In this Presentation, we have provided step by step Installation guide and error free solution for developers which helps in time efficient and user friendly installation of theme in Liferay 7.
OSGi Overview provides information on OSGi, its benefits, and how it works. Key points include:
- OSGi allows developing modular Java programs through bundles that declare dependencies. Each bundle dynamically loads classes.
- In Liferay, bundles become portlets, services, or extensions. The blade CLI helps create these.
- Portlets can be implemented as MVC portlets or use configuration and portlet provider templates.
- Services can be created with Service Builder or wrapped. OSGi services can also be registered.
- Liferay modules can be extended through fragments to customize JSPs, properties, add filters or events.
This document discusses modularity in Java applications and platforms. It covers OSGi, a popular modular system for Java that allows bundles to be installed and updated dynamically. It also discusses Project Jigsaw, which aims to add built-in modularity to the Java platform starting in JDK 9 by defining Java modules. Project Penrose explores interoperability between OSGi and Jigsaw modular systems.
OSGi and Java EE: A Hybrid Approach to Enterprise Java Application DevelopmentSanjeeb Sahoo
The document discusses using OSGi and Java EE together for enterprise application development. It provides an overview of OSGi including modules, services, and lifecycle. OSGi allows Java EE applications to be built as bundles that can leverage Java EE services. Specifications integrate technologies like JPA, JTA, and web applications. A demo shows lazy loading with JPA, EJB as a service, and security/transaction context propagation. More advanced topics include CDI injection of OSGi services and demos. The hybrid approach provides modularity, dynamism, and ease of deployment benefits for enterprise applications.
Julien Dubois discusses the benefits of developing modular Java applications. Modularity improves quality, lowers complexity, and makes applications easier to reuse and maintain. Spring provides tools for creating layered applications with clear separation of concerns between presentation, service, and repository layers using annotations like @Controller, @Service, and @Repository. For true modularity with hot-deployable modules, OSGi is introduced, which Spring Dynamic Modules builds upon. dm Server leverages Spring, Tomcat, and OSGi to allow deployment of modular applications to virtualized and cloud environments at runtime for improved scalability and reduced costs.
Brief description about Java modularity including OSGi and Jigsaw.
Nowadays the word "modularity" has been searched a lot in Google and several blog posts have been written about it. Specially with the #Jigsaw subject that Oracle's guys have been spreading in different conferences .
Here I try to summarise the idea in the Java environment mentioning what for me are the main implementations of java modularity : OSGi and Jigsaw.
Java 9 brings modules as a core concept to the platform, but it’s more than just a language feature. With modules in Java 9, we can improve the design of code to increase maintainability and extensibility. As with every design principle, modularity requires thought and trade-offs to really reap the benefits. This session covers design practices for making codebases more maintainable and extensible. You will also find out about trade-offs to help you make the best choices. Topics include hiding implementations, using services for extensibility, API modules, avoiding cycles, optional dependencies, and dynamically loading modules. Familiarity with modules is helpful but not required. The speakers are the authors of Java 9 Modularity (O’Reilly).
Also see https://javamodularity.com
OSGi Overview provides information on OSGi, its benefits, and how it works. Key points include:
- OSGi allows developing modular Java programs through bundles that declare dependencies. Each bundle dynamically loads classes.
- In Liferay, bundles become portlets, services, or extensions. The blade CLI helps create these.
- Portlets can be implemented as MVC portlets or use configuration and portlet provider templates.
- Services can be created with Service Builder or wrapped. OSGi services can also be registered.
- Liferay modules can be extended through fragments to customize JSPs, properties, add filters or events.
This document discusses modularity in Java applications and platforms. It covers OSGi, a popular modular system for Java that allows bundles to be installed and updated dynamically. It also discusses Project Jigsaw, which aims to add built-in modularity to the Java platform starting in JDK 9 by defining Java modules. Project Penrose explores interoperability between OSGi and Jigsaw modular systems.
OSGi and Java EE: A Hybrid Approach to Enterprise Java Application DevelopmentSanjeeb Sahoo
The document discusses using OSGi and Java EE together for enterprise application development. It provides an overview of OSGi including modules, services, and lifecycle. OSGi allows Java EE applications to be built as bundles that can leverage Java EE services. Specifications integrate technologies like JPA, JTA, and web applications. A demo shows lazy loading with JPA, EJB as a service, and security/transaction context propagation. More advanced topics include CDI injection of OSGi services and demos. The hybrid approach provides modularity, dynamism, and ease of deployment benefits for enterprise applications.
Julien Dubois discusses the benefits of developing modular Java applications. Modularity improves quality, lowers complexity, and makes applications easier to reuse and maintain. Spring provides tools for creating layered applications with clear separation of concerns between presentation, service, and repository layers using annotations like @Controller, @Service, and @Repository. For true modularity with hot-deployable modules, OSGi is introduced, which Spring Dynamic Modules builds upon. dm Server leverages Spring, Tomcat, and OSGi to allow deployment of modular applications to virtualized and cloud environments at runtime for improved scalability and reduced costs.
Brief description about Java modularity including OSGi and Jigsaw.
Nowadays the word "modularity" has been searched a lot in Google and several blog posts have been written about it. Specially with the #Jigsaw subject that Oracle's guys have been spreading in different conferences .
Here I try to summarise the idea in the Java environment mentioning what for me are the main implementations of java modularity : OSGi and Jigsaw.
Java 9 brings modules as a core concept to the platform, but it’s more than just a language feature. With modules in Java 9, we can improve the design of code to increase maintainability and extensibility. As with every design principle, modularity requires thought and trade-offs to really reap the benefits. This session covers design practices for making codebases more maintainable and extensible. You will also find out about trade-offs to help you make the best choices. Topics include hiding implementations, using services for extensibility, API modules, avoiding cycles, optional dependencies, and dynamically loading modules. Familiarity with modules is helpful but not required. The speakers are the authors of Java 9 Modularity (O’Reilly).
Also see https://javamodularity.com
Make JSF more type-safe with CDI and MyFaces CODIos890
These slides show how to use type-safe mechanisms provided by MyFaces CODI for developing JSF applications which are more type-safe and easier to maintain.
http://2012.con-fess.com/sessions/-/details/136/MyFaces-CODI-and-JBoss-Seam3-become-Apache-DeltaSpike is the next part with more details about MyFaces CODI and Apache DeltaSpike at
The document discusses plugins in Grails. It covers what a plugin is, the directory structure of plugins, common types of plugins, and implementation details like using the GrailsApplication object, configuring Spring, adding dynamic methods, and reloading on changes. The document is intended to teach plugin developers best practices for creating plugins in Grails.
With modularity coming to the core Java platform in Java 9, are all our modularity needs fulfilled, or does it still make sense to use something like OSGi? In this talk you will learn how Jigsaw helps modularity, and in what cases it might fall short.
Java 9 will provide a module-system, called Jigsaw. Besides modularising the JDK itself, Java developers can build more modular applications with Jigsaw. Modularity and Java go back way longer, though. OSGi, the de facto standard for modularity in Java has been around since 2000. Adoption is increasing in recent years.
A modular architecture has many advantages, such as increased decoupling resulting in more flexibility. In that sense, native support for Java modularity is very welcome. The big question now is: does Java 9 provide everything you need to build truly modular applications? Since Java 9 needs to maintain backwards compatibility, some compromises need to be made while enforcing module boundaries.
This talk discusses what you really need to build modular applications. We'll investigate which requirements are met (or not) by both module systems. You'll see that both Jigsaw and OSGi provided pieces of the modularity puzzle. Also, you'll learn whether having an additional modular runtime such as OSGi on top of Java 9 still makes sense.
The Web and Spring MVC continue to be one of the most active areas of the
Spring Framework with each new release adding plenty of features and refinements
requested by the community. Furthermore version 4 added a significant choice
for web applications to build WebSocket-style architectures.
This talk provides an overview of the areas in which the framework has evolved
along with highlights of specific noteworthy features from the most recent
releases.
This document summarizes a presentation about building mobile web apps with Grails. It introduces Grails, a web framework that can help with resource handling, caching, and deploying apps to the cloud. It also discusses jQuery Mobile, a library that can be used to build responsive web apps. The presentation recommends using the jQuery Mobile Client Scaffolding and PhoneGap Build plugins with Grails to generate HTML5 apps and native packages.
The document discusses the Play framework, an agile web development framework created by Guillaume Bort in 2007. It provides an overview of Play's main concepts including its stateless MVC architecture, ability to fix bugs and reload code without restarting, efficient templating, and support for test-driven development. The document also covers getting started with Play and using modules to add additional functionality.
Vert.x - Tehran JUG meeting Aug-2014 - Saeed ZarinfamSaeed Zarinfam
This document provides an overview of Vert.x, an application platform that runs on the JVM and allows building reactive applications. Vert.x is asynchronous, non-blocking, and distributed. It uses an event-driven architecture and supports polyglot programming through modules for Java, JavaScript, Python, Ruby, and other languages. Vert.x applications are composed of lightweight verticle components that communicate asynchronously through an event bus. It provides clustering, failover, and load balancing capabilities to build scalable and resilient applications.
With Java 9 modules coming to us soon, you want your existing code to be fully ready for the module system. Making code modular can be a daunting task, but Java 9 comes with a number features to ease migration. This includes automatic modules, the unnamed module and a number of command line arguments.
In this talk we will look at examples of migrating real code. It discusses common problems youll run into during migration, leading to practical tips and the ability to set realistic goals. Its also a good way to understand the module system itself and the various migration paths it supports. This talk is an excellent preparation to start migrating your own code.
* Understanding modules and the module path
* Automatic modules
* Mixing classpath and modulepath
* Dealing with reflection
* Escape switches
* Jdeps
All topics will be based on examples of often used libraries and frameworks.
The document provides an overview of key concepts in advanced Java programming including the Java Virtual Machine (JVM), assertions, Java Database Connectivity (JDBC), Java servlets, and Java Server Pages (JSP). It describes the JVM as a software layer that converts Java bytecode into machine code so it can run on any platform. It also outlines the components of the JVM and how assertions are used for programming by contract and verifying pre- and post-conditions. The document further explains how JDBC provides Java applications access to databases via SQL and the different types of JDBC drivers. It also summarizes how servlets handle HTTP requests and the basic servlet classes, and how JSP pages are compiled
This document discusses Spring Framework 4.0 and its support for Java 8 features. Spring 4.0 will include first-class support for Java 8 language features like lambda expressions and the new date/time API. It will also support upcoming Java EE 7 specifications. Some initial challenges in supporting Java 8 included differences in bytecode versions and hash algorithm changes. The document provides examples of using Java 8 lambda expressions with Spring's JdbcTemplate. It also discusses the state of Java 8 and tool support as Spring 4.0 development progresses.
The document discusses various aspects of developing modular applications using J2EE, OSGi, and RCP frameworks. It covers:
1. The structure and organization of modules, projects, and dependencies when using different frameworks like J2EE, Spring, Maven, and OSGi.
2. How modules, plugins, and bundles can be developed and packaged for each framework. This includes module/plugin sources, views, packaging, and dependencies.
3. Integration aspects like how to integrate databases, connection pools, templating engines, and more through extension bundles/plugins across frameworks.
In September 2017 the long-awaited release of Java 9 gave us a new module system in Java. It also kick-started the release-train of frequent Java releases, with Java 11 being the first long-term supported Java version poised to take modules into the mainstream. So what has happened since the introduction of the module system?
This talk will provide an overview adoption of modules in open-source libraries, IDEs, build tools, and so on. It will also feature tools that have emerged to make working with modules easier. Expect an honest overview of the current state of modules in Java, with lots of demos to show what's possible. After this talk you can start developing your own modular Java application without hesitation!
MyFaces CODI and JBoss Seam3 become Apache DeltaSpikeos890
These slides show how to use type-safe mechanisms provided by MyFaces CODI for developing JSF applications which are more type-safe and easier to maintain as well as common pitfalls. Beyond that there is an basic overview of Apache DeltaSpike.
Spring Framework 4.0 - The Next Generation - Soft-Shake 2013Sam Brannen
Spring Framework 4.0 is the next generation of the popular open source framework for Enterprise Java developers, focusing on the future with support for Java SE 8 and Java EE 7. In this presentation core Spring committer Sam Brannen will provide attendees an overview of the new enterprise features in the framework as well as new programming models made possible with the adoption of JDK 8 language features and APIs.
Specifically, this talk will cover support for lambda expressions and method references against Spring callback interfaces, JSR-310 Date-Time value types for Spring data binding and formatting, Spring's new @Conditional mechanism for activation of bean definitions, and a new WebSocket endpoint model. Regarding enterprise APIs, the presentation will cover Spring 4.0's new support for JMS 2.0, JPA 2.1, Bean Validation 1.1, Servlet 3.1, JCache, and JSR-236 concurrency. Last but not least, Sam will discuss improvements to Spring's testing support and point out which deprecated APIs have been pruned from the framework.
CDI portable extensions are one of greatest features of Java EE allowing the platform to be extended in a clean and portable way. But allowing extension is just part of the story. CDI opens the door to a whole new eco-system for Java EE, but it’s not the role of the specification to create these extensions.
Apache DeltaSpike is the project that leads this brand new eco-system by providing useful extension modules for CDI applications as well as tools to ease the creation of new ones.
In this session, we’ll start by presenting the DeltaSpike toolbox and show how it helps you to develop for CDI. Then we’ll describe the major extensions included in DeltaSpike, including 'configuration', 'scheduling' and 'data'.
Modularity of the Java Platform (OSGi, Jigsaw and Penrose)Martin Toshev
Seminar "Modularity of the Java Platform" of the Bulgarian Java User Group.
Topics of the seminar:
Modularity 101
Modularity on top of the platform: OSGi
Modularity of the platform: Jigsaw
OSGi and Jigsaw interoperability: Penrose
The document provides information about high performance Android app development. It begins with a history of Android performance features from early versions through Jellybean and Project Butter. It then compares the three Android programming models (SDK, NDK, RenderScript) in terms of workflow, execution model, and performance. A case study on the performance features of the Google Chrome browser for Android is presented, covering its multi-process architecture, hardware acceleration, networking, and VSync scheduling. The document concludes with a questionnaire on topics like multi-core vs GPU, Android vs Chrome, and developments beyond Android.
The Apache Aries project provides implementations for enterprise OSGi applications including the Blueprint container, JPA integration, JTA integration, and more. It aims to build a community around the OSGi enterprise expert group specifications and provide implementations of new technologies to inform standards. Aries components are used in Apache Geronimo, Apache Felix Karaf, JBossOSGi, and WebSphere Application Server.
Rational Rhapsody 8.3 with Cygwin and iFixes (www.executablembse.com)Fraser Chadburn
This detailed guide gives full instructions for installing IBM Rational Rhapsody v8.3 with iFixes *as of 14/01/18. It gives instructions for installing all Editions. It chooses Developer Edition and then switches it to Designer (although Architect is also possible). Included are steps for downloading and installing the minimal Cygwin environment and a profile called SysMLHelper which supports a Harmony/SE like workflow for advanced executable MBSE in automotive. Full steps on validating the install are provided including checking that the Rhapsody Gateway add-in launches OK.
IBM Rational Rhapsody 8.3.1 install guide with Cygwin for Executable MBSEFraser Chadburn
This is the installation guide of MBSE Training and Consulting's Mastering MBSE with OMG SysML and IBM Rational Rhapsody training. It gives detailed steps for obtaining and installing Rhapsody Designer and Cygwin gcc minimal download (just x3 things to pick) for simulation modelling. Also included are detailed validation steps to make sure that the compiler is installed and working, the Gateway add-on is installed and licensed and that Java plugins are working (with the SysMLHelper Profile).
Make JSF more type-safe with CDI and MyFaces CODIos890
These slides show how to use type-safe mechanisms provided by MyFaces CODI for developing JSF applications which are more type-safe and easier to maintain.
http://2012.con-fess.com/sessions/-/details/136/MyFaces-CODI-and-JBoss-Seam3-become-Apache-DeltaSpike is the next part with more details about MyFaces CODI and Apache DeltaSpike at
The document discusses plugins in Grails. It covers what a plugin is, the directory structure of plugins, common types of plugins, and implementation details like using the GrailsApplication object, configuring Spring, adding dynamic methods, and reloading on changes. The document is intended to teach plugin developers best practices for creating plugins in Grails.
With modularity coming to the core Java platform in Java 9, are all our modularity needs fulfilled, or does it still make sense to use something like OSGi? In this talk you will learn how Jigsaw helps modularity, and in what cases it might fall short.
Java 9 will provide a module-system, called Jigsaw. Besides modularising the JDK itself, Java developers can build more modular applications with Jigsaw. Modularity and Java go back way longer, though. OSGi, the de facto standard for modularity in Java has been around since 2000. Adoption is increasing in recent years.
A modular architecture has many advantages, such as increased decoupling resulting in more flexibility. In that sense, native support for Java modularity is very welcome. The big question now is: does Java 9 provide everything you need to build truly modular applications? Since Java 9 needs to maintain backwards compatibility, some compromises need to be made while enforcing module boundaries.
This talk discusses what you really need to build modular applications. We'll investigate which requirements are met (or not) by both module systems. You'll see that both Jigsaw and OSGi provided pieces of the modularity puzzle. Also, you'll learn whether having an additional modular runtime such as OSGi on top of Java 9 still makes sense.
The Web and Spring MVC continue to be one of the most active areas of the
Spring Framework with each new release adding plenty of features and refinements
requested by the community. Furthermore version 4 added a significant choice
for web applications to build WebSocket-style architectures.
This talk provides an overview of the areas in which the framework has evolved
along with highlights of specific noteworthy features from the most recent
releases.
This document summarizes a presentation about building mobile web apps with Grails. It introduces Grails, a web framework that can help with resource handling, caching, and deploying apps to the cloud. It also discusses jQuery Mobile, a library that can be used to build responsive web apps. The presentation recommends using the jQuery Mobile Client Scaffolding and PhoneGap Build plugins with Grails to generate HTML5 apps and native packages.
The document discusses the Play framework, an agile web development framework created by Guillaume Bort in 2007. It provides an overview of Play's main concepts including its stateless MVC architecture, ability to fix bugs and reload code without restarting, efficient templating, and support for test-driven development. The document also covers getting started with Play and using modules to add additional functionality.
Vert.x - Tehran JUG meeting Aug-2014 - Saeed ZarinfamSaeed Zarinfam
This document provides an overview of Vert.x, an application platform that runs on the JVM and allows building reactive applications. Vert.x is asynchronous, non-blocking, and distributed. It uses an event-driven architecture and supports polyglot programming through modules for Java, JavaScript, Python, Ruby, and other languages. Vert.x applications are composed of lightweight verticle components that communicate asynchronously through an event bus. It provides clustering, failover, and load balancing capabilities to build scalable and resilient applications.
With Java 9 modules coming to us soon, you want your existing code to be fully ready for the module system. Making code modular can be a daunting task, but Java 9 comes with a number features to ease migration. This includes automatic modules, the unnamed module and a number of command line arguments.
In this talk we will look at examples of migrating real code. It discusses common problems youll run into during migration, leading to practical tips and the ability to set realistic goals. Its also a good way to understand the module system itself and the various migration paths it supports. This talk is an excellent preparation to start migrating your own code.
* Understanding modules and the module path
* Automatic modules
* Mixing classpath and modulepath
* Dealing with reflection
* Escape switches
* Jdeps
All topics will be based on examples of often used libraries and frameworks.
The document provides an overview of key concepts in advanced Java programming including the Java Virtual Machine (JVM), assertions, Java Database Connectivity (JDBC), Java servlets, and Java Server Pages (JSP). It describes the JVM as a software layer that converts Java bytecode into machine code so it can run on any platform. It also outlines the components of the JVM and how assertions are used for programming by contract and verifying pre- and post-conditions. The document further explains how JDBC provides Java applications access to databases via SQL and the different types of JDBC drivers. It also summarizes how servlets handle HTTP requests and the basic servlet classes, and how JSP pages are compiled
This document discusses Spring Framework 4.0 and its support for Java 8 features. Spring 4.0 will include first-class support for Java 8 language features like lambda expressions and the new date/time API. It will also support upcoming Java EE 7 specifications. Some initial challenges in supporting Java 8 included differences in bytecode versions and hash algorithm changes. The document provides examples of using Java 8 lambda expressions with Spring's JdbcTemplate. It also discusses the state of Java 8 and tool support as Spring 4.0 development progresses.
The document discusses various aspects of developing modular applications using J2EE, OSGi, and RCP frameworks. It covers:
1. The structure and organization of modules, projects, and dependencies when using different frameworks like J2EE, Spring, Maven, and OSGi.
2. How modules, plugins, and bundles can be developed and packaged for each framework. This includes module/plugin sources, views, packaging, and dependencies.
3. Integration aspects like how to integrate databases, connection pools, templating engines, and more through extension bundles/plugins across frameworks.
In September 2017 the long-awaited release of Java 9 gave us a new module system in Java. It also kick-started the release-train of frequent Java releases, with Java 11 being the first long-term supported Java version poised to take modules into the mainstream. So what has happened since the introduction of the module system?
This talk will provide an overview adoption of modules in open-source libraries, IDEs, build tools, and so on. It will also feature tools that have emerged to make working with modules easier. Expect an honest overview of the current state of modules in Java, with lots of demos to show what's possible. After this talk you can start developing your own modular Java application without hesitation!
MyFaces CODI and JBoss Seam3 become Apache DeltaSpikeos890
These slides show how to use type-safe mechanisms provided by MyFaces CODI for developing JSF applications which are more type-safe and easier to maintain as well as common pitfalls. Beyond that there is an basic overview of Apache DeltaSpike.
Spring Framework 4.0 - The Next Generation - Soft-Shake 2013Sam Brannen
Spring Framework 4.0 is the next generation of the popular open source framework for Enterprise Java developers, focusing on the future with support for Java SE 8 and Java EE 7. In this presentation core Spring committer Sam Brannen will provide attendees an overview of the new enterprise features in the framework as well as new programming models made possible with the adoption of JDK 8 language features and APIs.
Specifically, this talk will cover support for lambda expressions and method references against Spring callback interfaces, JSR-310 Date-Time value types for Spring data binding and formatting, Spring's new @Conditional mechanism for activation of bean definitions, and a new WebSocket endpoint model. Regarding enterprise APIs, the presentation will cover Spring 4.0's new support for JMS 2.0, JPA 2.1, Bean Validation 1.1, Servlet 3.1, JCache, and JSR-236 concurrency. Last but not least, Sam will discuss improvements to Spring's testing support and point out which deprecated APIs have been pruned from the framework.
CDI portable extensions are one of greatest features of Java EE allowing the platform to be extended in a clean and portable way. But allowing extension is just part of the story. CDI opens the door to a whole new eco-system for Java EE, but it’s not the role of the specification to create these extensions.
Apache DeltaSpike is the project that leads this brand new eco-system by providing useful extension modules for CDI applications as well as tools to ease the creation of new ones.
In this session, we’ll start by presenting the DeltaSpike toolbox and show how it helps you to develop for CDI. Then we’ll describe the major extensions included in DeltaSpike, including 'configuration', 'scheduling' and 'data'.
Modularity of the Java Platform (OSGi, Jigsaw and Penrose)Martin Toshev
Seminar "Modularity of the Java Platform" of the Bulgarian Java User Group.
Topics of the seminar:
Modularity 101
Modularity on top of the platform: OSGi
Modularity of the platform: Jigsaw
OSGi and Jigsaw interoperability: Penrose
The document provides information about high performance Android app development. It begins with a history of Android performance features from early versions through Jellybean and Project Butter. It then compares the three Android programming models (SDK, NDK, RenderScript) in terms of workflow, execution model, and performance. A case study on the performance features of the Google Chrome browser for Android is presented, covering its multi-process architecture, hardware acceleration, networking, and VSync scheduling. The document concludes with a questionnaire on topics like multi-core vs GPU, Android vs Chrome, and developments beyond Android.
The Apache Aries project provides implementations for enterprise OSGi applications including the Blueprint container, JPA integration, JTA integration, and more. It aims to build a community around the OSGi enterprise expert group specifications and provide implementations of new technologies to inform standards. Aries components are used in Apache Geronimo, Apache Felix Karaf, JBossOSGi, and WebSphere Application Server.
Rational Rhapsody 8.3 with Cygwin and iFixes (www.executablembse.com)Fraser Chadburn
This detailed guide gives full instructions for installing IBM Rational Rhapsody v8.3 with iFixes *as of 14/01/18. It gives instructions for installing all Editions. It chooses Developer Edition and then switches it to Designer (although Architect is also possible). Included are steps for downloading and installing the minimal Cygwin environment and a profile called SysMLHelper which supports a Harmony/SE like workflow for advanced executable MBSE in automotive. Full steps on validating the install are provided including checking that the Rhapsody Gateway add-in launches OK.
IBM Rational Rhapsody 8.3.1 install guide with Cygwin for Executable MBSEFraser Chadburn
This is the installation guide of MBSE Training and Consulting's Mastering MBSE with OMG SysML and IBM Rational Rhapsody training. It gives detailed steps for obtaining and installing Rhapsody Designer and Cygwin gcc minimal download (just x3 things to pick) for simulation modelling. Also included are detailed validation steps to make sure that the compiler is installed and working, the Gateway add-on is installed and licensed and that Java plugins are working (with the SysMLHelper Profile).
IBM Rational Rhapsody 8.4 install guide (including Cygwin and obtaining an ev...Fraser Chadburn
The document provides instructions for installing IBM Rational Rhapsody Designer Edition 8.4 along with the Cygwin gcc compiler and SysMLHelperProfile add-in. It describes how to download Rhapsody, choose the Developer edition, download and install Cygwin gcc, and run the Rhapsody installation wizard. It also discusses obtaining any necessary iFixes and testing the installations. The goal is to set up Rhapsody with simulation support for systems models using Cygwin gcc and additional capabilities from add-ons like SysMLHelper.
Installing Installing IBM Rational Rhapsody Designer and Architect for MBSEFraser Chadburn
Detailed screen shots for installation of IBM Rational Rhapsody with Cygwin gcc compiler for executable Model-based Systems Engineering usage. Base instructions for preparing machines for training provided by www.mbsetraining.com.
Installing Rational Rhapsody Designer 8.2 or 8.2.1 for Executable MBSEFraser Chadburn
This document provides instructions for installing IBM Rational Rhapsody Designer for Executable MBSE version 8.2 or 8.2.1, including downloading the Rhapsody installer and evaluation key, obtaining the Cygwin gcc compiler for system simulation support, and running the Rhapsody installation wizard to complete the installation process. It also recommends testing the Cygwin gcc and make commands once installed and provides additional context around Rhapsody editions, versions, and installation considerations.
This document provides instructions for setting up a Ruby development environment on Windows. It details downloading and installing Ruby 2.0.0 and the Developer's Kit. It also covers installing Bundler and other required gems by running bundle install after editing the Gemfile. The instructions explain getting the repository from GitHub and making edits to the ExecJS gem to fix a known Windows issue.
How to Develop Progressive Web Apps in Flutter – Step by Step Guide.pptxBOSC Tech Labs
This article covers step-by-step process to create a Progressive Web Apps in Flutter. Here you will learn complete guide to a build a PWA to build a web based application for iOS and Android devices.
The document provides instructions for installing Microsoft .NET Framework 4.5 on a Raspberry Pi using Wine and an x86 emulator. It describes downloading and installing ExaGear Desktop to emulate an x86 system on the Raspberry Pi. It then guides installing Wine within the emulated system and using Winetricks to install .NET Framework 4.0. It explains a trick to installing 4.5 by first configuring Wine for Windows 7 before downloading and running the 4.5 installer executable under Wine.
The document provides instructions for installing Microsoft .NET Framework 4.5 on a Raspberry Pi using Wine and an x86 emulator. It describes downloading and installing ExaGear Desktop to emulate an x86 system on the Raspberry Pi. It then guides installing Wine within the emulated system and using Winetricks to install .NET Framework 4.0. It explains a trick to installing 4.5 by first configuring Wine for Windows 7 before downloading and launching the 4.5 installer executable under Wine.
Drupal 8 - Improving your development workflowvaluebound
Planning to improve software development workflow for your new project? Get answers to your questions. In this presentation, Malabya of Valuebound will help you learn about the codebase, local development, composer workflow and deployment of a project.
The document discusses modern web technologies including Composer, Laravel, Sass, Compass, Node.js, Bower, Gulp and SemanticUI. It provides overviews of each tool, why they are useful, how to install them and includes demos. Key topics covered are dependency management with Composer, PHP framework Laravel, CSS preprocessor Sass and framework Compass, front-end package manager Bower, task runner Gulp and theming framework SemanticUI.
Dependent things dependency management for apple sw - slideshareCavelle Benjamin
This document summarizes options for dependency management in iOS development projects. It discusses Cocoapods, Carthage, and Swift Package Manager, outlining the basic steps to set up each and comparing their key features. Cocoapods is the most full-featured but written in Ruby. Carthage is simpler but requires more manual setup. Swift Package Manager is built into Swift but still maturing. The document provides an overview to help developers choose the right approach for their needs and project requirements.
This document discusses setting up a local development environment for Drupal. It covers installing and configuring XAMPP, a local web server package, downloading and installing Drupal, and installing useful development tools like Git, Drush, and Sass. XAMPP is used to create a local server for testing Drupal sites without needing a live server. Drupal is downloaded and its installation wizard is used to set up a new Drupal site. Git is installed for version control and Drush provides commands for common Drupal tasks from the command line. Sass is also installed to allow writing CSS in a more reusable, object-oriented way.
This document provides instructions for setting up the development environment for building mobile apps with React Native using Expo. It outlines 10 steps: 1) downloading Expo XDE, 2) installing Expo client apps, 3) running a "Hello World" app, 4) installing a code editor like Atom or Visual Studio Code, 5) installing Git, 6) installing Node.js, 7) optionally installing the Android emulator Genymotion, 8) adding VS Code extensions, 9) optionally installing ESLint for linting, and 10) testing the installation and basic Expo commands.
Robot Framework is a generic test automation framework for acceptance and regression testing. It has easy-to-use tabular test data syntax and supports test automation using the keyword-driven testing approach. Tests are created using test cases composed of test data and keywords. Keywords are provided by test libraries that extend the functionality of the framework. Robot Framework can be installed on Windows using pip and supports creating and running tests from the command line or using the RIDE test data editor.
Cross Browser Automation Testing Using WatirSarah Elson
We are living in an era where software development demands for automation. Software development methodologies such as RAD(Rapid Application Development), Agile and so on requires you to incorporate automation testing as a part of your release cycle. There exist numerous test automation frameworks used for automation testing. Today, I will be picking up Watir an open source, selenium-based web driver used for browser automation. Cross browser automation testing using Watir would help you to ensure a good rendering user interface of your web app. If you are a beginner to automation testing and are unaware of basics then don’t worry as I will also be talking about browser automation, cross browser automation, parallel testing and what makes Watir special than other several tools and libraries. Without further ado, here we go!
5/13/13 presentation to Austin DevOps Meetup Group, describing our system for deploying 15 websites and supporting services in multiple languages to bare redhat 6 VMs. All system-wide software is installed using RPMs, and all application software is installed using GIT or Tarball.
This document provides instructions for setting up a Ruby on Rails development environment on Cloud9 using the suspenders gem. It describes installing Ruby 2.2.3, the suspenders gem, and its dependencies. It then explains how to create a new Rails project with suspenders and replace PostgreSQL with SQLite3. The document concludes by explaining how to launch the Rails server and install the simple_form gem for forms.
Installing Rhapsody 8.2.x Designer/Architect with Cygwin gcc compilerFraser Chadburn
This video gives detailed screenshots for installing IBM Rational Rhapsody. The suggested install is to install all the Editions and then modify the .ini file. The slide deck includes detail on downloading a minimal Cygwin (i.e. tiny amount) of the gcc tool-chain to build system sims. It also has test instructions that can be done to check the install. Rhapsody 8.2.1 is used.
Similar to Step by step guide to create theme for liferay dxp 7 (20)
Embarking on a software development journey for startups can be a thrilling yet daunting experience. It's a path filled with twists and turns, and challenges that can make or break your success. But fear not, for there are solutions and proven strategies that can help you achieve your goal of successful product development. Join us on this exciting adventure as we explore the secrets to unlocking your startup's full potentia
This blog includes detailed information about how chatbot empowers healthcare ecosystem. It also encompasses data based insights of healthcare chatbot advantages and attributes of an effective Chatbot.
This document provides a step-by-step guide to configure document generation functionality in Microsoft Dynamics 365. It describes: [1] how to create and configure document templates by selecting entities, downloading templates, and tagging fields; [2] how to provide a UI for users to select templates; and [3] how to implement a CRM plugin using Open XML SDK to populate templates with CRM data. The goal is to generate documents like sales quotes and invoices by extracting and populating relevant CRM data using predefined Word templates.
This blog is about conquering the operational challenges such as Beacon range detection and signal fluctuation that are encountered while getting the consistent Beacon behavior for Android and iOS mobile devices.
This blog is mainly fleshing the light over strengths and limitations of one of the most popular enterprise portal Liferay DXP. It caters in-depth information about Liferay DXP’s characteristics encompassing from architecture advantages to user experience.
Realm Mobile Platform allows real-time data synchronization between client apps and a Realm Object Server. It supports hosting on-premises or in the cloud, uses an object-based model, and enables offline-first capabilities. A demo "Hello World" app allows two users on different devices to draw sketches simultaneously using virtual pencils, with each user seeing real-time updates to the other's drawing. The app syncs drawing coordinate data to the Realm server, which then pushes updates to the other user's client. This demonstrates Realm's ability to synchronize data in real-time across multiple clients.
This blog is about utilizing IBM Bluemix’s readily available environment capabilities for the development of IoT application by integrating it with IBMWatson, Raspberry Pi and virtual device.
This blog is about creation of a ‘Hello World’ Angular 2.0 Application integrated with Liferay DXP to fetch Liferay’s OOTB advantages. Such integration can enable quick development of secured application that provides boosted digital experience to the user.
This presentation is about how to register the virtual device and analyze the device data. For more information please visit http://www.azilen.com/blog/step-by-step-guide-to-develop-iot-application-using-ibm-bluemix/
Azilen has done Web based platform to manage and automate event management services called Analytics & ETL based BI Solutions on AWS Cloud using Mule ESB, Spring Boot, Angular JS, MongoDB, Hibernate and PostgreSQL.
Azilen has Built Advance Risk Management & Mitigation System with Complex requirement & Also upgraded to Liferay 6.2. We have used various technologies such as Liferay, Spring, Yui & Solr.
Server Driven User Interface (SDUI) is a framework that allows mobile app user interfaces and data structures to be dynamically updated from a server after an app has been deployed. This eliminates the need for frequent app updates. SDUI uses a single code base to manage multiple UI releases and profile-driven interfaces, allowing developers to balance minimum viable products with continuous updates. It maintains UI components in a database on a server, fetching them through JSON calls to dynamically display the appropriate interface for each user's profile.
In this Blog, we are going to explore Liferay’s out of the box (OOTB) feature Portlet Sharing which proffers customized Widget publishing at third party websites or applications through very simple techniques.
With the introduction of new significant software platforms and several hardware products along with announcements of meaningful feature upgrades - WWDC 17 was Apple’s one of the biggest events in years.
This document summarizes the third blog post in a series about automating home appliances using a Raspberry Pi. It describes how the application was created as a captive portal to allow remote access. The application is hosted on the Raspberry Pi and built with Spring Boot for its lightweight and packageable qualities. It also demonstrates the real-time use including easy setup, learning modes to program gestures or numbers to commands, and execution mode to activate those commands remotely.
RFID systems are an emerging technology that can provide many benefits for asset management by allowing automatic tracking of assets. Key advantages of using RFID for asset management include improved inventory management and supply chain visibility, increased asset security, automated record keeping and compliance, reduced operating costs, and increased workflow efficiency. Industries like logistics and aviation have already seen positive results from implementing RFID solutions for asset tracking, while retail is also starting to experiment with the technology. RFID remains a young technology with opportunities for further development and customization of system solutions.
The document describes the process of developing an application on Raspberry Pi that uses computer vision and Java APIs to detect hand gestures and control home appliances via IR signals. The application continuously captures camera input, detects hand gestures using OpenCV, and passes appropriate signals to an IR device to control devices like a TV. Key steps include connecting the IR device to the application via SmartConfig, teaching gestures during a learning mode, and executing gestures during operation to control devices in real-time. The goal is to implement intelligent home automation through contactless hand gesture recognition.
We have achieved gesture recognition for implementing functionality like Turning On-Off, Increasing and decreasing the temperature for Air-conditioner and Turning On-Off for Television. In This blog talks about the complete step by step guide to setup OpenCV and JavaCV on Raspberry Pi.
TrustArc Webinar - 2024 Global Privacy SurveyTrustArc
How does your privacy program stack up against your peers? What challenges are privacy teams tackling and prioritizing in 2024?
In the fifth annual Global Privacy Benchmarks Survey, we asked over 1,800 global privacy professionals and business executives to share their perspectives on the current state of privacy inside and outside of their organizations. This year’s report focused on emerging areas of importance for privacy and compliance professionals, including considerations and implications of Artificial Intelligence (AI) technologies, building brand trust, and different approaches for achieving higher privacy competence scores.
See how organizational priorities and strategic approaches to data security and privacy are evolving around the globe.
This webinar will review:
- The top 10 privacy insights from the fifth annual Global Privacy Benchmarks Survey
- The top challenges for privacy leaders, practitioners, and organizations in 2024
- Key themes to consider in developing and maintaining your privacy program
Best 20 SEO Techniques To Improve Website Visibility In SERPPixlogix Infotech
Boost your website's visibility with proven SEO techniques! Our latest blog dives into essential strategies to enhance your online presence, increase traffic, and rank higher on search engines. From keyword optimization to quality content creation, learn how to make your site stand out in the crowded digital landscape. Discover actionable tips and expert insights to elevate your SEO game.
GraphRAG for Life Science to increase LLM accuracyTomaz Bratanic
GraphRAG for life science domain, where you retriever information from biomedical knowledge graphs using LLMs to increase the accuracy and performance of generated answers
Taking AI to the Next Level in Manufacturing.pdfssuserfac0301
Read Taking AI to the Next Level in Manufacturing to gain insights on AI adoption in the manufacturing industry, such as:
1. How quickly AI is being implemented in manufacturing.
2. Which barriers stand in the way of AI adoption.
3. How data quality and governance form the backbone of AI.
4. Organizational processes and structures that may inhibit effective AI adoption.
6. Ideas and approaches to help build your organization's AI strategy.
HCL Notes and Domino License Cost Reduction in the World of DLAUpanagenda
Webinar Recording: https://www.panagenda.com/webinars/hcl-notes-and-domino-license-cost-reduction-in-the-world-of-dlau/
The introduction of DLAU and the CCB & CCX licensing model caused quite a stir in the HCL community. As a Notes and Domino customer, you may have faced challenges with unexpected user counts and license costs. You probably have questions on how this new licensing approach works and how to benefit from it. Most importantly, you likely have budget constraints and want to save money where possible. Don’t worry, we can help with all of this!
We’ll show you how to fix common misconfigurations that cause higher-than-expected user counts, and how to identify accounts which you can deactivate to save money. There are also frequent patterns that can cause unnecessary cost, like using a person document instead of a mail-in for shared mailboxes. We’ll provide examples and solutions for those as well. And naturally we’ll explain the new licensing model.
Join HCL Ambassador Marc Thomas in this webinar with a special guest appearance from Franz Walder. It will give you the tools and know-how to stay on top of what is going on with Domino licensing. You will be able lower your cost through an optimized configuration and keep it low going forward.
These topics will be covered
- Reducing license cost by finding and fixing misconfigurations and superfluous accounts
- How do CCB and CCX licenses really work?
- Understanding the DLAU tool and how to best utilize it
- Tips for common problem areas, like team mailboxes, functional/test users, etc
- Practical examples and best practices to implement right away
Skybuffer AI: Advanced Conversational and Generative AI Solution on SAP Busin...Tatiana Kojar
Skybuffer AI, built on the robust SAP Business Technology Platform (SAP BTP), is the latest and most advanced version of our AI development, reaffirming our commitment to delivering top-tier AI solutions. Skybuffer AI harnesses all the innovative capabilities of the SAP BTP in the AI domain, from Conversational AI to cutting-edge Generative AI and Retrieval-Augmented Generation (RAG). It also helps SAP customers safeguard their investments into SAP Conversational AI and ensure a seamless, one-click transition to SAP Business AI.
With Skybuffer AI, various AI models can be integrated into a single communication channel such as Microsoft Teams. This integration empowers business users with insights drawn from SAP backend systems, enterprise documents, and the expansive knowledge of Generative AI. And the best part of it is that it is all managed through our intuitive no-code Action Server interface, requiring no extensive coding knowledge and making the advanced AI accessible to more users.
leewayhertz.com-AI in predictive maintenance Use cases technologies benefits ...alexjohnson7307
Predictive maintenance is a proactive approach that anticipates equipment failures before they happen. At the forefront of this innovative strategy is Artificial Intelligence (AI), which brings unprecedented precision and efficiency. AI in predictive maintenance is transforming industries by reducing downtime, minimizing costs, and enhancing productivity.
Main news related to the CCS TSI 2023 (2023/1695)Jakub Marek
An English 🇬🇧 translation of a presentation to the speech I gave about the main changes brought by CCS TSI 2023 at the biggest Czech conference on Communications and signalling systems on Railways, which was held in Clarion Hotel Olomouc from 7th to 9th November 2023 (konferenceszt.cz). Attended by around 500 participants and 200 on-line followers.
The original Czech 🇨🇿 version of the presentation can be found here: https://www.slideshare.net/slideshow/hlavni-novinky-souvisejici-s-ccs-tsi-2023-2023-1695/269688092 .
The videorecording (in Czech) from the presentation is available here: https://youtu.be/WzjJWm4IyPk?si=SImb06tuXGb30BEH .
Monitoring and Managing Anomaly Detection on OpenShift.pdfTosin Akinosho
Monitoring and Managing Anomaly Detection on OpenShift
Overview
Dive into the world of anomaly detection on edge devices with our comprehensive hands-on tutorial. This SlideShare presentation will guide you through the entire process, from data collection and model training to edge deployment and real-time monitoring. Perfect for those looking to implement robust anomaly detection systems on resource-constrained IoT/edge devices.
Key Topics Covered
1. Introduction to Anomaly Detection
- Understand the fundamentals of anomaly detection and its importance in identifying unusual behavior or failures in systems.
2. Understanding Edge (IoT)
- Learn about edge computing and IoT, and how they enable real-time data processing and decision-making at the source.
3. What is ArgoCD?
- Discover ArgoCD, a declarative, GitOps continuous delivery tool for Kubernetes, and its role in deploying applications on edge devices.
4. Deployment Using ArgoCD for Edge Devices
- Step-by-step guide on deploying anomaly detection models on edge devices using ArgoCD.
5. Introduction to Apache Kafka and S3
- Explore Apache Kafka for real-time data streaming and Amazon S3 for scalable storage solutions.
6. Viewing Kafka Messages in the Data Lake
- Learn how to view and analyze Kafka messages stored in a data lake for better insights.
7. What is Prometheus?
- Get to know Prometheus, an open-source monitoring and alerting toolkit, and its application in monitoring edge devices.
8. Monitoring Application Metrics with Prometheus
- Detailed instructions on setting up Prometheus to monitor the performance and health of your anomaly detection system.
9. What is Camel K?
- Introduction to Camel K, a lightweight integration framework built on Apache Camel, designed for Kubernetes.
10. Configuring Camel K Integrations for Data Pipelines
- Learn how to configure Camel K for seamless data pipeline integrations in your anomaly detection workflow.
11. What is a Jupyter Notebook?
- Overview of Jupyter Notebooks, an open-source web application for creating and sharing documents with live code, equations, visualizations, and narrative text.
12. Jupyter Notebooks with Code Examples
- Hands-on examples and code snippets in Jupyter Notebooks to help you implement and test anomaly detection models.
A Comprehensive Guide to DeFi Development Services in 2024Intelisync
DeFi represents a paradigm shift in the financial industry. Instead of relying on traditional, centralized institutions like banks, DeFi leverages blockchain technology to create a decentralized network of financial services. This means that financial transactions can occur directly between parties, without intermediaries, using smart contracts on platforms like Ethereum.
In 2024, we are witnessing an explosion of new DeFi projects and protocols, each pushing the boundaries of what’s possible in finance.
In summary, DeFi in 2024 is not just a trend; it’s a revolution that democratizes finance, enhances security and transparency, and fosters continuous innovation. As we proceed through this presentation, we'll explore the various components and services of DeFi in detail, shedding light on how they are transforming the financial landscape.
At Intelisync, we specialize in providing comprehensive DeFi development services tailored to meet the unique needs of our clients. From smart contract development to dApp creation and security audits, we ensure that your DeFi project is built with innovation, security, and scalability in mind. Trust Intelisync to guide you through the intricate landscape of decentralized finance and unlock the full potential of blockchain technology.
Ready to take your DeFi project to the next level? Partner with Intelisync for expert DeFi development services today!
How to Interpret Trends in the Kalyan Rajdhani Mix Chart.pdfChart Kalyan
A Mix Chart displays historical data of numbers in a graphical or tabular form. The Kalyan Rajdhani Mix Chart specifically shows the results of a sequence of numbers over different periods.
Unlock the Future of Search with MongoDB Atlas_ Vector Search Unleashed.pdfMalak Abu Hammad
Discover how MongoDB Atlas and vector search technology can revolutionize your application's search capabilities. This comprehensive presentation covers:
* What is Vector Search?
* Importance and benefits of vector search
* Practical use cases across various industries
* Step-by-step implementation guide
* Live demos with code snippets
* Enhancing LLM capabilities with vector search
* Best practices and optimization strategies
Perfect for developers, AI enthusiasts, and tech leaders. Learn how to leverage MongoDB Atlas to deliver highly relevant, context-aware search results, transforming your data retrieval process. Stay ahead in tech innovation and maximize the potential of your applications.
#MongoDB #VectorSearch #AI #SemanticSearch #TechInnovation #DataScience #LLM #MachineLearning #SearchTechnology
Letter and Document Automation for Bonterra Impact Management (fka Social Sol...Jeffrey Haguewood
Sidekick Solutions uses Bonterra Impact Management (fka Social Solutions Apricot) and automation solutions to integrate data for business workflows.
We believe integration and automation are essential to user experience and the promise of efficient work through technology. Automation is the critical ingredient to realizing that full vision. We develop integration products and services for Bonterra Case Management software to support the deployment of automations for a variety of use cases.
This video focuses on automated letter generation for Bonterra Impact Management using Google Workspace or Microsoft 365.
Interested in deploying letter generation automations for Bonterra Impact Management? Contact us at sales@sidekicksolutionsllc.com to discuss next steps.
Salesforce Integration for Bonterra Impact Management (fka Social Solutions A...Jeffrey Haguewood
Sidekick Solutions uses Bonterra Impact Management (fka Social Solutions Apricot) and automation solutions to integrate data for business workflows.
We believe integration and automation are essential to user experience and the promise of efficient work through technology. Automation is the critical ingredient to realizing that full vision. We develop integration products and services for Bonterra Case Management software to support the deployment of automations for a variety of use cases.
This video focuses on integration of Salesforce with Bonterra Impact Management.
Interested in deploying an integration with Salesforce for Bonterra Impact Management? Contact us at sales@sidekicksolutionsllc.com to discuss next steps.
Programming Foundation Models with DSPy - Meetup SlidesZilliz
Prompting language models is hard, while programming language models is easy. In this talk, I will discuss the state-of-the-art framework DSPy for programming foundation models with its powerful optimizers and runtime constraint system.
Programming Foundation Models with DSPy - Meetup Slides
Step by step guide to create theme for liferay dxp 7
1. Step by Step Guide to Create Theme for
Liferay DXP 7
2. Introduction of Liferay Digital Experience Platform
(DXP) 7
We have been working with Liferay platform ever since the release of Liferay
3.6 for developing enterprise web applications and over this time , not only
we have seen the platform evolve and grow significantly with each release, it
has also been recognized as a leader in the “Magic Quadrant for Horizontal
Portals”– an yearly publication from Gartner ( A leading IT research firm), for
the fifth year in a row.
With introduction of Liferay Digital Experience Platform (DXP) 7, creation of
custom themes became a complex process, compared to Liferay 6.2 where
themes can be easily created using Liferay developer studio and Eclipse.
3. Mainly 3 steps are included:
• Prerequisite (i.e. environment) to start theme development
• Steps to build theme.
• Deploy theme
Step by Step Guide for Creating Your Own Custom
Theme for Liferay 7.0.
4. Setup of Liferay Theme
Theme generator has few inline dependencies. To make theme generator
work, you need to follow following steps to resolve its dependencies.
• Uninstall latest version of node & Ruby and Rails if installe
• Install Node v4.2.2 via the link –
https://nodejs.org/download/release/v4.2.2/node-v4.2.2-x64.msi
• Open the Command Prompt and Check the node version,
=> Type command –
1 node –v
7. => Go to C:Users {current User} for Example: C:Usersdharam.mali
=> Type
1 copy NUL .npmrc
=> You can see-> .npmrc file is created at C:Usersdharam.mali
=> Open .npmrc file and add following path:
prefix=c:Usersdharam.mali.npm-packages
8. =>NPM_PACKAGES (Add new System Variable) = C:Users
dharam.mali.npm-packages
=>NODE_PATH (Add new System Variable) =
%NODE_PATH%;c:Usersdharam.mali.npm-packagesnode_modules
=> Add to (user variable) PATH = %NPM_PACKAGES%
Close the Command Prompt (CMD) and open again with Administrator, now
Install Yeoman and gulp globally by executing the following command
(It will take some time)
1 npm install -g yo gulp
9. Now you’re ready to install the Themes Generator. Install it by executing this
command:
Once everything is installed without error, then install Sass on Windows.
Install Ruby Sass and Compass by below steps
Download Ruby from: http://rubyinstaller.org/downloads/
=> Use the latest version: Ruby 2.3.1 (x64)
1 npm install -g generator-liferay-theme
10. Liferay Theme Installation:
a. Install it in Program file
b. Make sure to tick
i. “Add Ruby executable to you PATH
ii. Associate .rb and……
11.
12. iii. Open CMD with administrator, type
Output: 2.5.1
Now install SASS Compiler for CSS
a. To avoid error we will change source path for Ruby,
=> Open CMD with administrator, type:
b. Install
1 gem -v
1 gem sources -a http://rubygems.org/
1 gem install sass compass
13. Now it’s time to create theme!
Go to directory when you want to create your theme: (for Example:
E:projectsliferay-developer-studioworkspaceliferay-workspacethemes)
a. Open CMD with Administrator,
type :
1 yo liferay-theme
15. b. Now your theme is created, see folder created named “MyFirstTheme”
c. Go to your theme folder E:projectsliferay-developer-
studioworkspaceliferay-workspacethemesmyfirsttheme-theme
d. In CMD type:
1 npm install
16. Go to your theme folder in cmd, e.g. E:projectsliferay-developer-
studioworkspaceliferay-workspacethemesmyfirsttheme-theme
Type :
Deploy theme in Liferay
1 gulp build
17.
18. Once you get message “Finished ‘build’ after 17 s” type:
1 gulp deploy
19. Wrap-Up
In this PPT, we have provided step by step Installation guide and error free
solution for developers which helps in time efficient and user friendly
installation of theme in Liferay 7.
Talk to our Liferay consultant to know more about Liferay DXP(Digital
Experience Platform).