the writing process with examples. How To Write A Process Essay - A Complete Guide (With Topics). Step-By-Step Guide to Essay Writing - ESLBuzz Learning English - The .... The ESSAY Writing Process Made Easy - YouTube. WRITING PROCESS HOME - WRITING PROCESS - LibGuides at Kendall College. Writing Process Chart - TCR7639 | Teacher Created Resources.
2. Wizard Of Oz Analysis Essay
Wizard of Oz Analysis Scene: This scene in the film comes just after the house has
been picked up in the twister. Dorothy s house has been lifted up into the sky and
suddenly dropped back down to earth in the middle of the Land of Oz. In the scene
itself, Dorothy leaves her home to see that she is Not in Kansas anymore, and finds
the new and amazing world of the munchkin city in front of her. She also meets
Gwendela the good witch as her journey in Oz begins. Shot 1: Wide shot. View
behind Dorothy in black and white. Dorothy opens the door to the color world of Oz.
She steps out into Oz and stops. Straight on shot, camera moves into Oz first through
the door, followed by Dorothy appearing again in the foreground. Light... Show more
content on Helpwriting.net ...
Shot 6: Wide shot. Dorothy is in the center of the frame with Toto in her arms. Puts
Toto down as a mysterious glowing orb far in the distance slowly hovers down,
getting larger in size as it approaches. Dorothy backs up out of the frame as the orb
takes up the entire shot. Gwendela the good witch appears instantly. Straight on
shot, no camera movement. Music is more haunting, eerie, and mysterious to
represent the orb floating down. Shot 7: Close up. Dorothy scared, nervous, and
confused by this person. Tight head shot. Straight on camera shot, no movement.
Music still constant. Shot 8: Wide shot. Good witch Gwendela walks toward
Dorothy to talk to her. From right to left she goes toward Dorothy. Camera is
straight on, and then follows Gwendela to Dorothy, then makes a close up on the
two of them for a close, but not too tight two shot. No sound heard at all other than
their dialogue. Conclusion: I thought that what was most interesting about the
scene was how the director introduced us the viewer to the world of Oz. This is a
very important scene in the movie because it is the first time we are seeing this
magical place. It is important that we as the viewer find it to be just as amazing
and awe inspiring as Dorothy does when she walks into it for the first time. We are
supposed to identify with Dorothy here as she walks out of her home and into
Munchkin city to see this new world she has fallen
3. How Smart Waterflooding Can Improve The
Contemporary...
Smart waterflooding has recently proven more effective in improving the
contemporary recovery processes through the manipulation of the salinity and
compositions of the injected water. Different approaches have been tested by
various research groups to evaluate its effectiveness, such as brine dilution and
ionic variation. The brine dilution approach, also known as low salinity, which
involves lowering of the total brine salinity, has shown tremendous improvement
in oil recovery from core experiments using clay rich sandstone rocks in the range
of 5 30% oil originally in place (OOIP) (Jadhunandan and Morrow, 1995; Lager et
al., 2008; McGuire et al., 2005; Tang and Morrow, 1999; Webb et al., 2005; Yildiz
and Morrow, 1996). Similar improvements, between 3% and 19% OOIP, have been
observed in carbonate reservoirs, though the brine dilution effects and its underlying
mechanisms are more complex in carbonate than sandstone reservoirs (Austad et
al., 2011; Chandrasekhar and Mohanty, 2013; Romanuka et al., 2012; Yi and
Sarma, 2012; Yousef et al., 2011; Zahid et al., 2012). Essentially, this is because the
bonding energy between the carboxylic component of oil and carbonate rocks is
higher than with sandstone rocks (Awolayo et al., 2015). As a result, carbonate rocks
are oil wet, though not all, instead they are usually mixed wet subject to the nature of
the rock mineralsurface, oil properties, and their interactions (Anderson, 1986;
Donaldson et al., 1969; Morrow, 1990). It is the
4. The Historical And Contemporary Importance Of Francis
Of...
The most popular saint in history, Francis of Assisi s life is shrouded in as much
legend as it is fact. However, the influence of Francis or the monastic order he
founded cannot be disputed. Born into great wealth and influence during the Middle
Ages, Francis turned down such comforts instead taking up a life of poverty and
ministry. In less than two decades of ministry, Francis was able to leave a legacy that
continues to influence the Church today. The following will show the historical and
contemporary importance of Francis of Assisiby examining his unique life, his
founding of the FranciscanOrder and his ongoing influence in the life of the Church.
Saint Francis of Assisiwas born Giovanni Bernardone around 1182 in Assisi, Italy to
Peter (Pietro) Bernardone, a wealthy Italian cloth merchant, and his wife Pica.
When Francis was born Peter was away in France on business and his mother
baptized him as Giovanni. Upon his return, Peter gave Giovanni the name
Francesco (Francis). Francis received some limited formal education, but this was
supplemented with practical education received while accompanying his father on
his many business journeys. Francis lived the typical life of a wealthy young man
and aspired to be a knight. He was quite the character and always desired to rise
about the common place. A major turning point began in his life when in 1202, he
joined a military expedition against Perugia. The forces from Assisi were defeated
during which he was
5. The Genius Of Sir Isaac Newton
History has had its fair share of phenomenal scientists, but none can overshadow
the genius of Sir Isaac Newton. Isaac Newton was born on January 4, 1643. His
father died before he was born and he lived in Colsterworth in Lincolnshire with his
grandparents and three siblings. Isaac Newton was know to be quite secluded as a
young boy. Young Newton had a knack for model making and art, for example, he
made a working model of a windmill at some point in his childhood. He also made
other things such as dolls furniture and water clocks. Isaac s grandparents sent him to
king s school in grantham. At the age of eighteen, Newton attended Cambridge. He
was a major contributor to the scientific revolution alongside numerous other great
scientists... Show more content on Helpwriting.net ...
Newton s discoveries about gravity all began while he was sitting under an apple
tree. one of the apples fell from the tree making him begin to think about what caused
the change in acceleration and velocity in the apple. Newton s law of universal
gravitation states that Every object in the universe attracts every other object with a
force directed along the lines of centers for the two objects that is proportional to
the product of their masses and inversely proportional to the square of the separation
between the two objects . This law indicates that all objects in the universe are
constantly pulling against each other. This law began to work wonders in not only
his own laws and discoveries, but also in the finding of Johannes Kepler and his laws
of planetary motion.
This law of gravity coincides perfectly with Johannes Kepler s laws of planetary
motion. His first law state that The orbit of a planet about the Sun is an ellipse
with the Sun at one focus . This means that all planets orbit in ellipses around one
of two focuses being the sun. The second focus forms a more oval shaped orbit
because it is an area of lesser gravity that the planet slightly strays from the
magnitude of the gravitational pull of the sun. This first law can be clearly seen in
the solar system earth is currently in. Kepler s second law explains that A line
joining a planet and the Sun sweeps out equal areas in equal intervals of time This
6. Top 8 Powerful, Compact and Well Organized Tasks to...
Top 8 powerful, compact and well organized tasks to increase your productivity
(output).
Productivity is the grouping of smart preparation and dedicated hard work.
Continuing productive to your work is really hard. Every time end of the working
day, chances are that you are not fulfilled with what you have gifted. Productivity
could be constantly value added, but here are 8 pointers that have truly worked for
you. Fortunately, a computer, smartphone and a little know how all you need are.
1.Speed Reading Saves Your Time.
In your daily working day wants you to read huge passages of text quickly, think
about figuring out how to speed read. On a normal, a person reads around 200 to
250words per minute (WPM) and this is really slow compared to speed readers
because of sub vocalization you unconsciously read every word to yourself as you
read. Eliminating sub vocalization is one of the essential fundamental of speed reading
. You can use Speed Reader (by P Garrison) app for your android phone and tablet, for
google chrome you ll use Spreed extension and for iOS try Speed Reading HD.
These apps are using Rapid Serial Visual Presentation technique. In this technique
you ll see one word at a time very quickly in the center of your screen. You ll observe
that you re rapidly capable to read 300wpm and with a little more practice you ll
reach 500 600wpm. You ll have the capacity for reading three times quicker with a
couple of days practice.
2.Take a Breaks Reminder
Every
7. The Effects Of Mass Media And Communication On The
Society
Media Message
Introduction
Behavioral sciences play a central role in figuring out the likely effect of mass
media and communication in the society. Different theories and approaches are used
to figure this out. This study refers to the Uses and Gratifications, and Cultivation
theories to consider the effect of the media article below on individuals. The uses
and gratification theory argues that consumers of a given media uses this media to
satisfy and fulfill specific desires and needs. On the other hand, cultivation theory
holds that heavy exposure to a certain media can cause an individual to have an
illusory perception of the life reality based on the most consistent and repetitive
message that is given in this media (Fourie, 2011).
The Media Message
Those cheap home loans may be built on shaky foundation by The Independent on
Tuesday 04 November 2014
The article addressed itself to the issue of introduction of a mortgage loan that is
offered at an interest rate that is less than one per cent in the UK mortgage market.
According to the article, HSBC, which is one of the leading banks in the United
Kingdom, is planning to launch its less than one per cent mortgage loan. The article
analyses the requirements that an interested borrower will be required to fulfill in
order to benefit from it. Despite the low interest that the mortgage will attract, the
article warns that the recalculation of the charges that comes along with this
mortgage reveals that the assumingly
8. Discuss the Minority Presence in Contemporary British
Art...
Minority Presence in Contemporary British Art
Highly visible yet evasively mute.
Art critic Kobena Mercer, comments on the current position of African and Asian
artists in Contemporary British Art, when he suggests that minority artists are seen
and not heard. This oxymoronic position derives from a long historical legacy of
European colonization and the emphasis on racial inferiority and otherness. On the
one hand, British art is progressive, allowing some minority art in the general art
world. Yet on the other hand minority art is still marginalized by the preferential
treatment given to white artists. There is a strong degree of accuracy in Mercer s
statement because while minority art can now be seen, the voice is ... Show more
content on Helpwriting.net ...
The yBa movement is said to establish new ideas of Britishness in a postmodern
world. Yet, Mercer goes so far as to say that the movement is in part a reaction to the
attempt to globalize the British art world: At this stage it is precisely the discrepancy
between parochial yBa inwardness and the art world internatialism that obliges us to
interrogate the ideology of New British Art as a defensive, and, above all, regressive
response to the bewildering effects of globalization The important art (as seen by
Saatchi and The Tate) returns to a concern with British identity that fails to comment
on how diversity has changed that identity. By turning inward as a reaction to
globalization, British art regresses and fuels a return to white dominance. As a result,
multicultural art lacking Western referents become suppressed.
While there are movements to prevent this subordination of multiculturalism, their
range of influence is limited. The Institute of International Visual Arts (inIva) was
founded in 1994 and its major goal is to bring artists from culturally diverse
backgrounds to the attention of mainstream British culture. However, while their
success has been praised on a global level, locally they are largely overlooked. The
major art insitutions refuse to recognize artists whose thematic concentration does not
9. The Battle of Bunker Hill Essay
The Battle of Bunker Hill The battle of Bunker s Hill was one of the most important
battles during the Revolutionary War. On June 17, 1775, the Battle of Bunker Hill
took place. Fought during the Siege of Boston, it lent considerable encouragement to
the revolutionary cause. This battle made both sides realize that this was not going
to be a matter decided on by one quick and decisive battle. The battle of Bunker Hill
was not just an unplanned, random attack on British soldiers preformed by a few
crazed colonists. The battle was the result of struggle and hostility between Great
Britain and the colonies for many years. The feelings of angst were due to the simple
fact of the taxes the British were placing on them combined with the... Show more
content on Helpwriting.net ...
These were not the only incidents that caused unrest to exist between the Colonies
and the British. There had been incidents between British soldiers and colonists for
some time, due mainly to the Quartering Act. These incidents finally erupted into the
Boston Massacre, an event that resulted in colonists deaths and more distrust. These
feelings of discontent and the growing fear of an uprising would lead the British to
proceed to Lexington and Concord and destroy colonial military supplies. This left
the colonists with the feeling of hatred and total malice towards the British. Neither
side trusted the other, and had concerns that the opposition would launch an attack
upon them. When the British planned to occupy Dorchester Heights on the Boston
Peninsula, the colonists became alarmed at the build up of British troops off the
coast. The colonists decided that action had to be taken; they had to stop the
threatening British movement in this territory to protect them from an attack.
It was because of this as well as the many small skirmishes through the years, which
would lead the colonies into a confrontation with the British. The Battle of Bunker
Hill started when the colonists learned about the British plan to occupy Dorchester
Heights. The colonists were unnerved by this news. They, the Colonists
10. Thematic Essay On The Painted Bird
A thematic research paper on the novel of The Painted Bird by Jerzy Kosinski In
Jerzy Kosinski s novel, T he Painted Bird, marginalisation creates genocide, a
crimeВridden second class, and vast amounts of psychological torment. Jews were
massacred during World War II causing the young boy to flee from village after
village to avoid being sent to a concentration camp. The young boy s plea for safety
lands him in various situations, many of which cause him to be tortured and/or
abused. Psychological torment from marginalisation causes the young boy to
believe God holds disdain toward those without blond hair and blue eyes, causing
the young boy to feel depressed. Marginalisation of society in World War II causes
a genocide; this genocide forces the young boy to flee from his home and make an
endless journey in search of a place of sanctuary. During World War II, Jews were
sent to concentration camps and extermination camps in an effort to promote their
marginalisation and genocide; the young boy knew this reality and fled from many
villages to escape persecution. After causing mischief at his previous village, the
young boy decided to flee into the woods in search of a new home. I wandered for
several days in the woods and made attempts to approach the villages.... Show more
content on Helpwriting.net ...
The young boy s lust for a safe environment lead him to abusive situations. Jews at
that time were demonized, causing society to shun them. Psychological torment
from marginalisation lead many dark hair and dark skinned people to feel
ashamed of themselves, the young boy in T he Painted Bird was an example of
this. The young boy s psychological torment forced him to hold disdain for God
since God would not answer his prayers. The torment forced upon the young boy
was the harsh reality for Jews and other minorities during World War II. By reading
this book one is able to temporarily step into the shoes of a genocide
11. Best Memories Research Paper
When most people think of a school they think of hard work yelling teens and just
absolute chaos, but they also my think back to when they themselves were in
school or even their first year there as freshmen and then think of all of the good
and funny memories they had there in that year. I happen to be one of them just
thinking back to the beginning of the year and all the memories I have had so far.
Heck, some of my best memories are in school like when my balloon popped in
class,and when me and my friends messed with the plants we were supposed to grow
and even when me and my friends played a few games of UNO in the middle of
class. First off, one way I had a great time in class is when my balloon popped in the
middle of biology. One reason... Show more content on Helpwriting.net ...
One reason why this is one of my best memories is that we were super loud. This
makes it the best because we were super loud and our substitute teacher didn t even
care, other than when he asked us if we were done with are working Are you guys
done with your work over there and if not you ll have to talk to your teacher but
we were already done so we were good. Another reason why this is one of my best
memories is none of us were winning. This makes it the best because we are all
competitive and none of us were winning, Which is kind of funny because all of us
were smack talking each other about who is going to win. Yet I ended up winning
and won the next few games of UNO but they were all pretty lengthy and took us
most of the hour to play. This makes playing UNO in the middle of class one of the
best memories because our teacher didn t even care that much and that none of us
were winning even though we were all competitive. Some of my best memories
that i have had in my freshman year are when my balloon popped in the middle of
class ,and when we messed with my friends plant ,and finally when me and my
friends played UNO in the middle of class. These were some of my best memories
because when my balloon popped everyone jumped out of their seats and me and
my friends couldn t help but laugh, and when we messed with my friends plant and
we put a crayon in his plant and waterboarded it, and finally when me and my
friends played UNO in the middle of class and our teacher didn t even
12. What Is Shakespeare s Presentation Of Shylock In The...
Shakespeare s Presentation of Shylock in The Merchant of Venice
This essay is an analysis of how the character of Shylock, in the play The Merchant
of Venice , is presented to the audience, by Shakespeare, in different ways.
The riveting play shows the best and worst aspects of human nature and contains one
of Shakespeare s most reviled, complex and compelling characters. Love and romance
end this play, yet before that come bigotry, racism, hatred, death threats and money
especially the money. The dramatic courtroom scene and Shylock s cruel downfall
will challenge your heart and your sense of justice.
Shylock is a successful Jewish moneylender, who is filled with bitter words for the ...
Show more content on Helpwriting.net ...
Well, firstly, he is a Jew living and working in Venice. Venice was a hostile, highly
materialistic, predominantly Christian society, in Shakespeare s time; people were
unlikely to have met a Jew that had not already converted to Christianity.
Secondly, he is a moneylender, who earned profit through usury. Usury was despised
of by all other moneylenders (who all seem to be Christian). Money lending was a
contentious issue and it was considered not fair or moral to loan money, expecting
the initial amount to be repaid with a large interest on top of it.
Thirdly, he is nearly always contradicting himself. He is always talking of how the
Christians all call him names and all around just spurn and dislike him, which is a
way of asking for some sympathy or mercy (because of the way he keeps going on
and on about it) from the audience, but in the end How shalt thou hope for mercy,
rendering none? One instance for him going on about how the Christians all hated
him is his speech, in Act III Scene I, which contains words of his bitterness and
desire for revenge.
To bait Fish withal: if it will feed
nothing else, it will feed my Revenge. He hath
disgrace d me, and hinder d me half a Million,
laugh d at my Losses, mock d my Gains,
scorned my Nation, thwarted my Bargains, cooled
my friends, heated mine Enemies. And what s his
Reason? I am
13. Urban Gentrification and Urban Morphology
Urban Gentrification and Urban Morphology The term gentrification has myriads of
interpretations from different geographers, and sociologists. Ever since, there has
been protracted debate on its methodology, consequences and whether it constitutes a
dominant or residual urban form. The term gentrification was first coined by the
Marxist urban geographer Ruth Glass (Glass, 1964) to describe the influx of
wealthier individuals into cities or neighbourhoods who replace working or lower
classes already living there by using London districts such as Islington as her
example. On the other hand, Smith and Williams (1986, p.1) define gentrification as
the rehabilitation of working class and derelict housing and the consequent
transformation... Show more content on Helpwriting.net ...
Everything is inter related. The critique from this tool of analysis is again the
challenge of information overload from looking at each single factor affecting
gentrification therefore making it more complex to conceptualise gentrification.
Also, the limitation of research funding can affect the quality, accuracy and
credibility of academic s findings, speed to publication and research methodology
problems. Hence, the potential resulting in bias research findings, if used by local
government when intervening in determining housing policies in gentrifying
stagnant towns and cities may be wrongly misguided. The analysis of economic
driven gentrification is clearly illustrated in London beginning from the 1950s. This
process began in the Canonbury area of Islington; spread to Barnsbury and other
parts of Islington, as well as Camden, Notting Hill, Primrose Hill, Kentish Town,
Holland Park, and West Greenwich in the 1960s; and reached as far as Hackney in
East London and parts of South London like Lambeth, Battersea, Clapham, and
Fulham in the 1970s. (Moran, 2007, p.101) Before the 1950s, the North London
Borough of Islington was at a broken area, its once grand Regency and Victorian
houses split into poorly maintained,
14. On Collective Memory, By Maurice Halbwach
The central theme of Maurice halbwach in his book On Collective memory is the
relationship between memory and the society. This book constitutes nature,
memories of individuals, social class and religion. Not only is the nature of
collective memory important but also the linguistic part of the collectivity is also
looked upon. Halbwach is of the view that memory is not static, it is a dynamic one.
It is because memory is continuously reconstructed and one of the medium is through
language with which they convey. Within the structure of family, class and religion
there could be many frameworks of memory working simultaneously. From the
works of scholars like Emile Durkheim and Henri Bergson, Maurice halbwach
borrowed some ideas. Halbwach was... Show more content on Helpwriting.net ...
His friends used to talk about football for which halbwach did not have any interest
because he found it different from the one he knows and mane no sense to him.
He found it hard to follow the historical part popping out in any conversation.
Halbwachs s experience in his early life made little sense to his friends and vice
versa. As it was difficult for him go along with people from other communities and
places, he was excluded from his friends collective memory and their memory from
Halbwachs s. He gives another example where after the disintegration of Soviet
Union the history books showed the biases as people who were killed then were
now termed as heroes. Thus collective real memory was shedding and
reconstruction of new memories was taking place. The whole soviet history had to
be re written of the last 70 years. The books also demolished the old and real
memories and new generations are learning the reconstructed
15. Gender Roles In A Handmaid s Tale
A handmaid s Tale displays a society in which gender roles and functions in society
are strictly controlled and determined by those in power. Female sexuality,
reproduction, and masculinity is present throughout the book and has an interesting
parallel to our current society and where we are moving towards. The story and the
epilogue reminds us of the fragile nature of our rights and freedoms and how easily
they can be stripped away and how much we rely on the people in power. The Gilead
regime overthrew the U.S. government the President and Congress were killed and
the Constitution was suspended the government blamed the Islamic fanatics
(Atwood, 174). This concept alone is like our modern day feelings towards attacks
and blaming Islamic... Show more content on Helpwriting.net ...
A Commander is the head of the household and has wives until death do them apart
(81). Modern U.S. society also reinforces the idea that men are expected to be the
head of the household. Commanders who couldn t have children with their wife
are assigned a Handmaid. The Commander s wife is present and fully aware of the
situation she is there when the Commander has sex with the Handmaid (Atwood,
94). Orgasms and pleasure are recreational not required for this reproduction
purpose, its business (Atwood, 95). Even with the simple aspects of life such as
dress, in the book, the tourist presented are stared at because the women are so
undressed (Atwood, 28). The exposed face, hair, and legs was viewed by the
women even though they used to dress that way. They removed or altered most if
not all female activities, but men kept football (Atwood, 31). No freedom to roam,
and even if you did? Why? Show that women are not looked at with a sense of
purpose and determination (Atwood,
16. State Credentialing Board Research Paper
Kristy Hailey
State Credentialing Board Research Paper
January 30, 2017
I chose to do my paper on the State of Tennessee. I will explain the state board
information and help to become familiar with the credentialing and regulatory
processes that will govern my practice as a counselor.
The Tennessee Department of Health specifies the information for the Board of
Licensed Professional Counselors, Licensed Marital and Family Therapists and
Licensed Pastoral Therapists . They are in Nashville, TN. Their address is 710 James
Robertson Parkway Nashville, TN 37243.
Their mission is this: The Board is responsible for safeguarding the health, safety, and
welfare of Tennesseans, by requiring that all who practice ... Show more content on
Helpwriting.net ...
Each July the board elects these following members: a president, a vice president, a
board administrator, and a secretary. The president is required to attend all board
meetings. The vice president takes the presidents place if the president is absent.
The board administrator and the secretary are both in charge of correspondence
from the board. Regarding board meetings: At least one meeting is held annually. All
other times and dates are appointed by the board. Two members of the board or the
president may request special meetings. All board meetings are open to the public.
Topics on the agenda may include adopt and revise rules and regulations, examine for,
deny, with hold, or approve the license of an applicant and renew licenses or
certificates, establish continuing education requirements, appoint a designee to assist
in the performance of its duties, conduct hearings and the board has the authority to
select a consultant (Rules of Tennessee board for professional counselors, marital and,
family therapists and clinical pastoral therapists, 2016).
The requirements for licensure consist of education requirements, internship hours
and proper examination and documentation. First, you must be 18. The educational
requirements include sixty graduate semester hours that all must be completed from
an accredited institution. The graduate coursework should include these courses:
Theories of human
17. Active Volcanoes Research Paper
Volcan, named after the Vulcan god of Greek mythology, is a geological structure by
which magma emerges in the form of lava, volcanic ash and gases from the interior
of the earth. When the magma rises there is an episode of violent activity called
eruption, which can vary in intensity.
The duration and frequency ranges from mild lava flows to extremely destructive
exposures. Volcanoes are mountain shaped with a crater on top. Volcanoes not only
exist on Earth, but also on the sea, other planets and satellites. Almost always the
volcanoes are formed in the limits of the tectonic plates. Next I present you where we
can find some of the volcanoes that are currently active.
Chile is one of the countries with the most active volcanoes. The Calbuco ... Show
more content on Helpwriting.net ...
Helena is famous for its devastating eruption of 1980 where 87 people died. It is
estimated that there are about 130 active volcanoes in this country. In addition, Santa
Helena is located in Hawaii, the Kilauea volcano, the most active volcano on the
island and one of the most active in the world that has been vibrating since 1993.
Japan, Mount Ontake, is the second highest. In Japan there are a large number of
active volcanoes. These include Mount Fuji, which is expected to erupt in a very
short time. I can mention the Sakurajima, located in Kagoshima, south of the island
of Kyushu. Due to the activity of this volcano the authorities have alerted the
population to stay away from it.
Russia, most of the active volcanoes are located on the peninsula of Kamtchatka,
Siberia. One of them Shiveluch, characterized by the violence of its eruptions.
Volcano Plosky Tolbachik, which had been dormant since 1976, came on stream in
2012.
The subject of the volcanoes attracts me, since they are natural phenomena that can
not be predicted. We are currently studying this topic in science class and I really
like it. Volcanoes are dangerous but can be predicted, since before they start their
eruption they have a series of characteristics that can alert
18. Computer Science And Coding Of The Workplace Essay
INTRO In the world we live in today, more employers than ever before are looking
to hire individuals who have experience with computer programming and coding. The
growing job market in this field requires that more students learn these skills in order
to bring their knowledge into the workplace. However, some students do not have
this opportunity, as they have never been introduced to computersciences. There are
several reasons why this may occur, but one of the most prevalent is that students
from low income families do not have the necessary tools to learn and enhance their
skills. In order to prevent this misfortune, action must be taken. James M. Kouzes and
Barry Z. Posner say, in their book The Leadership Challenge, that, Meeting new
challenges always requires things to be different than they currently are. You can t
respond with the same old solutions (Kouzes and Posner 159). Thus, in order to
prevent students with less opportunities to learn about computer scienceand coding,
new solutions must be developed. We, the members of Cluster 6, have created a
proposal that could help fight this problem. By looking closely at how aspects of the
problem have arisen, and thinking of ways to help prevent them, we have created a
course of action that would certainly help less fortunate students strengthen their
skills in the field of computer sciences.
HISTORY AND CONTEXT
Today, the typical school calendar has school beginning in late August to early
September and ending in
19. Pfizer Case Study
Pfizer, one of the largest pharmaceutical companies in the world, owned by CEO
Ian C. Read has proven itself to be a controversial company as it headlines one of
America s largest industry. Making a huge revenue of over fifty billion dollars a
year, the company dominates its industry here in the United States, second to none.
Taken over in 2010 by Ian C. Read, the company has only grown and they continue to
do that throughout 2017. Their journey to the top really began in 2000 when the
company made their first major merge. Pfizermerged with Warner Lambert, another
company in the industry. 3 Years after that, Pfizer merged with Pharmacia and then
in 2009 Wyeth. These three transactions made by Pfizer led them to skyrocket to
the top of the food chain. With the company being so profitable in a controversial
industry, Pfizer is often subject to various disputes and negative feelings toward the
company. Pfizer has dealt with numerous lawsuits and have even been responsible
for the deaths of many users who have used their products. Ian C. Read and Pfizer
are Robber Barons due to these reasons. Pfizer has dealt with many lawsuits,
including trials over the death of patients. In 1996, the Nigerian government sued
Pfizer after children in Kano, Nigeriawere given antibiotics to treat the worst
meningitis outbreak in the area in history. The Nigerian government claims that the
parents of the children weren t aware that their kids were being given medicine and
that it was
20. Private Pensions Essay
For most Americans, retirement has become a lifelong goal. To retire comfortably,
you need income, and this income can come from one of three sources: savings,
Social Security, or a company pension plan. The unfortunate fact is that Americans
save very little money nowadays, and for anyone under forty, Social Security is a
very hollow promise. For most, private pensions are the key to a comfortable
retirement. When it comes to private pensions, however, most companies and
employees themselves don t contribute enough money, meaning that future retirees
will have to work longer if they want to maintain their pre retirement standard of
liv¬ing into retirement. There are two types of private pensions in America: the
defined benefit pension... Show more content on Helpwriting.net ...
Additionally, the costs of the pensions were also supported by the federal
government in the form of company tax deductions for whatever money was set
aside for a workers pension plan. Over time, these pension plans for industrial
workers became very generous. Everything seemed promising, until foreign
competitors with no such pension obligations began to emerge. Many of these
foreign companies paid lower wages, but even worse, had products that were just as
good as and sometimes better than American manufactured products. When the once
strong labor monopoly began to crumble, pensions became a massive and
unsustainable cost to most companies, many of which were trying to stay afloat in
an extremely competitive global market. Many employees thought that their
retirement was secure and agreed to lower wages with the promise of a generous
pension plan. Sadly, companies began to trim the fat away in order to survive, and
many American s pensions were on the chopping block. There just wasn t enough
money in the funds to support them anymore. Millions of Americans were faced
with the harsh reality that jobs don t last forever and economic security is not
guaranteed. Many people thought that they had good unions, good pensions, and
good healthcare. That isn t the case today. Slowly, it all began to erode away at such
a gradual pace that most didn t even notice until it was too late for them to do
anything about
21. Technology Today Research Paper
The Technology Today The United States of America is one the most technologically
advanced countries in the world. There are many different types of gadgets and apps
that have been made to make life easier. The technology in the world today hurts the
teenagers of America.
A small portion of the teenage population actually use the internet for educational or
informational purposes. A larger part uses internet for entertainment and gossip.
Entertainment is not necessarily a bad thing, but when someone is constantly on it
and not paying attention to the outside world things can get chaotic. If a teenager
has a test in school and instead of studying they watch TV or play on their phone
there is a chance that person is going to fail instead of pass. Teenagers the main
group of society that is always on some type of device that uses wifi or the internet.
Since teenagers will often have summer jobs, they are probably going to get on ...
Show more content on Helpwriting.net ...
Teens have a bad habit of posting everything they do on social media. What teens
do not know is that the people that hire them look into their life. They will go on
social media and look at what the teens posted. Many teens have lost the
opportunity to have because they post things that are not appropriate for someone
their age. Teens have even been killed by the technology we have today. Do not
text and drive has been a saying in the U.S. for a time now. There are too many
teens getting injured or even killed in a vehicle while texting. The average attention
span of a person is eight seconds. Teens that drive have an even smaller attention
span. So every little thing that pops in their vision they will look at it. If they get a
message then it is a high chance that the teen will look at their phone. All it
22. Into The Wild Analysis
Essay Into The Wild
Although MCcandless went into the wild,Because he wanted to get away from
civilization and rebellious tendencies.There are several reasons why chris went
into the wild but i m going to focus on rebellious tendencies and antisocial. He
chose to live a solitary life because he lived alone and never stayed in one place for
more than a month.He kept moving because was making his way to alaska to live off
the land.
Along his travel to alaska he broke minor laws. But he also broke federal laws such
as killing animals without an animal hunting license for the different animals he
killed. And doesn t pay taxes and falsifies information on documents. Gillian asked
chris if he had a hunting license chris scoffs and says how I ... Show more content on
Helpwriting.net ...
He was born into a rich family he did not enjoyed him Stuff to him because he
thought everything had to be earned and not bought and given to him. just like
when he had the old yellow car when he graduated high school his parents offered
him to buy a new car, pay for college.He felt like his parents were trying to buy his
love instead of earning his love. Immediately after graduating, with honors, from
Emory University in the summer of 1990, McCandless dropped out of sight. He
changed his name, gave the entire balance of a twenty four thousand dollar savings
account to charity, abandoned his car and most of his possessions, burned all the
cash in his wallet. And then he invented a new life for himself, taking up residence at
the ragged margin of our society, wandering across North America in search of raw,
transcendent experience. This could be another reason that lead him to go into the
23. J. P. Morgan s Robber Baron
Like any other Robber Baron during the late 1800 s, J.P. Morgan was no different.
He controlled finance and industrial consolidation and was well known for being a
banker. Credited for being one of the few to shape the U.S., Morgan did have a lust
of power and greed, but that doesn t stop him from being America s leading
businessman. His impact goes as far as the present with the many companies he
created. John Pierpont J.P. Morgan was born to a New England family on April 17,
1837, in Hartford, Connecticut, being in a well known family. James Pierpoint was
one of the founders of Yale University, his grandfather founded the Aetna Insurance
Company, and his father Junius Spencer Morgan ran a successful Hartford dry goods
company before... Show more content on Helpwriting.net ...
But still, during the late 1800 s, much of the country s industries fell into powerful
business leaders, including Morgan. He was criticized by everyone for a couple of
reasons: he created monopolies by making it difficult for any business to compete
against his known as Morganization; even though he was responsible for leading
them out of the 1907 financial crisis, he was also claimed by muckraking journalists
that he manipulated the nation s financial system for his own gain, as thousands of
workers die in his steel factories, and suffered higher casualties than even the Civil
war. This earned Morgan the occasional distrust of the federal government as well.
But those reasons didn t stop him to be a man who ended up industrializing America
with his vast, growing, and substantial companies and financial expertise that just
saved the railroads and subdued the country s financial panics. If he also had not
fought alongside with Thomas Edison with their DC (Direct Current) against Tesla
and Westinghouse s AC (Alternating Current), the way we use electricity wouldn t be
the same today.
In conclusion, J.P. Morgan is considered more of a Captain of Industry for today s
modern age than a robber baron. America would have been a whole different country
without his contributions towards society, especially if he didn t start the many
companies and industries during his
24. I Did My Wheel Chair Day On September 11
I did my wheel chair day on March 11. It was the day of the anatomy practical. So I
have to admit when I arrived at school I was more concerned about finishing my
practical than doing my wheelchair assignment. I was in the wheelchair while
reviewing the bones box before the practical and actually was not in my wheelchair
for the exam. I didn t feel like I really started my experience until after the practical.
One thing I notice right away was how much shorter I felt. Though it was
something I was expecting, when I actually experienced it I was still surprising. I
found that I had to look up to talk to people. It was a weird feeling because I was so
use to being on the same level as people, and the perspective shift was disorienting.
The second surprise was the bathroom. I never thought this would be an issue since
I considered myself to have strong arms, and felt that I would have been able to do
the task with ease. Although APU has handicap accessible stalks they aren t all that
different from normal ones. Yes they are bigger that a normal stall, but I still had no
clue how to go about transferring myself from the wheelchair to the toilet. It was not
something that I was ever taught. After, the experience I had to look up a video
how to do it, and I can say what I did surely was not as easy as the video made it
seem. I realized that people that are wheelchair bound have many small adaptations
they would need to learn in order to do daily activities. As a therapist I feel
25. Teacher
Out with the Old in with the New
Education is the single most important factor in not only an individual s life and their
outcome for success, but also the outcome of future success in America. In order for
our country to be successful we must invest in our future generations and the training
they will need once they move on to their future endeavors. Although America spends
vast amounts of money each year on education, money is not always the answer. We
must improve the performance in our classrooms by making sure we have the
strongest faculty possible. Teachers being given the luxury of tenure are hurting
student performance and the performance of America. Tenure is not only allowing
teachers to keep their jobs secure based off ... Show more content on Helpwriting.net
...
The future of education relies on technology and many teachers that hold tenure have
not grown up around such technology. This restricts them on their ability to utilize
technology in order to relate to their students. With the high school drop out rate
increasing each year, teachers must be well equipped with skills of not only the
Internet, but also power points, online lectures, and also online tutoring that all their
students may have access to. Society has risen the new generation of students to live
off technology. Hardly ever do students look something up in a book rather than
resorting to Google to find their answer. In a result, teachers that are younger with
less experience in the classroom, tend to have more experience with the technological
tactics of learning that many present day students prefer. Relating to the students
learning habits is crucial for their future success in higher education. Firing a teacher
with tenure is a very long and difficult process. It may take up to a year before the
courts become involved before a teacher may lose their tenure. Teacher tenure
requires schools to make long term spending commitments and prevents districts from
being fiscally flexible. Teacher employment contracts generally lack provisions for
declining enrollment and economic turmoil. As a high school student, I saw many
first hand accounts on the effects of tenure. Although it does affect teachers the most,
the community around the school may be
26. Conflict Management Research Paper
Conflict Management My husband and I have an ongoing conflict over my
feelings for one of his friends. I do not want to choose his friends, but one friend
and his wife have mistreated me in the past. He has known Alex for many years
and Alex s new wife was very hateful to me while Alex egged it on. My husband
and Alex still meet up for lunch from time to time, and it always makes me feel
like I am being betrayed. I am not one to hold back my feelings. My husband
always tells everyone that he has no problem trying to figure out my feelings
because I will tell him. I have a hard time trying to talk to him about this situation
because I do not wantto tell him who he can and cannot have as friends. I get
offended when he mentions that he was... Show more content on Helpwriting.net ...
This is a little different from usual in our house and I really hoped to have this
conversation and not ruin the evening. I put on some music and we sat down to
eat. I asked him about his day and listen to all of his adventures of the past 10
hours. He asked about my day and I told him I did not do anything out of the
ordinary but I did have something on my mind and I asked if this was an okay
time to have a quick discussion. He said sure and I preceded to tell him about this
assignment I have been working on for Communications class. I told him that I
could not find many conflicts to write about, but there is one thing that has been
bothering me every now and then. I told him that I have not brought it up before
now because I feel like it might be too easy to step on his toes and that is the last
thing I want to do. Then told him that when he is friendly with Alex I feel
betrayed. He gave me a very confused look and I continued by saying that is not
about his being friendly as much as it is about my feelings. I explained that I am
aware that he and Alex have been friends for a long time and that I did not want to
come between that, but after the way I was treated by Alex s wife and Alex did
not seem to think there was anything wrong with treating his friends wife that way,
I feel like he is against me or not on my side. I went on to explain that when he
visits with Alex, I feel like have no one in my corner. These two
27. Comparing The Plot Scenes In Hamlet And Gregory Doran
s...
William Shakespeare s Hamlet has been portrayed several times during the past
centuries but what distinguishes each piece of work is how the directors approached
the play. Hamlet without doubt is a troubled man overcome with the death of his
father and the discovery that us uncle now step father murdered his late father, the
king of Denmark. Kenneth Branaghs and Gregory Doran s portrayals of the famous
closet scene demonstrates two extremes of Hamlets relationship with his mother
Gertrude.
Branagh s version of the closet scene uses bright pastel colours such as blue, pink
and red to show happiness and innocence. The use of light blue hints the youth of a
child as it is often associated with the birth of boys in today s society. The only
exception is Hamlet, as he is dressed all in black. His black clothing is not only used
as a way to signify Hamlet s mourning of his father but also as a way to represent
how Hamlet himself is corrupt. This contrasts with Gertrude s appearance who is
dressed neatly in golden. Gold which symbolizes wealth and power is used to
describe Gertrude s position of power in the kingdom. Additionally, the golden dress
represents purity and demonstrates how Gertrude is oblivious to the corruption
taking place in her kingdom.
On the other hand, Doran s version uses much darker tones such as dark blues,
silvers and golds. The use of silver and gold demonstrates the wealth and power the
royal family has over themselves and society while the dark blue
28. Comparing the Democratic and Republican Parties Essay
Comparing the Democratic and Republican Parties Ralph Nader campaigned for the
2001 Presidency by arguing that there are no real differences between the two major
parties. In a broad sense, that statement might seem true. Major political parties play
a majoritarian role in an otherwise pluralistic democracy in the United States. They
are both majoritarian institutions trying to win control of the government. The
differences between the parties lie in each party s beliefs about the purpose and
scope of government. The United States is a government run by the people and for
the people. The whole population may participate in governing through the device of
having a much smaller number of people act on their behalf. In a pluralistic... Show
more content on Helpwriting.net ...
All governments require people to surrender some freedom as a part of being
governed and people can justify surrending some freedom to this control in order
to obtain the benefits of government. Government has always served two major
purposes: maintaining order, which is preserving life and protecting property, and
providing public goods, such as highways, state parks, etc. Recently, government
has pursued a third purpose: promoting equality. In the United States, the
government s fundamental issues are often defined as freedom, order and
equality. How it decides to promote those fundamental issues and how it chooses
the proper mix of freedom, order and equality in its policymaking has to do with
the process of choice. Freedom means different things to different people at
different times, depending on what political context is being used. The two major
senses of freedom are: freedom of and freedom from. Freedom of means freedom
to do something. It is the lack of constraints on behavior. Freedom from means
immunity from discrimination and it comes close to the concept of equality. Order
is viewed in one sense as preserving life and protecting property. Few people would
argue the need for order. However, order viewed in broader senses refers to
established patterns of authority in society and to traditional modes of behavior, such
as how students should dress in school (neatly and without outrageous hair colors)
and what the press should not
29. President Ronald Reagan s Speech
On June 12, 1987, the United States 40th President, Ronald Reagan, gave one of his
most famous speeches, Remarks at the Brandenburg Gate. In this speech Reagan s
aimed to expand democracy through Easter Berlin. Throughout the speech, Reagan
used rhetorical devices that made his speech affective. By balancing ethos, logos and
pathos in his speech Reagan was able to persuade the Soviet Unionleader, Mikhail
Gorbachev, and his partisans take a step forward in creating a world piece and reunite
East Berlin with West Berlin. Reagan also used repetition, strands as well as Maslow
s Hierarchy of Needs to address his audience s principal needs.
In this speech, Remarks at the Brandenburg Gate, President Ronald Reagan used
problem solution organization style to get his main points across. Throughout the
speech, Reagan provided some of the issues that the people in East and West Berlin
faced and then proffered few simple solutions that could resolve those problems.
Demolishing the Berlin Wall was one solution that was proposed by Reagan. The
Berlin Wall service as a barrier that divided families and friends, which interrupted;
the Berlin Wall also prevents democracy from spreading to East Germany. Reagan
used language that was easy to comprehend, he knew who his audiences were
whether they oppose him or supposed him. As a formal actor he knows how to grab
his audience s attention. By verbalizing the past, the present and the future Reagan
was able to illustrate the condition
30. Viruses Are Parasites Using Its Host s Cells
Viruses are parasites using its host s cells to replicate its own genome (Freeman,
2011). Viruses have either a deoxyribonucleic acid (DNA) or ribonucleic acid (RNA)
genome that affects its specific named genome. Types of RNA viruses include
positive strand, negative strand, double strand and RNA transcriptase. RNAviruses
have evolved into effective pathogens that mutate at high rates. This allows them an
advantage over their host to effectively evade the immune systemthrough several
mechanisms, such as mimicry, avoiding cell lysis, and phagocytosis. Their ability
to bypass a cell s normal process of proof reading and error correction is what
makes RNA viruses such effective pathogens. Almost all RNA viruses are termed
emerging infectious diseases because they are already known, but are increasing
rapidly in new areas. There are a few emerging infectious RNA viruses that have
reappeared into the population and have the potential to cause an epidemic.
Ebola hemorrhagic disease, rabies, influenza and HIV are examples of RNA viruses
and a few of these viruses have yet to be thoroughly researched. An example of an
RNA virus that mutates and evolves at a high rate is the influenza virus. The
influenza virus can mutate in two different ways; antigenic shift which is an abrupt
change and by antigenic drift which is a smaller, more gradual change that occurs
through point mutations (Uyeki 2014). These changes are what help the virus to
evade the host s immune system. Another
31. Bill Bradley Leadership Qualities
To reiterate, Bill Bradley s virtues of leadership, hard work, and respect are what
account most for his accomplishment as a citizen athlete. Bradleys first virtue is
leadership. He was a leader on and off the court, and he had this trait instilled in him
since a little boy ( Bill Bradley. Biography). For example, Bradley would always be
the one who started communication on the court. He spoke in basketballterms that
nevertheless underlined his basic principle. (Bradley 106). Another example of
Bill Bradley s leadership virtue was when he led his Princeton Tigers to a winning
season ( Bill Bradley 65. ). For Bill, that accomplishment was not easy or given to
him. He was on the rise and everyone wanted to beat him. Everyone knew that he
was an NBA prospect, but he kept his composure and played to the best of his
ability every single game. It did not matter who he was playing, he gave it his all
and made his teammates better. His teammates loved playing with him. Bill
displayed impeccable confidence. He always made the right decisions whether it
was shooting the last shot for the win or getting his teammates involved (Bradley
106). This was not only on the court but his leadership carried into his post career.
Bill was involved not only in sports, but he was also the U.S Senates for New Jersey.
He displayed tremendous patience through rigorous campaigning. This shows that he
wanted to help benefit values of our nation and come to a conclusion that will place a
smile on
32. Essay On Chronicle Of A Death Foretold
Throughout every story there remains a valuable impact onto the reader. Novels
and Short stories often stand as the brilliant creation with a mastermind not far
behind. One of the most recently studied works: Gabriel Garcia Marquez s
Chronicles of a Death Foretold; Showing a great example of styles and variations
in writing. Without detail, art cannot prevail in iconic value. The iconic value of a
piece depends upon how many different ways the reader can interpret the piece. In
Chapter one of Chronicles of a Death Foretold most readers already understood
someone croaked, however the form Marquez chose to describe the death relics
gruesome imagery for the painter. The canvas and colors selected by Marquez gave
the true painter an instant entrance... Show more content on Helpwriting.net ...
All works of art by Marquez earned him a Nobel Prize in literature for using
magical realism. The ability to combine the machismo from South America and
the imaginative influences from Marquez s travels to Colombia, his real
birthplace, created the masculine overture witnessed in Chronicles of a Death
Foretold. The most controversial statement by Gabriel Garcia Marquez in
Chronicles of a Death Foretold, The brothers were brought up to be men. The girls
had been reared to get married. (2.15) gave strength to the topic of a society ruled
by machismo. Breaking a link in the chain of tradition could lead to dishonor among
peers. Gabriel Garcia Marquez Gruesome attention to detail used popularized culture
to run his show. In Catholic Religion it is forbidden to do anything with the
deceased. Yet, Father Armador the priest went on ahead with Santiago Nasar s
Autopsy. Almost fully dehumanizing the Rich man; Santiago Nasar s Identity. Quite
the display of irony how Santiago Nasar s dead, cut up, and poorly sewn body lay
inside a luxurious
33. Lissencephay Research Paper
Human brain development represents a dynamic and complex process that requires
fine tuning of biochemical, genetic, environmental and physical events. Neuronal
migration is a significant part of neurodevelopment, which is a term that describes
moving of nerve cells from their origin to their ultimate location.
During the first trimester of pregnancy, abnormalities of the migrating neuroblasts
and glioblasts may result in abnormal gyral development, leading to a disorder
known as lissencephaly. Lissencephaly (a term derived from Greek words for
smooth brain ) is characterized by a smooth cortical surface, and occurs because there
is a disruption of the ordered migration of neurons to their permanent place in the
brain cortex.
Genes and molecular pathophysiology
Lissencephaly was initially described in 1868 as a distinct clinical entity by Owen,
and it was also the first of the human cortical malformations for ... Show more content
on Helpwriting.net ...
Central, cingulate, calcarine and parieto occipital sulci are visible at 27 weeks of
gestation, while secondary and tertiary gyrations arise late in gestation.
In lissencephaly, the cerebral hemispheres resemble the smooth 20 week fetal
cerebral cortex, with the absence of secondary sulci. Gray matter heterotopia (i.e.
mislocation of the gray matter), macrogyria, polymicrogyria and schizencephaly
(together with defective cortical lamination) often accompany this condition.
Pachygyria represents similar disorder with less severe pathology than in
lissencephaly, as areas of normal laminar organization can be seen. However, these
two conditions are not mutually exclusive and can occur together in the same brain,
thus they are considered as different degrees of the same fundamental disorder in cell
migration and cortical
34. Domestic Violence and Woodstock Essay
Family of Woodstock
Diana Clark
BSHS/355
April 22, 2013
Aaron Mills, MSW
Family of Woodstock The family of Woodstock was founded because of the
Woodstock Festival that took place in a city 115 miles away. Since 1970, a
program was brought to area residents called FAMILY it is a place where
individuals can go, and they are caring and respectful. With this any type of search
for a solution is creative and never ending. FAMILY s shelters, emergency food
pantries, court advocates, counseling, and case management services, hotlines, and
childcare supports that work together to help people achieve the changes they seek.
Many people liked the idea of living on their own and living care free. Many young
people were sleeping in the ... Show more content on Helpwriting.net ...
The final shelter is the Washbourne House, and this is for women and their children
involved in domestic violence. There are 17 beds available, and there is also two
supervised transitional living residences for up to six homeless adolescents each, and
when necessary, their children. The Family of Woodstock also provide for the
community childcare programs, case management services to such unconnected
populations as adult and adolescent substance abusers, individuals at the Ulster
County Jail, homeless individuals, and families, victims of domestic violence, and the
public. They also provide non residential services to victims of domestic violence
through advocates at the Ulster County Family and Kingston Domestic Violence
Courts and to men possessing a problem with violence through the Evolve
program, and supervised visits authorized by the Family Court for non custodial
parents. The values, beliefs, and attitudes of the Family of Woodstock have
changed over 40 years. When Woodstock occurred 40 years ago rock and roll was
everything. There are many changes with the youth s trends and how they act.
There are big differences between the morals and values of the young and the old
today. However, they do not create conflict with the delivery of the systems. At the
time when Woodstock was going on drugs and rock and roll were big. The young
people thought of it as being
35. The Master Of Deception ( Mod )
The Master of Deception
The Master of Deception (MOD) is the first hacking gang in hacking history, and it s
also one of the most extensive thefts of computer information. MOD was founded by
several blue collar youth in New York, which aimed at proving their power in
computer and network underground and beating other hackers and hacker gangs
(TABOR, 1992). MOD traded boasts, tapping into telephone systems, stealing
confidential information from government or other highly protected systems. At
first, their purpose was to prove that they are better and more skilled than other
hackers, but later MOD members began to steal confidential information and sell it
for personal gains. In 1992, five members of MOD were indicted in federal court, this
is the symbol of the fall of MOD, after these five members, more and more members
got arrested, and finally led to the collapse of MOD ( The Master of Deception, 2015)
Famous attacks
Conficker
Conficker is a name of a computer worm, in 2008, Conficker worm was exploited
vulnerabilities of millions of Microsoft Windows operating system computers. It uses
the flaws in Windows computers to break into a computer and links other affected or
unaffected computers together into a huge botnet ( Conficker , 2015). The botnet can
be controlled remotely by the author(s) of the worm. Conficker worm infected 9
million to 15 million Windows computers in over 200 countries in the world,
including government, military, business, and home computers. So
36. Bird Shrinking Research Paper
If your loved one has recently passed away, and you ve chosen to remember them
with a laser etched monument, you ll want to keep it looking beautiful. With
proper care, the monument you purchase will serve as a lasting memorial to your
loved one. One of the benefits of laser etching is that the work will last for years to
come. However, it will require some maintenance to ensure lasting beauty. Here are
four simple steps you can follow that will help you protect and preserve your loved
ones monument.
Wipe Bird Droppings Away Immediately
Bird droppings are unavoidable, especially when it comes to monuments that are
outside. Unfortunately, bird droppings are highly acidic, which means they can
damage your loved ones monument if left alone for
37. How The Symbolism In Tender Is The Night
In Tender is the Night, the scene of Nicole walking through her garden is highly
symbolic and relates to a larger meaning of innocence. Before this scene, the focus
was almost entirely on Rosemary and her obsession with the Divers. Little is known
about Dick or Nicole at this point. Rosemary is completely entranced and in lovewith
Dick and she is thrilled to be invited to his party. However, before the guests arrive,
Nicole is pictured, calmly strolling around her lovely garden. This is the first
instance the readers get the spend time with Nicole. Once people arrive, Dick
makes a comment about how Nicole nags and worries about her garden a lot,
especially about it having diseases. Using information gained from How to Read
Literature, the scene can be decoded into a representation of Nicole s illness due to a
loss of innocence.... Show more content on Helpwriting.net ...
Often, illness or disease is not meant only as a plot device. Illnesses can have a
larger, metaphorical meaning. For example, if a character is paralysed physically,
it can represent moral, social, spiritual, intellectual, or political paralysis. Illnesses
cause the sufferer to waste away, which can be linked to a waste of their lives.
Widespread diseases, such as a plague, can be representative of social devastation.
Malaria translates to bad air, as it was thought to be caused by harmful vapors in the
air, rather than mosquitoes. A person who suffers or dies from malaria can reflect
someone being destroyed by harsh public opinion or bad social atmosphere. In short,
diseases can be used by authors to make a statement about the victim of the
38. 1920s Fashion Research Paper
The revolutionary clothing of women s fashion in the 1920s not only shows itself in
our modern era, but is a historical adjustment which changed the way that we view
females today.
In the 1920s, breathtaking changes in women s fashion made its role into history. The
clothing designers created a unique and elegant style that gave ladies a greater
freedom of expression. With the new and colourful fabrics echoing, fashion designers
vintage clothing became more and more popular and paved the way for what fashion
has become today.
After World war one, the dresses became lighter, brighter and whole lot shorter!
Designers made new colours, textures, and patterns to make the perfect new well
designed dresses of the decade. Everything worn in the 1920s had a specific time of
day and people changed more than the average teenager of today. (What did women
wear in the 1920s, Par 1). Day wear was very different from evening wear.... Show
more content on Helpwriting.net ...
The cloche is a hat that was snug fitting, warn tilted up usually covered the
forehead and Often the flapper clothing and the cloche hat were worn together,
(1920 s Fashions and Accessories including Prices, Par 1). Ladies of this time span
would cut their hair short and keep it flat to fit under this hat. The flapper dress
was a historical adjustment on its own. The flapper dress was a chiffon dress with
a straight. The dress had different hem lines starting at the calf length making its
way to knee length. Wrap over coats were the perfect addition to the flapper look.
The inside of the coat was normally designed to match the dress patterns or fabric
(Women s Dress Fashion and Style, Par 10). Evening shoes varied from bar shoes and
T Bar shoes. They had a strap and were easy to dance in which made them very
39. Examples Of Appeal To Ignorance In Mass Media
This paper tries to determine the appeal to ignorance as used in mass media. It
provides examples that clearly show the depiction of appeal to ignorance used in
mass media. Through various research articles and books, it inspects fallacies at
depth with real world examples from the media. Mainstream media is not only a
source of passing information but it has become the top choice tool for advertising
companies to market their products regardless of the correct form of argument, as
far as the their market revenue increases. As a result, review of T Mobile
advertisement is used in analysis and delineation of appeal to ignorance fallacy.
Keywords: Appeal to ignorance, fallacy, Argumentum ad ignorantiam, Argumentum
ad populum Appeal To Ignorance Used In The Mass Media
Introduction
Criteria for relevance and ambiguity cannot be made formal because of the many
ways in which an attempted inference may fall. When an attempted implication fails
because the premises are irrelevant or ambiguous, we shall describe the argument
containing inference as a fallacy. Web dictionary defines fallacy as a logicof any of
various types of erroneous reasoning that render arguments logically unsound.
Fallacies in logic are incorrect forms of arguments. They may seem to be correct as
a fallacy cannot inform us of the truth of its conclusion, yet can seem correct, its aim
must be to cause us to accept or agree to its conclusion. We have seen that, while a
literal use of words can inform us, the
40. Functional Hypothalamic Essay
Stress Induced Anovulation
Functional Hypothalamic (FHA) is a reproductive disorder in which secondary
amenorrhea occurs, due to decreased Gonadotropin releasing hormone (GnRH) pulse
secretions. It is characterized by hypercortisolism, hypogonadism, lower leptin
levels, and dysregulated thyroid function (Berga and Loucks 2007). There are three
types of FHA categorized as either weight loss related, psychological stress related,
or exercise related amenorrhea. In each, higher than normal levels of cortisol caused
diminished functional activity of the ovaries, leading to deficiency in estrogen.
GnRH is a hormone produced by the hypothalamus, and stimulates the anterior
pituitary gland to secrete follicle stimulating hormone (FSH) ... Show more content on
Helpwriting.net ...
CBT is a better treatment alternative to pharmacological treatments because it targets
the underlying cause of the disorder by reducing allostatic load through teaching
stress management skills, and prevents other health conditions linked to chronic
stress such as cardiovascular disease (Michopoulos, Mancini, Loucks, Berga, 2013).
Additionally, it prevents potential side effects of HRT and ovulation, and can foster
better overall wellbeing and parenting skills of potential mothers. Given that there is
a direct relationship between the psychogenic stress, increased cortisol and
neuroendocrine imbalance, and negative health outcomes, it is important for
physicians to be cognizant of the psychological, emotional, and social stressors of
their patients, as they might directly cause their conditions, or may interfere with the
patients ability to comply with their treatments, and recover. Since there may be
many other illnesses that are directly influenced by stress, more research should be
done on how stress interacts with other illness. Physicians should emphasize the
importance of mental health and stress management techniques on patients health
41. Diversity Promotes A Higher Potential Of Success For A...
Albert Einstein once said, We cannot solve problems by using the same kind of
thinking we used when we created them. In other words, we need different ideas to
come to an optimal solution. Diversity encompasses a variety of differences
between people in this world. Each individual is classified to be different from one
another whether it is from age, gender, race, personality, education, background,
experiences, and more. Varying viewpoints provides a team with a larger pool of
ideas to work with and filter out what works for them. Modern day businesses that
are striving towards success through innovation tend to lean teams building a
diverse team. A variety of experiences and backgrounds creates a channel of people
who can provide innovated ideas that may have never been thought of. In this
paper, I argue that diversity promotes a higher potential of success for a company.
Age diversity plays a significant factor in productivity. From the young to the old,
knowledge will vary when it comes to age and experience. Together they will
comprise of a team with different perspectives and interpretations of ideas. These
factors contribute to the knowledge pool of the workforce which in return have a
direct effect on their abilities to problem solve. In Uschi Backes Gellner and
Stephan Veen s research on the effects of age diversity, he discusses diversity s costs
and benefits depending on the tasks of companies. A variety of ages is particularly
important when
42. The Eleusinian Mysteries Of Ancient Greece
The Eleusinian Mysteries
Religion is interwoven in the social, cultural and economic life of all civilisations
and Ancient Greece was no exception. Typically, most religion in Ancient Greece was
civic in nature, however, in the fifth century B.C., mystery religions began to gain
popularity. Shrouded in secrecy, the mystery religions provided a more personal
approach to religion, fascinating initiates and capturing the imagination of the Greek
populace. The most popular of these mystery cults was the cult of Demeter, a
veneration established in Eleusis around 1500 B.C. The Eleusinian mysteries were the
earliest and most celebrated mysteries in classical antiquity (Karoglou, 2013). These,
through their appeal to initiates, played a pivotal ... Show more content on
Helpwriting.net ...
The Homeric Hymn to Demeter, coupled with the surviving evidence, allows
modern historians to paint a consistent portrait of the Eleusinian mysteries. The
Hymn to Demeter was composed in Attica no later than the 7th century B.C. and
served for centuries thereafter as the canonical hymn of the Eleusinian Mysteries
(Nilsson, 2016). The anonymously transcribed source tells the tale of Persephone s
abduction by Hades, God of the underworld (Sailors, 2007). The Hymn reveals the
significance of seasonal elements within the Mystery cult. The fact that the
Persephone, upon negotiation with Hades, dwells two thirds of the year in the
upper world is manifestly connected to vegetation (Nilsson, 2016). This too is
connected to the annual festival which takes place in the middle of the Greek
month Boedromion (October), a winter month. In the 6th century B.C., Herodotus,
the father of Greek history, wrote: Every year the Athenians celebrate the festival
in honour of the Mother and the Maid, and anyone who wishes, from all of Athens
or elsewhere, may be initiated into the Mysteries (Keller, 2009). Therefore, it is
revealed that the great procession from Athens to Eleusis, along the sacred way, was
held in order to appease Demeter for a prosperous summer (Burkert, 1985). Except
for the date of this procession, little is known of the rites of
43. Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been
utilized for tumor targeting. Anti epidermal growth factor receptor (EGFR)
Affibody protein (e.g., Ac Cys ZEGFR:1907, amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQ
NH2) is used to target EGFR that is overexpressed in a wide variety of human
tumors. Cheng and co workers used anti EGFR Affibody proteinas tumortargeting
ligand on 64Cu Au IO nanoparticles (PET component: 64Cu, MRI component: iron
oxide, specific for EGFR) surface.[63] In their work, A431 tumor cells were
subcutaneously implanted in the right shoulders of nude mice; and 64Cu NOTA Au
IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive
A431 (human epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after
injection, significantly higher than that obtained from the blocking experiment
(1.9% ID/g) indicating the specificity of the probe. This difference in % ID/g values
corroborated with 44% drop in MRI signal intensity that was observed for the tumor.
In this study, the use of an Affibody protein as ligand for EGFR expressing tumor in
small animals was demonstrated to be successful; however, the benefit of
multimodality was not demonstrated. The unique chemistry of this dumbbell shaped
Au IO nanoprobe could pave the way for targeted drug delivery into EGFR
expressing tumors
44. The Controversy Of Year-Round School
The topic of year around school has been brought up many times throughout my
time in school. Though it has been brought up, it has not actually been considered
by my fellow students and I. We have all taken surveys regarding it and most of the
people I know have been against it. With our school being in a small town in Iowa I
do not think having year round schooling would benefit us or the community.
Many students including myself work for local businesses in the summer. Us
students make up a large amount of these businesses employes. Without high
schoolers working the business owners can not make a profit, which essentially
causes them to lose money and possibly go bankrupt. High school students being
summer workers is not the only
45. Examples Of Duality In Palazzo Chiercati
Duality in Palazzo Chiercati Palladio explores duality in Palazzo Chiericati
through typology, structure, and proportion. Palazzo Chiericati s site has a lot to
do with the design of the building. The site of the Palazzo Chiercati is in central
Vicenza, Italy. The building was erected on a very shallow site and has a long
frontage lining an open public space. Beyond the canal there was more rural
landscape compared to Vicenzas streets. Palladio did not let the opportunity of
designing the building regarding this unique site. To emphasize the difference in
landscape or built environment, Palladio makes use of a synthesis between two
stark typologies. Palazzo Chiercati is the combination of both the palazzo and the
villa. The building rather than trying to create an ideal version of either typology
focuses more on making combination of these two typologies meaningful and
understandable. Rather than try to fit a multitude of components from each
typology into the Palazzo, Palladio focuses on key distinguishing parts of the
typologies. For the palazzo aspect of the building, he makes sure to include a
courtyard. While the courtyard is narrow and not surrounded by the building on all
four sides, the opposite of the paradigm for palazzos, Palazzo Farnese, the
courtyard distinguishes itself by being the closest aspect of the building to the urban
environment surrounding it. To emulate the typology of villa, Palladio makes use
of the loggia and portico. Because the building was one of Palladio s most
compressed , Palladio was not able to make a full and extruding portico like many
villas feature. There is still that hint of a portico, but the extrusion from the colonnade
of the loggias is very miniscule. However, while the portico may be short and
compressed, it is still a feature of the façade meaning Palladio wanted it to be
understood as a portico from a villa. This building s construction began after
Palladio s infamous Villa Rotunda. While Villa Rotunda had porticos on all four
sides, Palladio reduces the number to one in Palazzo Chiercati to draw attention to
short procession needed to travel from the portico to the main space. This unusual
adjacency of the portico and the central space with no
46. Examples Of Brutus In Julius Caesar
Brutus is an important character in the play Julius Caesar as he is portrayed as a
tragic hero where he possessed heroic traits such as being noble and honourable
that earn the sympathy of the audience. However, he also has flaws and made
many mistakes and hamartias that ultimately lead to his downfall. Giagiari (2012),
claimed that stoicism is the belief of in hiding one s negative destructive emotions
where only the the most honorable men of men can contain these emotions . This
can be seen prominently when he received the news of his wife, Portia s death,
whereby he showed no outward emotions and reaction when she killed herself.
This is evident from Speak no more of her. Give me a bowl of wine . This shows
clearly how Brutus just brushed off the fact that his wife who had been a major
part of his life had just died and asked for some wine to enjoy. This is due to his
philosophy where he has to simply show that he did not care. Next, according to
Gann (2010), the passions were simply the intellect in a diseased state. A clear and
unbiased thinker will not be swayed by his emotions when making decisions. This
can be seen in Brutus s dilemma where he was torn between his personal affection
for Caesar and the need to end his dictatorship. In the end, he chose to not let his
personal emotions interfere with his decision and... Show more content on
Helpwriting.net ...
All his ideals and principles affected his actions such as joining the conspiracy
which then led to his downfall. Being an idealist, he could not see the practical
condition and assumed that others have the same ideals as him. This can seen when
he assumed that the plan for conspiracy will work out perfectly whereby it would not
seem too bloody since they did not kill Mark Antony and that they would be seen as
noble men since they did it for the sake and benefit of Roman
47. Notes On Chromatography
Background:
Derived form the greek words for colour (Chroma) and writing (graphe).
Chromatography is a method is method in which different kinds of the coloured
chemical mixtures are separated. In the early 1900s, Mikhail Tswett, a Russian
botanist, was interested in the individual compounds presented in plants. He
understood that removing ground up plants extracts with the dissimilar solvents will
provide assorted coloured solutions. Tswett conducted an experiment which involved
pouring a plant extract through a glass tube filled with calcium carbonate. As the
liquid passed through the powder, bands of colour was revealed; as individual
compounds.
пїј
In chromatographic techniques, there is a stationary phase: usually a solid, thick
liquid or bonded coating that stays in a secure position. mobile phase or eluent:
usually a liquid or gas moves through it or across it.
The mobile phase carries the components of the mixture with it.
The separation of a sample, placed in the stationary phase, will gradually transport
along with the mobile phase. If a sample compound has no connection with the
stationary phase, it will come out as the same rate of mobile phase. If a sample
compound has connection, it will stick with the stationary phase. This distribution
ratio among the selected phases must differ for each sample compound in order for
them to separate.
Types of Chromatography:
Paper Chromatography:
Paper chromatography is a analytical technique in which the mixture is
48. Napoleon Bonaparte Dbq
In 1795, the Directory was busy with the war in western and southern Germany
and had sent most of the French forces their to launch an offensive. The leaders of
the Directory believed that Italy was something of a sideshow (Roberts 78) and
gave Bonaparte command of some troops to fight in Italy. It was Bonaparte s first
military campaign at age of 26 against Austrians and their allies the Italians.
Unfortunately, when he arrived in Nice to command his troops, they were in a
horrible condition. The weather was frigid and the men had no overcoats, no shoes,
or clothes stolen from dead enemies. Unpaid and starving Napoleon had a daunting
task to win over the troops who were muttering about mutiny (Roberts 78). Firing
inefficient officers and
49. Evidence Investigation
In any case, during the initial canvass of the crime scene, documentation is made to
identify where evidence is and the type of evidence found. After it is recorded in an
evidence log the collection of evidence can begin. You will want to start with
collecting the most fragile or most easily lost evidence (Shiro, n.d.). Throughout the
collection process you will want to keep evidence in order by documenting in the log
where it is and taking photographs of each item. If additional items are found
underneath the other evidence, this should be documented in the log and
photographs should also continue to be taken if the investigator is revealing layers of
evidence which were not previously documented because they were hidden from sight
(Shiro,... Show more content on Helpwriting.net ...
The importance of an expert witness in a trial is presumably they will be able to
explain complicated scientific or technical matters (Siegel, 2010) But also explain
it in a manner that the judge and jury would be able to understand. The expert
witnesses are also brought in to give their findings of fact, as well as their opinion
as to what happened in the matter of the case. The problems that arise with an expert
witness are that jurors have no alternative but to judge the testimony of expert
witnesses on the personal credibility of the witness. As well as an untutored
audience may not be able to separate a well told tale from the truth (Richards, 1993).
The role that an expert witness may play in a handwriting analysis case would be to
determine if the document that was produced from the scene has the same writing on
it as that of which was produced by the subject, he/she would then explain to the
jurors and judge the similarities and difference found within the documents and if
they came to a consistent or inconsistent with having been authored by the person in
question. (Frost et al,
50. The Oral Motor Functional Development Essay
Introduction: The oral motor functional development is a complex process that starts
since the prenatal stage and it consolidates on the postnatal period. The oral motor
functions in early childhood (OMF) are part of the thin oral adaptive development,
heavily depending on the central nervous system. At birth, oral appliance acts as a
complete functional unit and the breastfeedingpractice will favor the OMF
coordination (sucking, swallowing), oral motor activity and the craniofacial growth.
From the first six months, a complementary feeding is introduced, jaw movements,
tongue and the lips act like independent structures; and then it starts a chewing
process, also known as mastication and the OMF will depend on the diet type,
texture, consistency of food and feeding techniques. In this way, is formed a group of
factors that affect the craniofacial growth and development, explained by the action
of the muscles over functional matrices and skeleton units during the function
(functional matrix) and by the influence of the environment about customs and
breeding habits that also both will have an impact on the OMF. In Colombia, there
are not longitudinal studies that describe the behavior of the OMF variables.
Objective: Set the periods of functional oral motor achievements during the
chronological development of children aged 0 3 years old. Sample: 265 Colombian
children, Bogota residents (116 girls, 149 boys), children s eligibility was determined
by inclusion and exclusion
51. The Impact Of Technological Change On The British...
Technological change was at the heart of driving the British Industrial Revolution
over the late 18th and early 19th century. A series of significant inventions such as
steam engines, spinning jenny and water frame had precipitated British economy s
evolution from pre modern to sustained economic growth. To explain the radical
change in technology, two competing factors are highlighted in literature. Economists
like Sir John R.Hicks outlined that the real reason for the predominance of labour
saving inventions is surely that ... a change in the relative prices of the factors of
production is itself a spur to innovationand to inventions (). In contrast, Joel Mokyr
argued that it was the right combination of useful knowledge generated by scientists,
engineers and inventors to be exploited by a supply of skilled craftsmen in an
institutional environment that produced the correct incentives for entrepreneurs
(Crafts, 2010, p155 156). By comparing the impacts of factor prices and institutions
on technological change in Industrial Revolution, the former is evidently more
important than the latter.
Britain s peculiar wage and price structure was decisive in motivating dramatic
technological change over industrial revolution. The abundance of coal s supply
made energy very cheap (Allen, 2009, p82). Other than that, the relative price of
labour to capital and energy had been surging from the mid 17th century (Allen,
2009, pp171 172). Due to the factor price structure of British
52. The New York Legislature Created A World Trade Center
In 1946, the New York Legislature created a World Trade Corporation. The war
had just ended and America was the only country still on their feet. Manhattan was
already one of the world s greatest centers for trade and commerce. So it was the
obvious location for a world trade center. The World Trade Center was located in
lower Manhattan During the 50s, lower Manhattan was full of rundown and
abandoned buildings. Full of small businesses, a small population, and a bad
economy, lower Manhattan was in need of a change. To fix this major problem,
organizers of the WTC wanted to clean up and transform the lower side of Manhattan
by building it there. The World Trade Centerwas permanent trade exposition for the
whole world to use. It... Show more content on Helpwriting.net ...
Others just thought it was ugly and a waste of space. Lewis Mumford said it was
just glass and metal filing cabinets . In 1968 construction began. It took about five
years to complete and the towers were opened to the public in 1973. The Twin
Towers were instant icons. At 1,368 feet tall, the World Trade Center was the
tallest building in the world until the Sears (Willis) tower was built in 1973. In
august 1974, Philippe Petit walked across a tight wire between the two towers. It
was 130 feet across and 1368 feet above the ground. This accomplishment made
him a hero. As soon as he stepped back onto the roof of the south tower, Petit was
arrested. He was then ordered to perform a free show for children in Central Park.
February 1975, a fire broke out on the eleventh floor. Some were injured but no one
died. The eleventh floor was destroyed and others above it. 9/11 wasn t the only
terrorist attack at the world trade center. On February 26, 1993, a bomb exploded
in the underground parking lot of the Two World Trade Center. Six people died
and about 1000 were injured. Terrorists blew up a truck with more than 1000lbs of
explosives inside. They wanted the North Tower s structure to fail and send it
crashing into the South Tower. Luckily, their plan failed. A lot of repair was needed,
but everything was quickly fixed. Within a year, most of those apart of the attack
were arrested and convicted. It took another year to find the head of the
53. Priestley s Views On Inequalities
How are Priestley s Views on Inequalities in society shown in the Presentation on
Sheila before, during and after the Inspectors Visit? Throughout the play An
Inspector Calls by J B Priestley, it is clear that Priestley strongly believes in the
importance of a caring society and the consequences of our actions. He presents
these views on inequalities through the presentation of Sheila Birling. This is done
in various different ways using numerous techniques. A major inequality that has
been highlighted in the play is gender Inequalities. Before the unexpected arrival of
Inspector Goole, Sheila is presented to be very outspoken about her ideas to Gerald
and the rest of her family. I d hate you to know all about port like one of these
purple faced old men As Sheila tells this to Gerald it shows how she openly
expresses her views to Gerald. The simple language emphasises how confidently
she is able to voice her opinion without a second thought. This is something that
wouldn t be expected from women in the early 1900s so it shows how from the
very beginning, Sheila is different to most women in the early 1900s. However, she
is also quite similar to them in terms of her power because she had no power in the
start of the play and despite the fact that she voices her opinion, it has no impact on
anyone in the family in comparison to the effect it would have if Gerald or Birling
said it. During the Inspectors visit Sheila increasingly breaks down the inequalities
between
54. Potable Drinking Water Act ( Sdwa ) For National Air...
Introduction In the water treatment process, there are lots of processes required in
order to remove sediments, bacteria, viruses and impurities. These processes are
including screening, filtration, flocculation, sedimentation, nitrification, chlorination,
coagulation, and disinfection. In many municipal wastewatertreatment has some
standards and regulations to follow in order to distribute clean and safe water supple
to citizen in their area. US Environmental Protection Agency (USEPA) enforces
requirements under the Clean Water Act (CWA) and Safe Drinking Water
Act (SDWA)
for national water supply in the U.S. Under the Clean Water Act s National Pollutant
Discharge Elimination System (NPDES) program, EPA regulates discharges of...
Show more content on Helpwriting.net ...
Water disinfection means eliminating or inactivate of growth and reproduction in
pathogenic microorganisms by creating cell wall corrosion in the cells of
microorganisms, or changes in cell permeability. From the water treatment process,
disinfection is a sufficient and the crucial process in order to inactivate bacteria,
viruses and pathogenic organisms that can waterborne diseases to downstream users
and the environment (USEPA, 1999). There are three most common methods of
disinfection in the U.S., which are Chlorination, Ozonation, and ultraviolet (UV)
disinfection. Chlorine, the most widely used disinfectant for municipal wastewater,
destroys target organisms by oxidation of cellular material. Ozone is a strong
oxidizing agent that is an unstable gas that is generated by an electrical discharge
through dry air or pure oxygen. Finally UV radiation generated by sunlight, tanning
lamp, black lights, and electrical discharge through mercury vapor, penetrates the
genetic material of microorganisms and retards their ability to reproduce (USEPA,
N.D.). One of the popular disinfection methods in water treatment is the Ultraviolet
(UV) disinfection. The ultraviolet (UV) disinfection is a physical disinfection of
water. This paper would provide a broadly definition of UV disinfection and its
purpose in water treatment. Also, this paper will provide the advantages and
disadvantages of using the advance technology over the common technology in water
treatment.