Aralin 5 Ugnayang Panlipunan at Kalagayang Pangkabuhayan ng mga Sinaunang F...Forrest Cunningham
Sa pagtatapos ng aralin, ang mag-aaral ay inaasahang:
a.) matatalakay at maipagmamalaki ang lipunan ng sinaunang Filipino
b.) matatalakay ang mga uri ng lipunan sa Pilipinas
c.) maipapaliwanag ang ugnayan ng mga tao sa iba't ibang antas
d.) matatalakay ang papel ng batas sa kaayusang panlipunan
e) matatalakay ang kabuhayan sa sinaunang panahon
f.) masusuri nag kabuhayan ng sinaunang Filipino; at
g.) matatalakay ang kontribusyon ng kabuhayan sa pagbuo ng sinaunang kabihasnan.
Sa pagtatapos ng aralin, ang mga mag-aaral ay inaasahang:
a.) maipapaliwanag ang mga sinaunang paniniwala at tradisyon at ang impluwensiya nito sa pang-araw-araw na buhay;
b.) maihahambing ang mga paniniwala noon at ngayon upang maipaliwanag ang mga nagbago at nagpapatuloy hanggang sa kasalukuyan;
c.) matatalakay ang paglaganap ng Islam sa bansa;
d.) masusuri ang pagkakapareho at pagkakaiba ng kagawiang panlipunan ng sinaunang Filipino sa kasaukuyan; at
e.) makabubuo ng konklusyon tungkol sa kontribusyon sinaunang kabihasnan sa pagkabuo ng lipunan at pagkakakilanlang Pilipino.
Aralin 5 Ugnayang Panlipunan at Kalagayang Pangkabuhayan ng mga Sinaunang F...Forrest Cunningham
Sa pagtatapos ng aralin, ang mag-aaral ay inaasahang:
a.) matatalakay at maipagmamalaki ang lipunan ng sinaunang Filipino
b.) matatalakay ang mga uri ng lipunan sa Pilipinas
c.) maipapaliwanag ang ugnayan ng mga tao sa iba't ibang antas
d.) matatalakay ang papel ng batas sa kaayusang panlipunan
e) matatalakay ang kabuhayan sa sinaunang panahon
f.) masusuri nag kabuhayan ng sinaunang Filipino; at
g.) matatalakay ang kontribusyon ng kabuhayan sa pagbuo ng sinaunang kabihasnan.
Sa pagtatapos ng aralin, ang mga mag-aaral ay inaasahang:
a.) maipapaliwanag ang mga sinaunang paniniwala at tradisyon at ang impluwensiya nito sa pang-araw-araw na buhay;
b.) maihahambing ang mga paniniwala noon at ngayon upang maipaliwanag ang mga nagbago at nagpapatuloy hanggang sa kasalukuyan;
c.) matatalakay ang paglaganap ng Islam sa bansa;
d.) masusuri ang pagkakapareho at pagkakaiba ng kagawiang panlipunan ng sinaunang Filipino sa kasaukuyan; at
e.) makabubuo ng konklusyon tungkol sa kontribusyon sinaunang kabihasnan sa pagkabuo ng lipunan at pagkakakilanlang Pilipino.
Iba't ibang pangkat-etniko ang naninirahan sa maraming lugar sa Pilipinas. Bawat isa sa kanila ay may kanya-kanyang wika, kaugalian,tradisyon, pananampalataya at paraan ng pamumuhay.
for LIT 203 (Panitikan sa Pilipinas)
Includes topics such as Kaligirang Kasaysayan ng Panahon (background), Katangian ng Literatura, Kilalang Manunulat at Akda (akdang Panrelihiyon sa Tagalog, Iloko, Bisaya, Mga Tula at Akdang ukol sa Tula, Tulang Maladula, Akdang Pangwika)
The sermon discusses the presentation of Jesus in the temple as described in Luke 2:22-38. It notes that Mary and Joseph marveled at the good news they received about Jesus. However, Simeon then revealed that the good news would also be bad news for some, as Jesus' coming would cause division. Anna later confirmed that the bad news was ultimately good news, promising redemption. The sermon emphasizes that while the good news of Christmas was joyous, it was also costly, bringing hope, joy and peace through God coming near as Immanuel.
Iba't ibang pangkat-etniko ang naninirahan sa maraming lugar sa Pilipinas. Bawat isa sa kanila ay may kanya-kanyang wika, kaugalian,tradisyon, pananampalataya at paraan ng pamumuhay.
for LIT 203 (Panitikan sa Pilipinas)
Includes topics such as Kaligirang Kasaysayan ng Panahon (background), Katangian ng Literatura, Kilalang Manunulat at Akda (akdang Panrelihiyon sa Tagalog, Iloko, Bisaya, Mga Tula at Akdang ukol sa Tula, Tulang Maladula, Akdang Pangwika)
The sermon discusses the presentation of Jesus in the temple as described in Luke 2:22-38. It notes that Mary and Joseph marveled at the good news they received about Jesus. However, Simeon then revealed that the good news would also be bad news for some, as Jesus' coming would cause division. Anna later confirmed that the bad news was ultimately good news, promising redemption. The sermon emphasizes that while the good news of Christmas was joyous, it was also costly, bringing hope, joy and peace through God coming near as Immanuel.
This document outlines the historic campus master plans of the University of California, Berkeley from 1865 to 1962. It describes three eras led by Frederick Law Olmsted during the Picturesque Era from 1865-1914, John Galen Howard during the Beaux-Arts Era from 1914-1962, and Thomas Church during the Modern Era from 1962 onward. It also highlights some of the campus's defining open spaces and landmarks that were planned during these eras, such as Sproul Plaza, the Campanile, and Strawberry Creek.
GenScript is a world-leading biology CRO with over 1,000 employees and facilities in New Jersey, Nanjing, Paris, and Tokyo. It provides custom gene synthesis, protein and peptide services, antibodies, and assay development. GenScript has a drug discovery platform and removes bottlenecks in early drug discovery through custom bio-reagent preparation and screening.
This document discusses Docker, a tool for deploying applications as portable, self-sufficient containers. It provides an overview of Docker components like the Engine, Hub, Compose and Swarm. Key aspects of Docker like namespaces, control groups and union file systems that enable isolation and resource management are explained. The document also covers building Docker images using Dockerfiles, running containers, linking containers, managing storage and deploying applications on Docker.
Resultats de l'Enquesta del perfil de l'alumne del SEFED de Lleida comparats amb les dades de l'Enquesta, sobre el mateix tema, dels diferents SEFEDs de Catalunya. En alguns casos, es contrasten amb l'Enquesta Social Europea de 2010-2011.
The document discusses the benefits of exercise for mental health. Regular physical activity can help reduce anxiety and depression and improve mood and cognitive functioning. Exercise causes chemical changes in the brain that may help boost feelings of calmness, happiness and focus.
The document discusses the biblical concept of kingdom restoration through Jesus Christ. It explains that when Adam and Eve sinned, their relationship with God, each other, themselves, and creation was broken. However, Jesus restored these relationships through his sacrificial and sinless death on the cross. His death paid the price for sin and redeemed mankind. It then discusses how the kingdom of God is both a present and future reality, seen through inner transformation rather than external events. Believers now experience righteousness, peace and joy through the Holy Spirit. The kingdom of God calls us to live transformed lives as kingdom people.
Este documento explica cómo calcular la altura, los lados, el área y el perímetro de un triángulo rectángulo dado. Proporciona las fórmulas del teorema de la altura, teorema de Pitágoras, área y perímetro de un triángulo rectángulo. Luego aplica estas fórmulas a un triángulo específico para calcular su perímetro.
Missions the story of the bible - ssmc - 28 apr'13 editedSSMC
The document provides an overview of the main story and themes of the Bible. It discusses (I) Creation and the Fall, (II) Noah and the Flood, and (III) the Tower of Babel as the beginning of the biblical narrative. It then focuses on the Abrahamic covenant as central to God's redemptive plan, where God promises to bless Abraham and his descendants, and through them, all peoples on earth. The document argues that this theme continues through Moses and the deliverance of Israel from Egypt, and in Daniel's faithfulness to God. It concludes by discussing Jesus' understanding of this covenant and the Great Commission to take the gospel to all nations as fulfilling God's promises in the Abrahamic covenant.
The document provides links to several online tools for creating visual representations of text including Wordle for generating word clouds, a movie poster creator, and Voki for customizing avatars.
The document is a map showing recreational areas in Oakland and Berkeley, California. It depicts two pools, the East Pool and Strawberry Canyon Pool, as well as the Haas Clubhouse, Stern Pool, and Centennial Recreational Area. The map also includes a scale bar for measuring distances.
The document discusses three theories of audience reception of media:
1) Active Audience theory proposes that audiences actively interpret media based on their own experiences and backgrounds. Factors like age, culture, and knowledge can influence audience activity.
2) Passive Audience theory suggests audiences are easily manipulated by media creators and their thinking changed. This is often used to explain influence on certain groups.
3) Hypodermic Model theory likens media to a syringe injecting ideas into a powerless audience. It implies exposure to violent media causes violent behavior, leading some films to be banned.
This document discusses Jesus' teachings in Matthew 7:1-5 about not judging others and instead focusing on one's own faults. It covers how we should relate to God and others as discerning brothers, not hypocritical judges. The document also references additional Bible passages on forgiveness, reconciliation, and correcting others in a spirit of love and restoration rather than condemnation.
The document discusses four superheroes. It introduces the characters of Superman, Batman, Wonder Woman, and Spider-Man. Each hero has unique powers and abilities that help them fight crime and protect people.
The document discusses prophecies in the Bible that are claimed to refer to the Quran and Islam. It provides several biblical passages that mention a "new song" or "strange lips" and argues these refer to the Arabic language of the Quran. It also cites passages about messages being revealed "line upon line" or teachings being "bound up" as prophecies of the piecemeal revelation of the Quran. Finally, it discusses prophecies about people from the "ends of the earth" or descendants of Ishmael as referring to the Arab origins of Islam and the global spread of the Islamic faith.
1) Islam is the religion of submission to the will of God. The Quran teaches that Islam is the religion of all prophets including Abraham, Moses, Jesus and Muhammad.
2) Many people today follow religions out of tradition rather than personal conviction. With advances in knowledge, one should choose a religion based on understanding and evidence rather than tradition alone.
3) Religions are often named after their founders like Christianity after Jesus and Buddhism after Buddha. However, Islam means submission to God and does not reference a human founder, as it is the religion established by God since the time of Abraham.
1. The document discusses various forms of idolatry and shirk that existed among Jews, Christians, and later Muslims may fall into, such as belief in omens, astrology, magic, and fortune telling.
2. It prohibits sorcery and describes types of magic like amulets. Belief in magic is a form of shirk.
3. Predictions are made that Muslims may later imitate the idolatrous ways of Jews and Christians if they are not careful. The document warns against several superstitious beliefs and practices.
This document discusses the Islamic faith as the Abrahamic mystery of Ishmael and its roots in Biblical scripture. It notes that Abraham was a monotheist chosen by God to be a father of many nations, and that both Ishmael and Isaac inherited this pure monotheistic belief. It then provides examples of Islamic faith and practices that have prototypes or parallels in the Bible, such as the Shahadah (declaration of faith in God) and the importance of prayer in Islam.
This document discusses the popularity and origins of astrology. It states that astrology has become a multi-million dollar industry with over 175,000 part-time astrologers in the US alone. The document traces astrology's origins to ancient Babylon and discusses how it later developed in places like Greece, India, and Central America. It provides an overview of the key beliefs and practices in astrology, such as the 12 signs of the zodiac and how astrologers assign meanings to the positions of planets and stars. The document also notes that while astrology was once considered a science, modern scientists have rejected its principles. It concludes by stating that both the Quran and hadiths condemn practices like astrology and
This document outlines the genealogical lineage of Abraham through his two sons Ishmael and Isaac. It discusses the covenant God made with Abraham to make Ishmael a great nation and that twelve princes would come from him. The document provides biblical references that support Islam being the fulfillment of this promised blessing to Ishmael and his progeny. It argues that Islam has the most continuous message from God as all prophets, including Abraham, were Muslim according to the teachings of Islam.
This document outlines the genealogical lineage of Abraham through his two sons Ishmael and Isaac. It discusses the covenant God made with Abraham to make Ishmael a great nation and that twelve princes would come from him. The document provides biblical references that support Islam being the fulfillment of this promised blessing to Ishmael and his progeny. It argues that Islam has the most continuous and universal message because all prophets, including Abraham, were Muslim according to the teachings of the Quran and Hadith.
Fasting is abstaining from food, drink, and other things for spiritual purposes. It is mentioned frequently in scripture and practiced by prophets and early Christians. Fasting is prescribed in Islam during the month of Ramadan as a means of spiritual purification, gaining forgiveness, and strengthening one's relationship with God. In addition to spiritual benefits, fasting can provide physical health benefits like rest for the digestive system and potential treatment of diseases.
The document provides information about the five daily prayers (salat) in Islam. It explains that Muslims are obligated to pray five times a day at dawn, midday, late afternoon, just after sunset, and between sunset and midnight. Each prayer involves reciting passages from the Quran and performing set movements like standing, bowing, and prostrating on the ground while facing the Kaaba in Mecca. The call to prayer is announced by the muezzin and helps structure the day for Muslims.
The Shahada is the declaration of faith in Islam. It consists of two statements: 1) There is no god but Allah, and 2) Muhammad is the messenger of Allah. Reciting the Shahada with belief in one's heart is how one enters the fold of Islam. It affirms faith in all of Allah's prophets, with Muhammad being the last. The Shahada is not just a one-time declaration, but rather a lifelong commitment to surrendering one's will to Allah and following Islamic principles.
The document provides information about the key beliefs and practices of Islam, beginning with definitions of important terms like Islam, Muslim, and Allah. It then discusses the five pillars of Islam - Shahadah (declaration of faith), Salah (prayer), Zakat (charity), Sawm (fasting during Ramadan), and Hajj (pilgrimage to Mecca). Each pillar is described in 1-2 sentences. The document also briefly outlines the six articles of faith in Islam and explains the spiritual meanings and benefits of fasting, such as developing patience, unselfishness, willpower, and moderation.
4. 50,000- 150 BCE AngNegrito ay angunangnaglakbaypatungosaKalupaanngPilipinas
5. AngKonseptongpagkakahati-hatinglupainsa 3 anakni Noah The Ancient Greek geographer Strabo holding a globe showing Europa and Asia Medieval map showing the three continents as domains of the sons of Noah - Sem (Shem), Iafeth (Japheth) and Cham (Ham)
7. AngDaigdigsakonseptoni Homer Homer, a semi-mythical poet at the dawn of Greek history, was seen by Strabo and the Stoics as the father of geography. His overarching geographic concept was of the world as a flat, round disk of land, completely encircled by Okeanos, the world sea. All this was enclosed by the fixed dome of the Heavens, filled with cloud and mist close to the Earth, but with clear aether closer to the sky’s dome. Sun, Moon and stars rose from the eastern waters of the Ocean, moved along the dome and sank again into the western waters. The whole thing is reminiscent of nothing so much as of one of those snowdomes that are the staple of any self-respecting tourist trap. This vision is expounded in the Iliad,
45. MgaPangalannaikinapitsaKapuluanngPilipinas IkinapitngmgaIntsik 10thSiglo IkinapitngmgaHapones Ma-i – lupainngmgaBarbaro Chin-san – bundokngmgaginto Lui-sung- lupainnamalapitsaKabihasnan San-tao -tatlongkapuluan Luzones o kaya’yLucones ItinawagngKastilaatbpa.. Archipelago de San Lazaro-Magellan VallSeuParigne( Valley without Peril) Islas del Poniente Islas del Oriente Felipinas ( Leyte/Samar)
54. Tipan Kay Isaac at IsmaelGenesis 17:19-20 “ At tungkolkayIsmael, ay dininig din kita. Narito’takingpinagpalasiya, at siya’yakingpapag-anakinngmarami, at siya’yakingpararamihinngdikawasa; labingdalawangprinsipeangkaniyangmagiginganak, at siya’ygagawinkongmalakingbansa.” “ At sinabing Dios, Hindi kundiangiyongasawangsi Sara ay manganganaksaiyo; at tatawagin mo angkaniyangpangalang Isaac; at akingpagtitibayinangakingtipansakaniyangpinakatipangwalanghanggan,sakaniyanglahipagkamatayniya.”
57. AngDalawangTipan Sapagkatnasusulat , nasi Abraham ay nagkaroonngdalawanganak, angisa’ysaalipingbabae, angangisa’ysababaingmalaya. Gayon man anganaksaalipin ay ipinanganakayonsalaman; ngunitanganaksababaingmalaya ay sapamamagitanngpangako. Angmgabagaynaito ay may lamangtalinghaga: sapagkatangmgababaingito’ydalawangtipan; angisa’ymulasabundokng Sinai, nananganganaksamgaanaksapagkaalipinnaito’ysi Agar. Ang Agar ngangito ay bundokng Sinai ng Arabia at ito’ykatuladng Jerusalem ngayon:sapagkat , ito’ynasapagkaalipinkasamangkaniyangmgaanak. Ngunitang Jerusalem nanasaitaas ay malaya, nasiyanginanatin… At tayo , mgakapatid, tuladni Isaac, ay mgaanaksapangako. ( Galacia 4:22-26,28 )
58. AngItinakuwil ay nagingpangulongbato Sinasakanilani Jesus, Kailan man baga’yhindininyonabasasakasulatan, angbatongitinakwilngnangagtatayonggusali, Angsiya ring ginawangpangulosapanulok; Ito’ymulasaPanginoon, At ito’ykagilagilalassaharapngatingmgamata? Kayangasinasabikosainyo, Aalisinsainyoangkaharianng Dios, at ibibigaysaisangbansangmagkakabunga. At angmahulogsaibabawngbatongito ay madudurog: datapwatsinomangkaniyangmalagpakan, ay pangangalatinggayangalabok. ( Mateo 21:42-44 )
62. AngMgaPulongDagat “ Kayo’ymagsipakinigsa akin, Oh mgapulo; at inyongpakinggan, ninyongmgabayan, samalayo…” ( Isaias 49:1) “ Angmgaito ay maglalakasngkanilangtinig, sila’ymagsisihiyaw; dahilsakamahalanngPanginoon ay magsisihiyawsilangmalakasmulasadagat. Kaya’tluwalhatiinninyoangPanginoonsasilanganan, samakatuwidbaga’yangpangalanngPanginoonng Israel , samgapulongdagat.” ( Isaias 24: 14-15)
63. PaglalakbaymulasaPulo “ Sapagkatkilalakoangkanilangmgagawa at angkanilangmgapag-iisip: angpanahon ay aydumaratingnaakingpipisaninanglahatnabansa at angmga may iba’t-ibangwika; at sila’ymagsisiparoon, at mangakikitaangakingkalualhatian. At ako’ymaglalagayngtandasagitnanila, at akingsusuguinangmganakatanansakanilasamgabansa, saTarsia, Pul, at Lud, nanagsisihawakngbusog, sa Tubal at Javan, samgapulongmalayonahindinangakarinigngakingkabantugan, o nakakita man ngakingkaluwalhatian; at sila’ymangagpapahayagngakingkaluwalhatiansagitnangmgabansa. At dadalhinanglahatninyongmgakapatidmulasalahatnabansanapinakahandogsaPanginoon, nanasasakaysamgakabayo, at mgakaro, at samgaduyan, at samgamula, at samgamaliksinghayop, saaking banal nabundokna Jerusalem, sabingPanginoon, gayangpagdadalangmgaanakni Israel sakanilanghandogsamalinisnasisidlansabahayngPanginoon… At mangyayari, namulasabagongbuwanhanggangsapanibago, at mulasa Sabbath hanggangsapanibago, ay paroroonanglahatnataoupangsumambasaharapko, sabingPanginoon. “ ( Isaias 66:18-20,23)
64. AngmgaPulo ay maghihintay Angkatuwiranko ay malapit, angakingpagliligtas ay lumabas, at hahatolangakingmgabisigsamgabayan; angmgapulo ay magsisipaghintaysa akin, at saakingbisig ay magsisitiwalasila.” ( Isaias 51:5) Siya’yhindimanglulupaypay o maduduwag man, hanggangsamaitatagniyaangkahatulansalupa: at angmgapulo ay maghihintaysakaniyangkautusan… Magsiawit kayo saPanginoonngbagongawit, at ngkapurihanniyanamulasawakasnglupa; kayongnagsisibabasadagat, at ngbuongnariyan, angmgapulo, at mganananahandoon.” ( Isaias 42:4,10)
87. Kasunduanng Portugal At Espanya- Treaty of Torsidellasnoong June 7,1494 HinatiangDaigdigupangSakupinngEspanya at Portugal Kinilalang Papa sa Roma ang Treaty of Tordesillas
118. AngEspanya ay nagpadala pa ngEkspedisyonnamgaNabigo Juan Garcia Jofre de Loaysanoong 1525 Juan Cabot noong 1526 Alvaro de Saadvedranoong 1527- Mindanao mulasa Mexico; NamataysaPaglalakbay at bumalikngEspanya
119. NaratingRuy Lopez de Villalobos at inangkinangKapuluansapanglanng Haring Felipe II ngEspanya ( King Philip II )
120. Febrero 13, 1565 Miguel Lopez Legaspi at angmgaKawal ay nakaratingsaKapuluan KawalniLegaspi Miguel Lopez de Legaspi
121. King Philip II itinalagasi Miguel Lopez de LegaspibilangGobernador-General ngPilipinasbilangsakopng Mexico ( angBagongEspanya )