Pakchong, Thailand
• New introduction of the virus
from Pool 2
Onward risks?
SEACFMD – 2017:
• ~500,000 head/year move from
Mynamar into Yunnan Province
of PR China
• 5% infected with FMDV
SEA: New outbreaks of Serotype Asia 1
9. Analyses of samples from Nepal
Highlights gaps in regional/National surveillance?
Serotype O:
~94% identity with closest VP1 sequences
Serotype Asia 1:
~91% identity with closest VP1 sequences
How do we interpret
these trees?
1. Rapid evolutionary
change
2. Un-sampled cases
10. Pool 1
Pool 2
Pool 3
Pool 4
Pool 6
Pool 5
Pool 7
FMD outbreaks in North Africa
North Africa
No FMD outbreaks 1999-2013
Near East
Serotype O/SAT 2
Serotype A
Previous SAT 2 outbreaks in Egypt/Libya/Palestine 2012
11. March – April 2017: FMD cases in Algeria and Tunisia
• >100 outbreaks in cattle
• Due to a new FMD virus strain for
the region (A/AFRICA/G-IV)
• Sequences from Algeria (March) and
Tunisia (April) >99% identity
• Most closely related to FMD viruses
from Nigeria
• First cases of Serotype A in the
Maghreb > 30 years
• Algeria 1977
• Tunisia 1984
• in-vitro vaccine matching data for
provides candidates vaccines that
now need testing
VACCINE STRAINS
A/ERI/3/98 A/TUR/20/06 A22/IRQ/64 A/IRN/05
ALG/2/2017 0.41 0.00 0.31 0.00
ALG/3/2017 0.32 0.00 0.32 0.00
12. • Due to the O/EA-3 topotype
• >50 outbreaks
• >99% nt identity to sequences from
Guinea (generated by for
samples collected in July 2018)
• July-September 2018: Reports to OIE of
FMD outbreaks elsewhere in West Africa
(The Gambia, Guinea-Bissau, and Sierra
Leone { + Burkina Faso and Senegal -not
reported to OIE})
• Are these cases linked? – and do they
represent the likely origins of the viruses
that help us understand how FMDV has
recently spread into North Africa?
June 2018: FMD cases in Algeria
13. • Sequences from West
Africa/Algeria are
different to Egypt/
Palestine/Israel
• Western-clade most
similar to sequences
from Nigeria
• Similar picture to
A/AFRICA/G-IV
Different O/EA-3 sub-lineages in Africa
Cameroon 2016
O/CAR/G4258/2013* (KY581680)
O/CAR/G4260/2013* (KY581679)
Nigeria 2014
O/GNA/18Z005582/18* (ANSES)
O/GNA/18Z005587/18* (ANSES)
O/GNA/18Z005583/18* (ANSES)
O/ALG/2/2018
O/ALG/1/2018
O/GNA/18Z005588/18* (ANSES)
Nigeria 2016
O/NIG/1/2007 (KX258020)
O/SUD/1/2005 (GU566056)
O/SUD/3/2005 (GU566058)
Egypt / Palestine / Israel 2017
O/SUD/2/86 (DQ165075)
O/ETH/2/2006 (FJ798127)
O/ETH/3/2004 (FJ798109)
O/ETH/1/2007 (FJ798137)
“East
Africa”
Clade
“West
Africa”
Clade
15. 2017/18 FMD situation – ”headlines”
Colombia
Serotype O
East Asia
Serotype O
Myanmar
Serotype Asia 1
Algeria (Tunisia)
Serotype A
Serotype O
Near East
Serotype O (O/EA-3)
Serotype A (A/ASIA/G-VII)
Serotype SAT 2
Russia
Serotype O
Zambia
Serotype O
South Korea
Serotypes O/A
Pakistan
Serotype O
16. Selecting vaccines to cover risk?
European Perspective
2010-2011
• Outbreaks in Bulgaria
• FMD-free buffer zone
in Turkish Thrace
• Outbreaks in UK in 2001
• Increased FMD circulation
in East Asia
%oftotalrisk
NRL Workshop for FMD – Ascot, UK - May 2016
• New FMD lineages in North
Africa
• Outbreaks in FMD-free
countries
17. Vaccine Antigen Prioritisation: Europe
SELECTING VACCINES
September 2018
NB: Analyses uses best available data, however there are gaps in surveillance and vaccine coverage data
Insufficient Data: C3 Oberbayern [LOW];
SAT2 SAU [HIGH];
SAT3 ZIM 2/83 [LOW]
Risk Profile:
O-TUR/5/2009 [HIGH]
O-3039 [HIGH]
O1-Manisa [HIGH]
O1-Campos [HIGH]
O-BFS/1860 [LOW]
O-SKR/7/2010 [LOW]
O-TAW/98 [↓ LOW]
A-TUR/2006 [HIGH]
A22 Iraq [HIGH]
A-Iran-05 [HIGH]
A-Malaysia 97 [↑ HIGH]
A-Eritrea [MEDIUM]
A-SAU 95 [LOW]
A24 Cruzeiro [↓LOW]
Asia1-Shamir [HIGH]
SAT2 Eritrea 3218 [HIGH]
SAT2-ZIM [MEDIUM]
SAT-1 Rho/78 [MEDIUM]
Vaccine Coverage:
DEFINING RISK
O/ME-SA/Ind2001A/ASIA/G-VII
40%
0%
Regional risks:
Viral
lineages:
18. FMDV vaccines: evidence gaps
Particularly for Africa (from OIE/FAO and EALN-FMD Network Meetings)
[1] in vivo potency tests are rarely done,
particularly those that define cross-
protective responses
[2] Immunogenicity studies for monovalent
(or multivalent vaccines) are rarely
reported
[3] Reference reagents (such as validated
BVS) from vaccines suppliers are not
readily available to the Reference
laboratory community
[4] Not clear that batch serological testing
data is always supplied
[5] Studies that assess vaccine performance
under field conditions are often lacking
19. Production batches
(Batch control)
Formulated product
(Customer requirements)
Licensed vaccine
(Registration)
• Biosecurity and containment
procedures
• GMP and in process controls
• MSV records
• Homologous potency testing in
cattle
• Sterility, adventitious agent and
inocuity testing
• Purity and safety testing
• Stability and duration of immunity
• Confirmation of MSV identity
• Sterility and inocuity tests
• Safety test
• Indirect potency test
• Monitoring of long-term storage
conditions
• Verification of Ag integrity of
batch
• Confirmation of batch identity
• Purity testing
• Defining/validating heterologous
correlates (cattle and other
species)
• Batch testing to generate sera
• Confirmation that batch sera
passes threshold heterologous
responses
• Field studies of post-vaccination
responses
• Vaccination coverage and
outcomes
• Investigation of vaccine failure
• Selection of reference viruses
(to cover regional risks)
• Generation of reference BVS
• Application of in vitro vaccine
matching tests
• Development of harmonised
test formats
• In vivo studies (where required)
• Identification of vaccine gaps
• Tender requirements
• Shelf life
• Antigenic relevance
• Potency
• Purity
• Duration of immunity
• Correlate of immunity
threshold
• Verification /calibration studies
Vx Producers (with audit at registration/purchase)
AU-PANVAC (with assistance from WRLFMD)
Vx producer (with supervision/audit by AU-PANVAC) – or AU-PANVAC
Customer (with support from FMD Reference labs/AU-PANVAC – where needed)
OIE/FAO FMD Lab Network
KEY
VACCINATION PLAN
VaccineQA/QC
Homologousprotection
Vaccineperformance
Heterologous(field)protection
FMDV vaccine QA/QC pipeline for Africa
Defining responsibilities:
20. • Epidemiology of FMD is very dynamic
• New unpredictable patterns in Asia (East and West)
and North Africa
• Threats to FMD-free countries in Europe and
Turkish Thrace
• Sampling of field outbreaks is critical
• Importance of an active FMD Reference
Laboratory Network to facilitate sample
collection from FMD outbreaks in the field– to
feed real-time lab data back to FMD control
programmes
• Impact upon selection and deployment of
vaccines
Talk summary
21. Upcoming events….
• 60th Symposium and celebration on 5th-6th November 2018
• Previous anniversary events……
• OIE/FAO FMD Laboratory Network Meeting @ Pirbright - 7th-8th
November 2018
• E-learning course on FMD Diagnostics – Jan/Feb 2019
• Practical training course on FMD diagnostics for East Africa – Jan 2019
Royal Society, London, 2008John Brooksby (first head of WRLFMD), Pirbright, 1998
40 years 50 years
22. Acknowledgements
• Support for the WRLFMD
and research projects
• Collaborating FMD
Reference Laboratories
and field teams
• Partners within the
OIE/FAO FMD Lab
Network
23.
24. New FMD outbreaks in Republic of Korea
A/Iran-05
A/May97
ATUR20/06
A/G-VII
A22
A24(1)
A24(2)SKR/5/2008 0.45 0.12 0 0.47 0.43 0.19 0.35
1PANAFTOSA BVS
2BI BVS
• March 2018: Two FMD outbreaks in pigs due
to A/ASIA/Sea-97
• 2017: One outbreak due to A/ASIA/Sea-97
• 2017: Eight outbreaks due to O/ME-SA/Ind-
2001
• Samples tested at QIA and WRLFMD
• Represent new introductions of FMD into
South Korea from an East/Southeast Asian
country?
• Vaccine matching:
• 2018: 24 FMD outbreaks reported to OIE in
DPR Korea (serotype O - tbc)
25. • 5 FMD outbreaks reported in
Bashkortostan (in the FMD-free zone
without vaccination)
• Reported cases in cattle, sheep and
goats
• New FMDV lineage in ME-SA topotype
(not PanAsia or PanAsia-2)
• Most closely related to FMD viruses in
Pakistan and Iran (2014)
• Reporting of cases in “central Asia”?
O/ME-SA lineage in Russia
October 2017
26. • Two isolates in a new genetic clade
within O/ME-SA/PanAsia-2ANT-10
• Discrete from other ANT-10 viruses
• Collected in Punjab, Pakistan
(2016/17) from cattle and water
buffalo
• No neutralization in VNT with BVS for
O-Manisa, O-3039 or O-TUR-5-09
• New antigenic variant?
• Spread of this lineage needs to be
closely monitored – esp. wrt evidence
of vaccine failure in the field
Poor Ag-match for serotype O viruses from Pakistan
27. 10 20 30 40 50 60 70 80
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
Ag site 3
O/PAK/14/2017 TTSAGESSDPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLVGALLRTATYYFADLEVAV
O/PAK/10/2016 .......A....T...................................................................
O/PAK/4/2017 .......A........................................................................
90 100 110 120 130 140 150 160
....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|
Ag site 1
O/PAK/14/2017 KHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGNCKYGESHVPNVRGDLQVLAQKAARALP
O/PAK/10/2016 ....D..........T.............................................T..................
O/PAK/4/2017 ....D..........T........................................S....T...............T..
170 180 190 200 210
....|....|....|....|....|....|....|....|....|....|...
Ag site 1
O/PAK/14/2017 TSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPDAARHKQKIVAPVKQLL
O/PAK/10/2016 .................................V..NE...............
O/PAK/4/2017 ....................................NE...............
• VP1
• Complete genome sequences will also be determined using the Illumina MiSeq
Known type O
antigenically important
residues are underlined
Vaccine matching O 3039 O Manisa O TUR/5/2009
O/PAK/14/2017 0.62 0.32 0.48
O/PAK/10/2016 0 0 0
O/PAK/4/2017 0 0.10 0
Residue 198 has been shown to be part of site
1 in type A viruses
↑
Preliminary analyses:
28. FMD Cases in Colombia
• First clinical case reported in South
America since 2013 (Venezuela)
• 7 outbreaks (June and July 2017)
• 5 Outbreaks (October 2018)
• Some close to border with
Venezuela
• Cases in vaccinated cattle
• Sequence data consistent with
indigenous strains from the region
• Lineage 6 described by Malirat
et al., 2011