SlideShare a Scribd company logo
The new kid on the block
Hexavalent Vaccines!
Dr. Gaurav Gupta,
Pediatrician,
04th Aug 2017
Conflict of Interest
• Received grants from various vaccine
manufacturers including
– Sanofi Pasteur
– GSK
– Abbott
– Novartis
WIIFY
• Need for Combination Vaccines
• Safety, efficacy of Hexavalent Vaccines
• Latest Data
• Scheduling
• Some Unique Features
What I won’t be talking about?
• aP versus wP
• Components
• Pricing
Approximate duration of immunity after natural
infection and after vaccination
COMPONENT COMPANY EFFICACY
1C Amvax, JNIH 71 TO 78%
2C SKB 59%
2C Pasteur Merieux 85%
3C SKB (GSK) 84 %
4C LEDERLE - an european vacc .
not marketed
79 %
5C Connaught (Pasteur) 85 %
DTwP VARIOUS countries 36 TO 96 %
Summary of vaccine efficacy: Cochrane 2012 (and 14)
Statements of Vaccines Experts/Health Authorities regarding number of
Pertussis components in licensed vaccines:
• “There are now only 3 broadly distributed acellular pertussis vaccines: the
French 2-component, the Belgian 3-component, and the Canadian 5-
component vaccines. National surveillance data have clearly demonstrated
the ability of each vaccine to accomplish excellent control of pertussis.”
Plotkin et al.
VACCINES 6th
ed.
• The European scientific panel on childhood immunization does not discuss
the number and types of acP vaccines components, since effectiveness data
have not shown any significant differences.”
European CDC
• “Point estimate of vaccine efficacy ranged from 80% to 85% for vaccines
currently licensed in the United States. Confidence intervals for vaccine
efficacy overlap, suggesting that none of the vaccines is significantly more
effective than the other.”
CDC Pink Book
12th ed.
• “long-term large scale use of licensed 2-component aP-containing vaccines
(primarily in Sweden and Japan) and of 1-component aP vaccine in the
national Danish immunization programme, all of these aP-containing vaccines
demonstrated high levels of effectiveness in preventing pertussis irrespective
of antigen content.”
WHO Pertussis
Vaccines
Position Paper 7
Indian Pediatrics, Jan 2017
Combination Vaccines – Why?
• Simplified Immunization Schedule
• Less injections – Complications
• Better Compliance
• Lesser administration time/ costs/ space
Combination vaccines – Why not?
• Adverse effects maybe more common
• Reduced Immunogenicity
• May have lesser shelf life
• Technically difficult
• Expensive
Hexavalent Vaccines across the World
• Hexavac – discontinued
• Infanrix Hexa – GSK – with lyophilised Hib
• Hexaxim – Fully liquid 6 in 1 with DPT + Hep B
+ Hib + IPV (HEXAVAC contained a smaller amount - 5 μg of the
hepatitis B antigen produced in Saccharomyces cerevisiae yeast. In contrast,
Hexaxim contains 10 μg of the hepatitis B antigen (HBsAg) produced in
Hansenula polymorpha yeast)
Registered in more than 100 countries
Efficacy
• As compared to other aP vaccines
• As compared to wP vaccines, specifically
against Pertussis
HEXAXIM® immunogenicity assessment - Overview
● 8 primary series studies
● 3 primary schedules (6, 10 & 14 weeks; 2, 3 & 4 and 2, 4 & 6 months)
● With or without hepatitis B vaccination at birth
● versus different control vaccines:
• wP-based combination vaccines
• PENTAXIM® + standalone hepatitis B vaccine
• INFANRIX-HEXA (DTaP-IPV-HBV//Hib***)
• Concomitantly with other routine pediatric vaccines
*Tritanrix®-HepB/Hib **CombAct-HIB® *** Infanrix Hexa®
0
20
40
60
80
100
D T PT FHA PV1 PV2 PV3 HBsAg Hib
Immunogenicity v/s wP vaccines
HEXAXIM® induces high immune responses similar
to those of wP-based combination vaccines
Seroprotection/seroconversion rates after the 3rd dose of HEXA or a wP-based combination
vaccine in infants vaccinated at 6,10 &14 weeks of age
(South Africa)1 (No HepB vaccine at birth, no concomitant vaccine)
Seroprotection/
Seroconversionrates(%)
D T PT FHA PV1,2,3 HBsAg Hib
 0.01 IU/mL 4-fold increase
(pertussis antigens)
1/dil  8  10 mIU/mL  0.15 µg/mL
98 96 100 100
94
83
93
58
100
93
99 100 100 98 96 95 95
100
HEXAXIM® 1
n=220
DTwP//Hib* + OPV + Hep B vaccine 1
n=212
* CombAct-HIB® [1] Madhi et al. PIDJ, 2011;30(4)
0
20
40
60
80
100
D T PT FHA PV1 PV2 PV3 HBsAg Hib
The immune response to all HEXAXIM® antigens is high and similar
to that of PENTAXIM® co-administered with standalone hepatitis B vaccine
Seroprotection/
Seroconversionrates(%)
D T PT FHA PV1,2,3 HBsAg Hib
 0.01 IU/mL 4-fold increase
(pertussis antigens)
1/dil  8  10 mIU/mL  0.15 µg/mL
100 100 100 100
92 93 93 90
100 100 100 100 100 100 99 100
95 97
HEXAXIM®
n=260
PENTAXIM® + Hep B vaccine
n=271
[5] Tregnagui et al. PIDJ, 2011;30(6)
Seroprotection/Seroconversion rates after the 3rd dose of HEXA or PENTA
in infants vaccinated at 2, 4 & 6 months of age
(Argentina)5 (No Hep B vaccine at birth, no concomitant vaccine)
Immunogenicity Vs PENTAXIM®
Safety
HEXAXIM® safety assessment - Overview
Evaluated in 20 clinical trials in more than 6000 infants and toddlers
● 18,000 doses administered to > 6000 infants in 20 clinical trials
● With or without hepatitis B vaccination at birth
● versus different control vaccines:
• wP-based combination vaccines
• PENTAXIM® + standalone hepatitis B vaccine
• INFANRIX-HEXA (DTaP-IPV-HBV//Hib***)
• Concomitantly with other routine pediatric vaccines
[19] Sanofi Pasteur. Data on file
Solicited reactions after any dose of HEXAXIM® or DTwP-HepB//Hib*
in infants vaccinated at 2,4 & 6 months of age (Mexico & Peru)3 (No concomitant vaccine)
0
20
40
60
80
100
Pain Red Swell A Fever Vom Crying Somnol Anor Irr
The reactogenicity of HEXAXIM® is consistently lower than that of
wP-based combination vaccines
Gr3: grade 3 *Tritanrix®-HepB/Hib [3] Macias et al. PIDJ, 2012;31(8)
78 94
59 71
17 36
3 6
43 67
1 6
75 93
4 6
30 31
2 3
78 92
3 5
57 69
5 6 3 5
82 92
46 59
6 10
Reactionincidence(%)
HEXAXIM®
n=1422
DTwP-HepB//Hib*
n=711
Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3
Pain Redness Swelling Fever Vomiting Crying Somnolence Anorexia Irritability
Tolerability Vs. wP vaccines
Indian Data
IMMUNOGENICITY AND SAFETY OF
DTaP-IPV-HB-PRP-T COMBINED
VACCINE GIVEN AT 6, 10 AND 14
WEEKS OF AGE IN INFANTS FROM
INDIA, WHO PREVIOUSLY RECEIVED
A DOSE OF HEP B VACCINE AT BIRTH
Presenting Author: Prof Sanjay Lalwani
Date : 23 January 2016
Venue : PEDICON – Hyderabad
WHO Universal Trial Number (UTN): U1111-1127-6936
Safety: Solicited reactions from D0 to D7, any
grade, after each injection (in %)
22
19%
4.60%
10.30%
13.80%
3.40% 3.40%
11.90%
0.60%
6.50%
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
Tenderness Erythema Swelling
Post Dose 1 Post Dose 2 Post Dose 3
7.5%
9.8%
16.1%
9.8%
6.9%
22.4%
8.6%
3.4%
9.8%
3.4% 3.4%
16.7%
7.1%
3.0%
7.7%
3.0% 3.0%
12.5%
0.0%
10.0%
20.0%
30.0%
40.0%
50.0%
60.0%
70.0%
80.0%
90.0%
100.0%
Fever Vomiting Abnormal
Crying
Drowsiness Loss of
appetite
Irritability
Post Dose 1 Post Dose 2 Post Dose 3
 54.6% experienced at least 1 solicited
systemic reaction.
 Most frequently reported systemic
reaction was irritability (36.2%)
 19.0% of subjects reported fever ; no
Grade 3 fever reported
Injection site reactions
 37.9% experienced at least 1 solicited
injection site reaction, most frequent being
tenderness (30.5%).
 2.9% of subjects reported Grade 3 reactions
 The incidence lowered with successive
doses with no Grade 3 reaction reported
after the third dose
Systemic reactions
Safety in primary and booster series
Key points
Better tolerated than wP-based combination vaccines
Comparable to other licensed aP-based combination
vaccines (PENTAXIM®, Infanrix Hexa)
The safety and reactogenicity - not affected by the
administration of hepatitis B vaccine at birth
* Infanrix® Hexa
Ekdum Latest!
 Higher performance and safety of acellular pertussis vaccine versus
whole cell vaccine.
 Acceptable efficacy in high risk adults as well.
 Study provides evidence in favor of introduction of acellular vaccine in
the National Program
 HB vaccination at birth, then comparing immunogenicity and safety of
Hexaxim at 2, 4, 6 months of age v/s Pentaxim at 2, 4, 6 months &
standalone HB vaccine at 1 and 6 months.
 4 consecutive doses of HB-containing vaccine in the Hexaxim group
(i.e. birth, 2, 4, 6 months) versus three HB-containing vaccine doses
in the Pentaxim and HB group (i.e. birth, 1, 6 months).
 Hexaxim at 2, 4, 6 months induced anti-HB seroprotective titers that
were slightly higher than following monovalent HB vaccine at 0, 1, 6
month, with no difference in reactogenicity.
http://dx.doi.org/10.1016/j.vaccine.2017.05.062
What Schedule works?
WHO position paper on Hepatitis B
2017
 The birth dose should be followed by 2 or 3 additional doses to complete
the primary series.
Both of the following options are considered appropriate:
(i) a 3-dose schedule - birth dose + first and third doses of DTP-containing
vaccine; OR
(ii) a 4 dose schedule - birth dose + 3 doses, usually given with other routine
infant vaccines; NO HARM. The interval between doses should be at least
4 weeks.
 There are no differences in the seroprotection outcomes (anti-HBs
antibody concentrations, seroprotection rates of vaccinees) of schedules
with intervals of 1, 2, or 5 months between primary doses.
 Longer intervals between doses appear to increase the final anti-HBs
antibody concentrations, but not the seroconversion rates
7 JULY 2017, 92th YEAR / 7 JUILLET 2017, 92e ANNÉE No 27, 2017, 92, 369–392
Recommendations
IAP
HepB seroprotection rates (%≥10mIU/ml) and GMT
(IU/mL) following different HepB immunization regimen
HB
regimen
Infant series
product &
regimen
Post Infant series
responses
Toddler
product
Pre
toodler
booster
Post
toddler
booster
0 + 2 + 1 HXM 3-58 97,2% - 401 HXM (11/12) 87,6% - 76 96,4% - 1,370
0 + 3 + 0
HXM 2-4-611 99,2% - 1,148 -
HXM 2-4-612 99,2% - 986 -
0 + 3 + 1
HXM 2-3-45 94,0% - 149 HXM (15/18) 80,7% - 44 97,3% - 1,379
HXM 2-3-49 97,5% - 242
96,1% - 267
HXM (12)
90,1% - 76
91,4% - 95
98,9% - 2,230
98,9% - 2,233
HXM 2-3-410 95,7% - 207 HXM (11/18) Ongoing Ongoing
HXM 2-4-62 98,3% - 1,142 HXM (15/18) 89,8% - 93 99,4% - 2,553
HXM 6-10-143,4 95,7% - 330 HXM (15/18) 78,9% - 51 98,5% - 4,630
1 + 3 + 0
HXM 6-10-147 100% - 2,491 -
HXM 2-4-66 99,5% - 2,477 -
1 + 3 + 1
HXM 6-10-143,4 99,0% - 1,913 HXM (15/18) 94,7% - 228 100% - 44,893
HXM 2-4-61 99,7% - 3,013
HXM (12/18) 97,5% - 386 99,7% - 8,462
IH (12/18) 97,7% - 406 99,5% - 11,218
IH 2-4-62 100% - 2,766 HXM (15/18) 99,2% - 336 100% - 9,688
1. Lopez P & al. ICID 2012 & ESPID 2014 2. Aquino A & al. Vaccine 2012 3. Madhi S & al. PIDJ 2011
4. Madhi S & al. PIDJ 2013 5. Ceyhan M & al. ACPID 2010 6. Kosalaraska P & al. Int JID 2011
7. Lalwani S & al. PEDICON 2016 8. Vesikari T & al. ESPID 2015 9. Vesikari T & al. ESPID 2015 and 2016
10. Prymula R & al. ESPID 2016 11. Tregnaghi MW & al. PIDJ 2011 12. Lanata C & al. Vaccine & Vaccinations 2012
Features
Hepatitis B antigen: Source
Produced using the patented Hansenula
polymorpha yeast expression system:
● Consistent high quality and reliable supply
● No need for methanol as solvent (used with
other yeast expression system)5
Manufactured and controlled in Sanofi
Pasteur’s state-of-the-art facility in Argentina
● Completely dedicated to this new hepatitis B
antigen
Produced exclusively for use in HEXAXIM®
[5] Celik. Biotechnol Adv, 2012;30(5) [6] Shouval. J Hepatol, 2003;39(Suppl1)
Registered in more than 100 countries
Technological innovation
Office practice suggestions?
FAQs
What to do with children having received all
aP?
How to counsel parents regarding wP & aP
vaccines?
THANK YOU
docgaurav@gmail.com
Missed something?
Get my presentations at
www.slideshare.net/gauravg
Acknowledgement: Dr Sujatha Shetty, Dr Vibhas,
Sanofi Pasteur
Comments/ Questions

More Related Content

What's hot

Antibiotic Uses in Neonates
Antibiotic Uses in NeonatesAntibiotic Uses in Neonates
Antibiotic Uses in Neonates
Sujit Shrestha
 
Growth charts in Neonates- Preterm and term
Growth charts in Neonates- Preterm and termGrowth charts in Neonates- Preterm and term
Growth charts in Neonates- Preterm and term
Sujit Shrestha
 
Approch to cough in children
Approch to cough in childrenApproch to cough in children
Approch to cough in children
HAMAD DHUHAYR
 
Acute flaccid paralysis and Surveillance 2018
Acute flaccid paralysis and Surveillance 2018Acute flaccid paralysis and Surveillance 2018
Acute flaccid paralysis and Surveillance 2018
Raghav Kakar
 
Vaccination in Preterms by - Dr Padmesh - Neonatology
Vaccination in Preterms by  - Dr Padmesh - NeonatologyVaccination in Preterms by  - Dr Padmesh - Neonatology
Vaccination in Preterms by - Dr Padmesh - Neonatology
Dr Padmesh Vadakepat
 
ACUTE RESPIRATORY INFECTIONS/PNEUMONIA
ACUTE RESPIRATORY INFECTIONS/PNEUMONIAACUTE RESPIRATORY INFECTIONS/PNEUMONIA
ACUTE RESPIRATORY INFECTIONS/PNEUMONIA
Drvishal Bathma
 
Malaria IN Pediatrics
Malaria IN  Pediatrics Malaria IN  Pediatrics
Malaria IN Pediatrics
Drsurajkc
 
Perinatal asphyxia
Perinatal asphyxiaPerinatal asphyxia
Perinatal asphyxia
Varsha Shah
 
Latest edition tog updates
Latest edition tog updatesLatest edition tog updates
Latest edition tog updates
Bhargav Kiran
 
Hypoxic Ischemic Encephalopathy
Hypoxic Ischemic EncephalopathyHypoxic Ischemic Encephalopathy
Hypoxic Ischemic Encephalopathy
Yohaimi Cosme Ayala
 
Current Guidelines on Malaria In Children
Current Guidelines on Malaria In ChildrenCurrent Guidelines on Malaria In Children
Current Guidelines on Malaria In Children
Dr Anand Singh
 
Management of systemic fungal infection in newborn
Management of systemic fungal infection in newbornManagement of systemic fungal infection in newborn
Management of systemic fungal infection in newborn
Rizwan Naqishbandi
 
Journal club pediatrics medicine
Journal club pediatrics medicineJournal club pediatrics medicine
Journal club pediatrics medicine
Nehal Shah
 
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRK
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRKAcute respiratory tract infection control programme IMNCI pneumonia Dr GRK
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRK
grkmedico
 
Nocturnal enuresis 2019
Nocturnal enuresis 2019Nocturnal enuresis 2019
Nocturnal enuresis 2019
Hussein Abdeldayem
 
Approach to a child with suspected Immunodeficiency
Approach to a child with suspected ImmunodeficiencyApproach to a child with suspected Immunodeficiency
Approach to a child with suspected Immunodeficiency
DrDilip86
 
Approach to neuroregression
Approach to neuroregressionApproach to neuroregression
Approach to neuroregression
drswarupa
 
Hyponatremia in children
Hyponatremia in  children Hyponatremia in  children
Hyponatremia in children
Abdul Rauf
 
Lactation failure
Lactation failureLactation failure
Lactation failure
Sivakumar K
 
Neonatal seizures
Neonatal seizuresNeonatal seizures
Neonatal seizures
Rakesh Verma
 

What's hot (20)

Antibiotic Uses in Neonates
Antibiotic Uses in NeonatesAntibiotic Uses in Neonates
Antibiotic Uses in Neonates
 
Growth charts in Neonates- Preterm and term
Growth charts in Neonates- Preterm and termGrowth charts in Neonates- Preterm and term
Growth charts in Neonates- Preterm and term
 
Approch to cough in children
Approch to cough in childrenApproch to cough in children
Approch to cough in children
 
Acute flaccid paralysis and Surveillance 2018
Acute flaccid paralysis and Surveillance 2018Acute flaccid paralysis and Surveillance 2018
Acute flaccid paralysis and Surveillance 2018
 
Vaccination in Preterms by - Dr Padmesh - Neonatology
Vaccination in Preterms by  - Dr Padmesh - NeonatologyVaccination in Preterms by  - Dr Padmesh - Neonatology
Vaccination in Preterms by - Dr Padmesh - Neonatology
 
ACUTE RESPIRATORY INFECTIONS/PNEUMONIA
ACUTE RESPIRATORY INFECTIONS/PNEUMONIAACUTE RESPIRATORY INFECTIONS/PNEUMONIA
ACUTE RESPIRATORY INFECTIONS/PNEUMONIA
 
Malaria IN Pediatrics
Malaria IN  Pediatrics Malaria IN  Pediatrics
Malaria IN Pediatrics
 
Perinatal asphyxia
Perinatal asphyxiaPerinatal asphyxia
Perinatal asphyxia
 
Latest edition tog updates
Latest edition tog updatesLatest edition tog updates
Latest edition tog updates
 
Hypoxic Ischemic Encephalopathy
Hypoxic Ischemic EncephalopathyHypoxic Ischemic Encephalopathy
Hypoxic Ischemic Encephalopathy
 
Current Guidelines on Malaria In Children
Current Guidelines on Malaria In ChildrenCurrent Guidelines on Malaria In Children
Current Guidelines on Malaria In Children
 
Management of systemic fungal infection in newborn
Management of systemic fungal infection in newbornManagement of systemic fungal infection in newborn
Management of systemic fungal infection in newborn
 
Journal club pediatrics medicine
Journal club pediatrics medicineJournal club pediatrics medicine
Journal club pediatrics medicine
 
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRK
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRKAcute respiratory tract infection control programme IMNCI pneumonia Dr GRK
Acute respiratory tract infection control programme IMNCI pneumonia Dr GRK
 
Nocturnal enuresis 2019
Nocturnal enuresis 2019Nocturnal enuresis 2019
Nocturnal enuresis 2019
 
Approach to a child with suspected Immunodeficiency
Approach to a child with suspected ImmunodeficiencyApproach to a child with suspected Immunodeficiency
Approach to a child with suspected Immunodeficiency
 
Approach to neuroregression
Approach to neuroregressionApproach to neuroregression
Approach to neuroregression
 
Hyponatremia in children
Hyponatremia in  children Hyponatremia in  children
Hyponatremia in children
 
Lactation failure
Lactation failureLactation failure
Lactation failure
 
Neonatal seizures
Neonatal seizuresNeonatal seizures
Neonatal seizures
 

Similar to Hexaxim rtm dr. gaurav gupta 04 aug 2017

The new kid on the block hexavalent vaccines patiala may 2017
The new kid on the block   hexavalent vaccines patiala may 2017The new kid on the block   hexavalent vaccines patiala may 2017
The new kid on the block hexavalent vaccines patiala may 2017
Gaurav Gupta
 
The new kid on the block - hexavalent vaccines
The new kid on the block - hexavalent vaccinesThe new kid on the block - hexavalent vaccines
The new kid on the block - hexavalent vaccines
Gaurav Gupta
 
Slide RTD Hexaxim.pptx
Slide RTD Hexaxim.pptxSlide RTD Hexaxim.pptx
Slide RTD Hexaxim.pptx
ssuserb76779
 
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
Meningitis Research Foundation
 
Dr.MK Sudarshan
Dr.MK SudarshanDr.MK Sudarshan
Dr.MK Sudarshan
riacon
 
table_1_feb_2023_english.pdf
table_1_feb_2023_english.pdftable_1_feb_2023_english.pdf
table_1_feb_2023_english.pdf
MukhtarYonis1
 
Bacterialvaccine (1).ppt
Bacterialvaccine (1).pptBacterialvaccine (1).ppt
Bacterialvaccine (1).ppt
VandanaVats8
 
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir MadhiPotential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
WAidid
 
Immunization Training Educative ppt.ppt.
Immunization Training Educative ppt.ppt.Immunization Training Educative ppt.ppt.
Immunization Training Educative ppt.ppt.
chaperonehealthcare
 
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
Meningitis Research Foundation
 
Designing vaccines for specific populations and germs - Slides by Professor E...
Designing vaccines for specific populations and germs - Slides by Professor E...Designing vaccines for specific populations and germs - Slides by Professor E...
Designing vaccines for specific populations and germs - Slides by Professor E...
WAidid
 
Early Onset Neonatal Sepsis questions and controversies
Early Onset Neonatal Sepsis  questions and controversiesEarly Onset Neonatal Sepsis  questions and controversies
Early Onset Neonatal Sepsis questions and controversies
Christian Medical College & Hospital
 
Immunization routine table2
Immunization routine table2Immunization routine table2
Immunization routine table2
jhansi94944
 
VACCINOLOGY.pptx
VACCINOLOGY.pptxVACCINOLOGY.pptx
VACCINOLOGY.pptx
BhavyaRKrishnan
 
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
Gaurav Gupta
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
jyothi132223
 
Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)
mandar haval
 
Current challenges in pertussis prevention gaurav gupta - sept 2016
Current challenges in pertussis prevention   gaurav gupta - sept 2016Current challenges in pertussis prevention   gaurav gupta - sept 2016
Current challenges in pertussis prevention gaurav gupta - sept 2016
Gaurav Gupta
 
0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture
ANJUMKHATUN3
 
NEWER VIRAL VACCINES - presentation.pptx
NEWER VIRAL VACCINES - presentation.pptxNEWER VIRAL VACCINES - presentation.pptx
NEWER VIRAL VACCINES - presentation.pptx
Dr. Nagendra Kumar
 

Similar to Hexaxim rtm dr. gaurav gupta 04 aug 2017 (20)

The new kid on the block hexavalent vaccines patiala may 2017
The new kid on the block   hexavalent vaccines patiala may 2017The new kid on the block   hexavalent vaccines patiala may 2017
The new kid on the block hexavalent vaccines patiala may 2017
 
The new kid on the block - hexavalent vaccines
The new kid on the block - hexavalent vaccinesThe new kid on the block - hexavalent vaccines
The new kid on the block - hexavalent vaccines
 
Slide RTD Hexaxim.pptx
Slide RTD Hexaxim.pptxSlide RTD Hexaxim.pptx
Slide RTD Hexaxim.pptx
 
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
Dr Mary Ramsay @ MRF's Meningitis & Septicaemia in Children & Adults 2015
 
Dr.MK Sudarshan
Dr.MK SudarshanDr.MK Sudarshan
Dr.MK Sudarshan
 
table_1_feb_2023_english.pdf
table_1_feb_2023_english.pdftable_1_feb_2023_english.pdf
table_1_feb_2023_english.pdf
 
Bacterialvaccine (1).ppt
Bacterialvaccine (1).pptBacterialvaccine (1).ppt
Bacterialvaccine (1).ppt
 
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir MadhiPotential advantages of booster containing PCV regimen - Professor Shabir Madhi
Potential advantages of booster containing PCV regimen - Professor Shabir Madhi
 
Immunization Training Educative ppt.ppt.
Immunization Training Educative ppt.ppt.Immunization Training Educative ppt.ppt.
Immunization Training Educative ppt.ppt.
 
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
Dr Caroline Trotter @ MRF's Meningitis & Septicaemia in Children & Adults 2017
 
Designing vaccines for specific populations and germs - Slides by Professor E...
Designing vaccines for specific populations and germs - Slides by Professor E...Designing vaccines for specific populations and germs - Slides by Professor E...
Designing vaccines for specific populations and germs - Slides by Professor E...
 
Early Onset Neonatal Sepsis questions and controversies
Early Onset Neonatal Sepsis  questions and controversiesEarly Onset Neonatal Sepsis  questions and controversies
Early Onset Neonatal Sepsis questions and controversies
 
Immunization routine table2
Immunization routine table2Immunization routine table2
Immunization routine table2
 
VACCINOLOGY.pptx
VACCINOLOGY.pptxVACCINOLOGY.pptx
VACCINOLOGY.pptx
 
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
Dr. Gaurav Gupta RV 5 Patiala CME 18 feb 2018
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
 
Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)
 
Current challenges in pertussis prevention gaurav gupta - sept 2016
Current challenges in pertussis prevention   gaurav gupta - sept 2016Current challenges in pertussis prevention   gaurav gupta - sept 2016
Current challenges in pertussis prevention gaurav gupta - sept 2016
 
0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture
 
NEWER VIRAL VACCINES - presentation.pptx
NEWER VIRAL VACCINES - presentation.pptxNEWER VIRAL VACCINES - presentation.pptx
NEWER VIRAL VACCINES - presentation.pptx
 

More from Gaurav Gupta

Impact of Social Media on Mental Health.pptx
Impact of Social Media on Mental Health.pptxImpact of Social Media on Mental Health.pptx
Impact of Social Media on Mental Health.pptx
Gaurav Gupta
 
How AI will transform Pediatric Practice - Feb 2024
How AI will transform Pediatric Practice - Feb 2024How AI will transform Pediatric Practice - Feb 2024
How AI will transform Pediatric Practice - Feb 2024
Gaurav Gupta
 
Latest GINA guidelines for Asthma & COVID
Latest GINA guidelines for Asthma & COVIDLatest GINA guidelines for Asthma & COVID
Latest GINA guidelines for Asthma & COVID
Gaurav Gupta
 
Podcasting for pediatricians - part 1
Podcasting for pediatricians - part 1Podcasting for pediatricians - part 1
Podcasting for pediatricians - part 1
Gaurav Gupta
 
Podcast creation for doctors (Pediatricians)
Podcast creation for doctors (Pediatricians)Podcast creation for doctors (Pediatricians)
Podcast creation for doctors (Pediatricians)
Gaurav Gupta
 
Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021 Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021
Gaurav Gupta
 
Hep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in IndiaHep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in India
Gaurav Gupta
 
Prevention of influenza in relation to COVID 19 - the TWINDEMIC
Prevention of influenza in relation to COVID 19 - the TWINDEMICPrevention of influenza in relation to COVID 19 - the TWINDEMIC
Prevention of influenza in relation to COVID 19 - the TWINDEMIC
Gaurav Gupta
 
Top 10 practical questions about Flu Vaccine in India!
Top 10 practical questions about Flu Vaccine in India!Top 10 practical questions about Flu Vaccine in India!
Top 10 practical questions about Flu Vaccine in India!
Gaurav Gupta
 
Helping doctors avoid COVID in their Office Practice
Helping doctors avoid COVID in their Office PracticeHelping doctors avoid COVID in their Office Practice
Helping doctors avoid COVID in their Office Practice
Gaurav Gupta
 
Digital eye strain - Computer vision syndrome for students during Online clas...
Digital eye strain - Computer vision syndrome for students during Online clas...Digital eye strain - Computer vision syndrome for students during Online clas...
Digital eye strain - Computer vision syndrome for students during Online clas...
Gaurav Gupta
 
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic QuestionsPrevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
Gaurav Gupta
 
Digital waste management pedicon 2020 Indore, preconference workshop
Digital waste management   pedicon 2020 Indore, preconference workshopDigital waste management   pedicon 2020 Indore, preconference workshop
Digital waste management pedicon 2020 Indore, preconference workshop
Gaurav Gupta
 
Advertise yourself with simple office tools PEDICON 2020 Indore workshop 8 ...
Advertise yourself with simple office tools   PEDICON 2020 Indore workshop 8 ...Advertise yourself with simple office tools   PEDICON 2020 Indore workshop 8 ...
Advertise yourself with simple office tools PEDICON 2020 Indore workshop 8 ...
Gaurav Gupta
 
Zyvac TCV - The Indian Typhoid Conjugate Vaccine
Zyvac TCV - The Indian Typhoid Conjugate VaccineZyvac TCV - The Indian Typhoid Conjugate Vaccine
Zyvac TCV - The Indian Typhoid Conjugate Vaccine
Gaurav Gupta
 
What nelson forgot 5
What nelson forgot 5What nelson forgot 5
What nelson forgot 5
Gaurav Gupta
 
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
Gaurav Gupta
 
Meningococcal disease sep 2019 National Epidemiology & Indian recommendations
Meningococcal disease   sep 2019 National Epidemiology & Indian recommendationsMeningococcal disease   sep 2019 National Epidemiology & Indian recommendations
Meningococcal disease sep 2019 National Epidemiology & Indian recommendations
Gaurav Gupta
 
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
Gaurav Gupta
 
Research in pediatrician office - my story! NORC Aug 2019 New Delhi
Research in pediatrician office - my story! NORC Aug 2019 New DelhiResearch in pediatrician office - my story! NORC Aug 2019 New Delhi
Research in pediatrician office - my story! NORC Aug 2019 New Delhi
Gaurav Gupta
 

More from Gaurav Gupta (20)

Impact of Social Media on Mental Health.pptx
Impact of Social Media on Mental Health.pptxImpact of Social Media on Mental Health.pptx
Impact of Social Media on Mental Health.pptx
 
How AI will transform Pediatric Practice - Feb 2024
How AI will transform Pediatric Practice - Feb 2024How AI will transform Pediatric Practice - Feb 2024
How AI will transform Pediatric Practice - Feb 2024
 
Latest GINA guidelines for Asthma & COVID
Latest GINA guidelines for Asthma & COVIDLatest GINA guidelines for Asthma & COVID
Latest GINA guidelines for Asthma & COVID
 
Podcasting for pediatricians - part 1
Podcasting for pediatricians - part 1Podcasting for pediatricians - part 1
Podcasting for pediatricians - part 1
 
Podcast creation for doctors (Pediatricians)
Podcast creation for doctors (Pediatricians)Podcast creation for doctors (Pediatricians)
Podcast creation for doctors (Pediatricians)
 
Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021 Rotavirus vaccines in India - Whats new in 2021
Rotavirus vaccines in India - Whats new in 2021
 
Hep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in IndiaHep a Live & Inactivated vaccines in India
Hep a Live & Inactivated vaccines in India
 
Prevention of influenza in relation to COVID 19 - the TWINDEMIC
Prevention of influenza in relation to COVID 19 - the TWINDEMICPrevention of influenza in relation to COVID 19 - the TWINDEMIC
Prevention of influenza in relation to COVID 19 - the TWINDEMIC
 
Top 10 practical questions about Flu Vaccine in India!
Top 10 practical questions about Flu Vaccine in India!Top 10 practical questions about Flu Vaccine in India!
Top 10 practical questions about Flu Vaccine in India!
 
Helping doctors avoid COVID in their Office Practice
Helping doctors avoid COVID in their Office PracticeHelping doctors avoid COVID in their Office Practice
Helping doctors avoid COVID in their Office Practice
 
Digital eye strain - Computer vision syndrome for students during Online clas...
Digital eye strain - Computer vision syndrome for students during Online clas...Digital eye strain - Computer vision syndrome for students during Online clas...
Digital eye strain - Computer vision syndrome for students during Online clas...
 
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic QuestionsPrevenar e cme june 2020 & FAQs & COVID Clinic Questions
Prevenar e cme june 2020 & FAQs & COVID Clinic Questions
 
Digital waste management pedicon 2020 Indore, preconference workshop
Digital waste management   pedicon 2020 Indore, preconference workshopDigital waste management   pedicon 2020 Indore, preconference workshop
Digital waste management pedicon 2020 Indore, preconference workshop
 
Advertise yourself with simple office tools PEDICON 2020 Indore workshop 8 ...
Advertise yourself with simple office tools   PEDICON 2020 Indore workshop 8 ...Advertise yourself with simple office tools   PEDICON 2020 Indore workshop 8 ...
Advertise yourself with simple office tools PEDICON 2020 Indore workshop 8 ...
 
Zyvac TCV - The Indian Typhoid Conjugate Vaccine
Zyvac TCV - The Indian Typhoid Conjugate VaccineZyvac TCV - The Indian Typhoid Conjugate Vaccine
Zyvac TCV - The Indian Typhoid Conjugate Vaccine
 
What nelson forgot 5
What nelson forgot 5What nelson forgot 5
What nelson forgot 5
 
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
At the four front of flu vaccination - Quadrivalent Flu Vaccination in India ...
 
Meningococcal disease sep 2019 National Epidemiology & Indian recommendations
Meningococcal disease   sep 2019 National Epidemiology & Indian recommendationsMeningococcal disease   sep 2019 National Epidemiology & Indian recommendations
Meningococcal disease sep 2019 National Epidemiology & Indian recommendations
 
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
Japanese encephalitis - Sep 2019 India epidemiology - Is vaccination needed?
 
Research in pediatrician office - my story! NORC Aug 2019 New Delhi
Research in pediatrician office - my story! NORC Aug 2019 New DelhiResearch in pediatrician office - my story! NORC Aug 2019 New Delhi
Research in pediatrician office - my story! NORC Aug 2019 New Delhi
 

Recently uploaded

Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptxEar and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
Dr. Rabia Inam Gandapore
 
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
Medical Quiz ( Online Quiz for API Meet 2024 ).pdfMedical Quiz ( Online Quiz for API Meet 2024 ).pdf
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
Jim Jacob Roy
 
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
Kosmoderma Academy Of Aesthetic Medicine
 
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấuK CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
HongBiThi1
 
Osteoporosis - Definition , Evaluation and Management .pdf
Osteoporosis - Definition , Evaluation and Management .pdfOsteoporosis - Definition , Evaluation and Management .pdf
Osteoporosis - Definition , Evaluation and Management .pdf
Jim Jacob Roy
 
share - Lions, tigers, AI and health misinformation, oh my!.pptx
share - Lions, tigers, AI and health misinformation, oh my!.pptxshare - Lions, tigers, AI and health misinformation, oh my!.pptx
share - Lions, tigers, AI and health misinformation, oh my!.pptx
Tina Purnat
 
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdfCHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
rishi2789
 
Cervical Disc Arthroplasty ORSI 2024.pptx
Cervical Disc Arthroplasty ORSI 2024.pptxCervical Disc Arthroplasty ORSI 2024.pptx
Cervical Disc Arthroplasty ORSI 2024.pptx
LEFLOT Jean-Louis
 
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.GawadHemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
NephroTube - Dr.Gawad
 
Travel Clinic Cardiff: Health Advice for International Travelers
Travel Clinic Cardiff: Health Advice for International TravelersTravel Clinic Cardiff: Health Advice for International Travelers
Travel Clinic Cardiff: Health Advice for International Travelers
NX Healthcare
 
10 Benefits an EPCR Software should Bring to EMS Organizations
10 Benefits an EPCR Software should Bring to EMS Organizations   10 Benefits an EPCR Software should Bring to EMS Organizations
10 Benefits an EPCR Software should Bring to EMS Organizations
Traumasoft LLC
 
pathology MCQS introduction to pathology general pathology
pathology MCQS introduction to pathology general pathologypathology MCQS introduction to pathology general pathology
pathology MCQS introduction to pathology general pathology
ZayedKhan38
 
Efficacy of Avartana Sneha in Ayurveda
Efficacy of Avartana Sneha in AyurvedaEfficacy of Avartana Sneha in Ayurveda
Efficacy of Avartana Sneha in Ayurveda
Dr. Jyothirmai Paindla
 
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotesPromoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
PsychoTech Services
 
How to choose the best dermatologists in Indore.
How to choose the best dermatologists in Indore.How to choose the best dermatologists in Indore.
How to choose the best dermatologists in Indore.
Gokuldas Hospital
 
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptxREGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
LaniyaNasrink
 
DECLARATION OF HELSINKI - History and principles
DECLARATION OF HELSINKI - History and principlesDECLARATION OF HELSINKI - History and principles
DECLARATION OF HELSINKI - History and principles
anaghabharat01
 
Cell Therapy Expansion and Challenges in Autoimmune Disease
Cell Therapy Expansion and Challenges in Autoimmune DiseaseCell Therapy Expansion and Challenges in Autoimmune Disease
Cell Therapy Expansion and Challenges in Autoimmune Disease
Health Advances
 
Physical demands in sports - WCSPT Oslo 2024
Physical demands in sports - WCSPT Oslo 2024Physical demands in sports - WCSPT Oslo 2024
Physical demands in sports - WCSPT Oslo 2024
Torstein Dalen-Lorentsen
 
The Nervous and Chemical Regulation of Respiration
The Nervous and Chemical Regulation of RespirationThe Nervous and Chemical Regulation of Respiration
The Nervous and Chemical Regulation of Respiration
MedicoseAcademics
 

Recently uploaded (20)

Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptxEar and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
Ear and its clinical correlations By Dr. Rabia Inam Gandapore.pptx
 
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
Medical Quiz ( Online Quiz for API Meet 2024 ).pdfMedical Quiz ( Online Quiz for API Meet 2024 ).pdf
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
 
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
Cosmetology and Trichology Courses at Kosmoderma Academy PRP (Hair), DR Growt...
 
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấuK CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
K CỔ TỬ CUNG.pdf tự ghi chép, chữ hơi xấu
 
Osteoporosis - Definition , Evaluation and Management .pdf
Osteoporosis - Definition , Evaluation and Management .pdfOsteoporosis - Definition , Evaluation and Management .pdf
Osteoporosis - Definition , Evaluation and Management .pdf
 
share - Lions, tigers, AI and health misinformation, oh my!.pptx
share - Lions, tigers, AI and health misinformation, oh my!.pptxshare - Lions, tigers, AI and health misinformation, oh my!.pptx
share - Lions, tigers, AI and health misinformation, oh my!.pptx
 
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdfCHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
CHEMOTHERAPY_RDP_CHAPTER 6_Anti Malarial Drugs.pdf
 
Cervical Disc Arthroplasty ORSI 2024.pptx
Cervical Disc Arthroplasty ORSI 2024.pptxCervical Disc Arthroplasty ORSI 2024.pptx
Cervical Disc Arthroplasty ORSI 2024.pptx
 
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.GawadHemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
Hemodialysis: Chapter 5, Dialyzers Overview - Dr.Gawad
 
Travel Clinic Cardiff: Health Advice for International Travelers
Travel Clinic Cardiff: Health Advice for International TravelersTravel Clinic Cardiff: Health Advice for International Travelers
Travel Clinic Cardiff: Health Advice for International Travelers
 
10 Benefits an EPCR Software should Bring to EMS Organizations
10 Benefits an EPCR Software should Bring to EMS Organizations   10 Benefits an EPCR Software should Bring to EMS Organizations
10 Benefits an EPCR Software should Bring to EMS Organizations
 
pathology MCQS introduction to pathology general pathology
pathology MCQS introduction to pathology general pathologypathology MCQS introduction to pathology general pathology
pathology MCQS introduction to pathology general pathology
 
Efficacy of Avartana Sneha in Ayurveda
Efficacy of Avartana Sneha in AyurvedaEfficacy of Avartana Sneha in Ayurveda
Efficacy of Avartana Sneha in Ayurveda
 
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotesPromoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
Promoting Wellbeing - Applied Social Psychology - Psychology SuperNotes
 
How to choose the best dermatologists in Indore.
How to choose the best dermatologists in Indore.How to choose the best dermatologists in Indore.
How to choose the best dermatologists in Indore.
 
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptxREGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
REGULATION FOR COMBINATION PRODUCTS AND MEDICAL DEVICES.pptx
 
DECLARATION OF HELSINKI - History and principles
DECLARATION OF HELSINKI - History and principlesDECLARATION OF HELSINKI - History and principles
DECLARATION OF HELSINKI - History and principles
 
Cell Therapy Expansion and Challenges in Autoimmune Disease
Cell Therapy Expansion and Challenges in Autoimmune DiseaseCell Therapy Expansion and Challenges in Autoimmune Disease
Cell Therapy Expansion and Challenges in Autoimmune Disease
 
Physical demands in sports - WCSPT Oslo 2024
Physical demands in sports - WCSPT Oslo 2024Physical demands in sports - WCSPT Oslo 2024
Physical demands in sports - WCSPT Oslo 2024
 
The Nervous and Chemical Regulation of Respiration
The Nervous and Chemical Regulation of RespirationThe Nervous and Chemical Regulation of Respiration
The Nervous and Chemical Regulation of Respiration
 

Hexaxim rtm dr. gaurav gupta 04 aug 2017

  • 1. The new kid on the block Hexavalent Vaccines! Dr. Gaurav Gupta, Pediatrician, 04th Aug 2017
  • 2. Conflict of Interest • Received grants from various vaccine manufacturers including – Sanofi Pasteur – GSK – Abbott – Novartis
  • 3. WIIFY • Need for Combination Vaccines • Safety, efficacy of Hexavalent Vaccines • Latest Data • Scheduling • Some Unique Features
  • 4. What I won’t be talking about? • aP versus wP • Components • Pricing
  • 5. Approximate duration of immunity after natural infection and after vaccination
  • 6. COMPONENT COMPANY EFFICACY 1C Amvax, JNIH 71 TO 78% 2C SKB 59% 2C Pasteur Merieux 85% 3C SKB (GSK) 84 % 4C LEDERLE - an european vacc . not marketed 79 % 5C Connaught (Pasteur) 85 % DTwP VARIOUS countries 36 TO 96 % Summary of vaccine efficacy: Cochrane 2012 (and 14)
  • 7. Statements of Vaccines Experts/Health Authorities regarding number of Pertussis components in licensed vaccines: • “There are now only 3 broadly distributed acellular pertussis vaccines: the French 2-component, the Belgian 3-component, and the Canadian 5- component vaccines. National surveillance data have clearly demonstrated the ability of each vaccine to accomplish excellent control of pertussis.” Plotkin et al. VACCINES 6th ed. • The European scientific panel on childhood immunization does not discuss the number and types of acP vaccines components, since effectiveness data have not shown any significant differences.” European CDC • “Point estimate of vaccine efficacy ranged from 80% to 85% for vaccines currently licensed in the United States. Confidence intervals for vaccine efficacy overlap, suggesting that none of the vaccines is significantly more effective than the other.” CDC Pink Book 12th ed. • “long-term large scale use of licensed 2-component aP-containing vaccines (primarily in Sweden and Japan) and of 1-component aP vaccine in the national Danish immunization programme, all of these aP-containing vaccines demonstrated high levels of effectiveness in preventing pertussis irrespective of antigen content.” WHO Pertussis Vaccines Position Paper 7
  • 9. Combination Vaccines – Why? • Simplified Immunization Schedule • Less injections – Complications • Better Compliance • Lesser administration time/ costs/ space
  • 10. Combination vaccines – Why not? • Adverse effects maybe more common • Reduced Immunogenicity • May have lesser shelf life • Technically difficult • Expensive
  • 11. Hexavalent Vaccines across the World • Hexavac – discontinued • Infanrix Hexa – GSK – with lyophilised Hib • Hexaxim – Fully liquid 6 in 1 with DPT + Hep B + Hib + IPV (HEXAVAC contained a smaller amount - 5 μg of the hepatitis B antigen produced in Saccharomyces cerevisiae yeast. In contrast, Hexaxim contains 10 μg of the hepatitis B antigen (HBsAg) produced in Hansenula polymorpha yeast)
  • 12. Registered in more than 100 countries
  • 13. Efficacy • As compared to other aP vaccines • As compared to wP vaccines, specifically against Pertussis
  • 14. HEXAXIM® immunogenicity assessment - Overview ● 8 primary series studies ● 3 primary schedules (6, 10 & 14 weeks; 2, 3 & 4 and 2, 4 & 6 months) ● With or without hepatitis B vaccination at birth ● versus different control vaccines: • wP-based combination vaccines • PENTAXIM® + standalone hepatitis B vaccine • INFANRIX-HEXA (DTaP-IPV-HBV//Hib***) • Concomitantly with other routine pediatric vaccines *Tritanrix®-HepB/Hib **CombAct-HIB® *** Infanrix Hexa®
  • 15. 0 20 40 60 80 100 D T PT FHA PV1 PV2 PV3 HBsAg Hib Immunogenicity v/s wP vaccines HEXAXIM® induces high immune responses similar to those of wP-based combination vaccines Seroprotection/seroconversion rates after the 3rd dose of HEXA or a wP-based combination vaccine in infants vaccinated at 6,10 &14 weeks of age (South Africa)1 (No HepB vaccine at birth, no concomitant vaccine) Seroprotection/ Seroconversionrates(%) D T PT FHA PV1,2,3 HBsAg Hib  0.01 IU/mL 4-fold increase (pertussis antigens) 1/dil  8  10 mIU/mL  0.15 µg/mL 98 96 100 100 94 83 93 58 100 93 99 100 100 98 96 95 95 100 HEXAXIM® 1 n=220 DTwP//Hib* + OPV + Hep B vaccine 1 n=212 * CombAct-HIB® [1] Madhi et al. PIDJ, 2011;30(4)
  • 16. 0 20 40 60 80 100 D T PT FHA PV1 PV2 PV3 HBsAg Hib The immune response to all HEXAXIM® antigens is high and similar to that of PENTAXIM® co-administered with standalone hepatitis B vaccine Seroprotection/ Seroconversionrates(%) D T PT FHA PV1,2,3 HBsAg Hib  0.01 IU/mL 4-fold increase (pertussis antigens) 1/dil  8  10 mIU/mL  0.15 µg/mL 100 100 100 100 92 93 93 90 100 100 100 100 100 100 99 100 95 97 HEXAXIM® n=260 PENTAXIM® + Hep B vaccine n=271 [5] Tregnagui et al. PIDJ, 2011;30(6) Seroprotection/Seroconversion rates after the 3rd dose of HEXA or PENTA in infants vaccinated at 2, 4 & 6 months of age (Argentina)5 (No Hep B vaccine at birth, no concomitant vaccine) Immunogenicity Vs PENTAXIM®
  • 18. HEXAXIM® safety assessment - Overview Evaluated in 20 clinical trials in more than 6000 infants and toddlers ● 18,000 doses administered to > 6000 infants in 20 clinical trials ● With or without hepatitis B vaccination at birth ● versus different control vaccines: • wP-based combination vaccines • PENTAXIM® + standalone hepatitis B vaccine • INFANRIX-HEXA (DTaP-IPV-HBV//Hib***) • Concomitantly with other routine pediatric vaccines [19] Sanofi Pasteur. Data on file
  • 19. Solicited reactions after any dose of HEXAXIM® or DTwP-HepB//Hib* in infants vaccinated at 2,4 & 6 months of age (Mexico & Peru)3 (No concomitant vaccine) 0 20 40 60 80 100 Pain Red Swell A Fever Vom Crying Somnol Anor Irr The reactogenicity of HEXAXIM® is consistently lower than that of wP-based combination vaccines Gr3: grade 3 *Tritanrix®-HepB/Hib [3] Macias et al. PIDJ, 2012;31(8) 78 94 59 71 17 36 3 6 43 67 1 6 75 93 4 6 30 31 2 3 78 92 3 5 57 69 5 6 3 5 82 92 46 59 6 10 Reactionincidence(%) HEXAXIM® n=1422 DTwP-HepB//Hib* n=711 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Any Gr3 Pain Redness Swelling Fever Vomiting Crying Somnolence Anorexia Irritability Tolerability Vs. wP vaccines
  • 21. IMMUNOGENICITY AND SAFETY OF DTaP-IPV-HB-PRP-T COMBINED VACCINE GIVEN AT 6, 10 AND 14 WEEKS OF AGE IN INFANTS FROM INDIA, WHO PREVIOUSLY RECEIVED A DOSE OF HEP B VACCINE AT BIRTH Presenting Author: Prof Sanjay Lalwani Date : 23 January 2016 Venue : PEDICON – Hyderabad WHO Universal Trial Number (UTN): U1111-1127-6936
  • 22. Safety: Solicited reactions from D0 to D7, any grade, after each injection (in %) 22 19% 4.60% 10.30% 13.80% 3.40% 3.40% 11.90% 0.60% 6.50% 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% Tenderness Erythema Swelling Post Dose 1 Post Dose 2 Post Dose 3 7.5% 9.8% 16.1% 9.8% 6.9% 22.4% 8.6% 3.4% 9.8% 3.4% 3.4% 16.7% 7.1% 3.0% 7.7% 3.0% 3.0% 12.5% 0.0% 10.0% 20.0% 30.0% 40.0% 50.0% 60.0% 70.0% 80.0% 90.0% 100.0% Fever Vomiting Abnormal Crying Drowsiness Loss of appetite Irritability Post Dose 1 Post Dose 2 Post Dose 3  54.6% experienced at least 1 solicited systemic reaction.  Most frequently reported systemic reaction was irritability (36.2%)  19.0% of subjects reported fever ; no Grade 3 fever reported Injection site reactions  37.9% experienced at least 1 solicited injection site reaction, most frequent being tenderness (30.5%).  2.9% of subjects reported Grade 3 reactions  The incidence lowered with successive doses with no Grade 3 reaction reported after the third dose Systemic reactions
  • 23. Safety in primary and booster series Key points Better tolerated than wP-based combination vaccines Comparable to other licensed aP-based combination vaccines (PENTAXIM®, Infanrix Hexa) The safety and reactogenicity - not affected by the administration of hepatitis B vaccine at birth * Infanrix® Hexa
  • 25.  Higher performance and safety of acellular pertussis vaccine versus whole cell vaccine.  Acceptable efficacy in high risk adults as well.  Study provides evidence in favor of introduction of acellular vaccine in the National Program
  • 26.  HB vaccination at birth, then comparing immunogenicity and safety of Hexaxim at 2, 4, 6 months of age v/s Pentaxim at 2, 4, 6 months & standalone HB vaccine at 1 and 6 months.  4 consecutive doses of HB-containing vaccine in the Hexaxim group (i.e. birth, 2, 4, 6 months) versus three HB-containing vaccine doses in the Pentaxim and HB group (i.e. birth, 1, 6 months).  Hexaxim at 2, 4, 6 months induced anti-HB seroprotective titers that were slightly higher than following monovalent HB vaccine at 0, 1, 6 month, with no difference in reactogenicity. http://dx.doi.org/10.1016/j.vaccine.2017.05.062
  • 28. WHO position paper on Hepatitis B 2017  The birth dose should be followed by 2 or 3 additional doses to complete the primary series. Both of the following options are considered appropriate: (i) a 3-dose schedule - birth dose + first and third doses of DTP-containing vaccine; OR (ii) a 4 dose schedule - birth dose + 3 doses, usually given with other routine infant vaccines; NO HARM. The interval between doses should be at least 4 weeks.  There are no differences in the seroprotection outcomes (anti-HBs antibody concentrations, seroprotection rates of vaccinees) of schedules with intervals of 1, 2, or 5 months between primary doses.  Longer intervals between doses appear to increase the final anti-HBs antibody concentrations, but not the seroconversion rates 7 JULY 2017, 92th YEAR / 7 JUILLET 2017, 92e ANNÉE No 27, 2017, 92, 369–392
  • 30. HepB seroprotection rates (%≥10mIU/ml) and GMT (IU/mL) following different HepB immunization regimen HB regimen Infant series product & regimen Post Infant series responses Toddler product Pre toodler booster Post toddler booster 0 + 2 + 1 HXM 3-58 97,2% - 401 HXM (11/12) 87,6% - 76 96,4% - 1,370 0 + 3 + 0 HXM 2-4-611 99,2% - 1,148 - HXM 2-4-612 99,2% - 986 - 0 + 3 + 1 HXM 2-3-45 94,0% - 149 HXM (15/18) 80,7% - 44 97,3% - 1,379 HXM 2-3-49 97,5% - 242 96,1% - 267 HXM (12) 90,1% - 76 91,4% - 95 98,9% - 2,230 98,9% - 2,233 HXM 2-3-410 95,7% - 207 HXM (11/18) Ongoing Ongoing HXM 2-4-62 98,3% - 1,142 HXM (15/18) 89,8% - 93 99,4% - 2,553 HXM 6-10-143,4 95,7% - 330 HXM (15/18) 78,9% - 51 98,5% - 4,630 1 + 3 + 0 HXM 6-10-147 100% - 2,491 - HXM 2-4-66 99,5% - 2,477 - 1 + 3 + 1 HXM 6-10-143,4 99,0% - 1,913 HXM (15/18) 94,7% - 228 100% - 44,893 HXM 2-4-61 99,7% - 3,013 HXM (12/18) 97,5% - 386 99,7% - 8,462 IH (12/18) 97,7% - 406 99,5% - 11,218 IH 2-4-62 100% - 2,766 HXM (15/18) 99,2% - 336 100% - 9,688 1. Lopez P & al. ICID 2012 & ESPID 2014 2. Aquino A & al. Vaccine 2012 3. Madhi S & al. PIDJ 2011 4. Madhi S & al. PIDJ 2013 5. Ceyhan M & al. ACPID 2010 6. Kosalaraska P & al. Int JID 2011 7. Lalwani S & al. PEDICON 2016 8. Vesikari T & al. ESPID 2015 9. Vesikari T & al. ESPID 2015 and 2016 10. Prymula R & al. ESPID 2016 11. Tregnaghi MW & al. PIDJ 2011 12. Lanata C & al. Vaccine & Vaccinations 2012
  • 32. Hepatitis B antigen: Source Produced using the patented Hansenula polymorpha yeast expression system: ● Consistent high quality and reliable supply ● No need for methanol as solvent (used with other yeast expression system)5 Manufactured and controlled in Sanofi Pasteur’s state-of-the-art facility in Argentina ● Completely dedicated to this new hepatitis B antigen Produced exclusively for use in HEXAXIM® [5] Celik. Biotechnol Adv, 2012;30(5) [6] Shouval. J Hepatol, 2003;39(Suppl1)
  • 33. Registered in more than 100 countries
  • 36. FAQs What to do with children having received all aP? How to counsel parents regarding wP & aP vaccines?
  • 37. THANK YOU docgaurav@gmail.com Missed something? Get my presentations at www.slideshare.net/gauravg Acknowledgement: Dr Sujatha Shetty, Dr Vibhas, Sanofi Pasteur Comments/ Questions