SlideShare a Scribd company logo
1 of 33
Universal immunization
programme
Introduction
• Smallpox Eradication Program, it was experienced that
immunization is the most powerful and cost- effective weapon for
the prevention and control and even eradication of a disease.
• In 1974, WHO officially launched a global immunization program,
known as Expanded Program of Immunization for the prevention and
control of six killer diseases of children
namely tuberculosis, diphtheria, pertussis, tetanus, poliomyelitis and
measles, all over the world.
Presentation title 2
It was called Expanded because:
• Adding more disease controlling antigens of vaccination schedules.
• Extending coverage to all corners of a country.
• Spreading services to reach the less privileged sectors of the society
• The primary healthcare concept as enunciated in the 1978 Alma-Ata
Declaration included immunization as one of the strategies for reaching the goal
of “Health For All” by the year 2000.
• The Government of India launched EPI in1978 with objective of reducing mortality
and morbidity resulting from vaccine-preventable diseases of childhood and to
achieve self sufficiency in the production of vaccines.
Presentation title 3
• In October 1985, UNICEF emphasized the goal of achieving
universal immunization by 1990 so the global program was renamed
as ‘Universal Child Immunization’.
• On 19 November 1985, GOI renamed EPI program, modifying the
schedule as ‘Universal Immunization Program’ dedicated to the
memory of Late Prime Minister Mrs Indira Gandhi.
• UIP has two vital components: immunization of pregnant women
against tetanus, and immunization of children in their first year of life
against the six EPI target diseases.
• The aim was to achieve 100 per cent coverage of pregnant women
with 2 doses of tetanus toxoid (or a booster dose), and at least 85 per
cent coverage of infants with 3 doses each of DPT, OPV, one dose of
BCG and one dose of measles vaccine by 1990.
Presentation title 4
Universal immunization was first taken up in 30
selected districts and catchment areas of 50 Medical
Colleges in November 1985
• A “Technology Mission on Vaccination and
Immunization of Vulnerable Population, specially
Children” was set up to cover all aspects of the
immunization activity from research and development
to actual delivery of services to the target population.
Presentation title 5
Universal immunization was first taken up in 30 selected districts and catchment
areas of 50 Medical Colleges in November 1985.
• A “Technology Mission on Vaccination and Immunization of VulnerablePopulation,
speciallyChildren”was set up to cover all aspects of the immunization activity from
research and development to actual deliveryof services to the target population.
• The immunization services are being provided through the existing health care
delivery system (i.e., MCH centres, primary health centres and subcentres, hospitals,
dispensaries and ICD units).
• During 1992 , immunization program become a componentof Child Survival and
Safe Motherhood (CSSM) program. It was recommendedto cover 100% among infant
also.
• In 1995, Pulse Polio Immunization Programwas launched as a strategy to eradicate
poliomyelitis.
Presentation title 6
• In 1997, immunization activities have been an important
component of National Reproductive and Child Health Program.
• In 2005, immunization schedule was revised incorporating hepatitis
vaccine, 2 doses of JE vaccine in selected endemic districts
1st during 9- 12 months and 2nd during 16-24 months and 2 doses of
measles vaccine, 1st dose during 9-12 months and 2nd dose during
16-24 months, under National Rural Health Mission (NRHM).
Presentation title 7
• In 2012, GOI declared 2012 as the “Year of Intensification
of Routine Immunization”.
• In 2013, GOI along with other S-E Asia regions, declared
commitment towards measles elimination and congenital
rubella syndrome control by 2020.
• In 2014, India was certified as “Polio free country”.
Presentation title 8
• Although the target was “universal” immunization by
1990, in practice, no country, even in the industrialized
world, has ever achieved 100 per cent immunization in
children.
• ‘Universal’ immunization is, therefore, best interpreted as
implying the ideal that no child should be denied
immunization against tuberculosis, diphtheria, whooping
cough, tetanus, polio and measles.
Presentation title 9
agreed that when immunization coverage reaches a figure
of 80 per cent or more, then disease transmission patterns
are so severely disrupted as to provide a degree of
protection even for the remaining children who have not
been immunized, because of “herd immunity”.
It is also important that children are immunized during the
first year of life and that levels of immunization are
sustained so that each new generation is protected.
Presentation title 10
Significant achievements have been made in India.
• At the beginning of the programme in 1985-86, vaccine coverage
ranged between 29 per cent for BCG and 41 per cent for DPT.
• By the end of 2014, coverage levels had gone up significantly to
about
• 87 per cent for tetanus toxoid for pregnant women
• about 91 per cent for BCG
Presentation title 11
• 83 per cent for measles
• 82 per cent for OPV 3 doses and
• 70 per cent for HepB3 and
• 20 percent for Hib3.
Presentation title 12
• To strengthen routine immunization, Government of India has planned the
State Programme Implementation Plan (PIP) part C
. • It consists of:
(a) Support for alternate vaccine delivery from PHC to sub-centre and outreach
sessions;
(b) Deploying retired manpower to carry out immunization activities in urban
slums and underserved areas, where services are deficient;
(c) Mobility support to district immunization officer as per state plan for
monitoring and supportive supervision;
Presentation title 13
(d) Review meeting at the state level with the districts at 6 monthly intervals;
(e) Training of ANM, cold chain handlers, mid-level managers, refrigerator
mechanics etc.;
(f) Support for mobilization of children to immunization session sites by ASHA,
women self-help groups etc.; (g) Printing of immunization cards, monitoring
sheet, cold chain chart vaccine inventory charts etc.
Presentation title 14
• In addition, central government is supporting in supplies of auto-
disposable syringes, downsizing the BCG vial from 20 doses to 10 doses to
ensure that BCG vaccine is available in all immunizationsession sites,
strengthening and maintenance of the cold chain system in the states, and
supply of vaccines and vaccine van.
Presentation title 15
PULSE POLIO IMMUNIZATION PROGRAMME
Pulse Polio Immunization
Programme was launched in the country in the year 1995.
• In this programme children under five years of age are given
additional oral polio drops in December and January every
year on fixed days.
• From 1999-2000,house to house vaccination of missed
children was also introduced.
Presentation title 16
PULSE POLIO IMMUNIZATION PROGRAMME
Pulse Polio Immunization
The NIDs rounds cover approximately 172 million children and
SNIDs rounds cover 40-80 million children. In addition, large
scale multi- district mop-ups have been conducted.
• As a result only one case of polio was reported in 2011 in the
month of January.
• As on 25th Feb 2012, India was removed from the list of
polio endemic countries, and on 27th March 2014, India was
certified as polio-free country.
Presentation title 17
INTRODUCTION OF HEPATITIS-B VACCINE
• In 2010-2011, Government of India universalized hepatitis
B vaccination to all States/UTs in the country.
• Monovalent hepatitis B vaccine is given as intramuscular
injection to the infant at 6th, 10th and 14th week along with
primary series of DPT and polio vaccines.
• In addition one dose of hepatitis B is given at birth for
institutional deliveries within 24 hours of birth.
18
INTRODUCTION OF JE VACCINE •
The programme was introduced in 2006 to cover 104 endemic districts in phased
manner, using SA 14-14-2 vaccine, imported from China.
• Single dose of JE vaccine was given to all children between 1 to 15 years of age
through campaigns
. • The JE vaccine is being integrated into routine immunization in the districts
where campaign had already been conducted to immunize the new cohort of
children by vaccinating with two doses at 9-12 months and 16-24 months.
Presentation title 19
INTRODUCTION OF MEASLES
VACCINE SECOND OPPORTUNITY
• In order to accelerate the reduction of measles related morbidity
and mortality, second opportunity for measles vaccination is being
implemented.
• The National Technical Advisory Group on immunization
recommended introduction of 2nd dose of measles vaccine to
children between 9 months and 10 years of age through
supplementary immunization activity (SIA) for states where
evaluated coverage of first dose of measles vaccination is less than
80 per cent.
• In states, with coverage of measles vaccination more than 80 per
cent, the second dose of vaccine was given through routine
immunization at 16-24 months.
Presentation title 20
INTRODUCTION OF
PENTAVALENT VACCINE (DPT + Hep-B +
Hib)
• India introduced pentavalent vaccine containing DPT, hepatitis B and Hib vaccines in two
states viz. Kerala and Tamil Nadu under routine immunization programme from December
2011
• DPT and hepatitis B vaccination require 6 injections to deliver primary doses
. • With the introduction of pentavalent vaccine, a new antigen, i.e., Hib has been added
which protects against haemophilus influenzae type B (associated with pneumonia and
meningitis) and the number of injections are reduced to 3
• The vaccinehas been expanded to 6 more states, i.e., Haryana, Jammu and Kashmir,
Gujarat, Karnataka, Goa and Puducherry in 2012-13
Now pentavalent vaccine is being given in all states
Presentation title
MISSION INDRADHANUSH
• The Government of India launched Mission Indradhanush on
25th December 2014
to cover children who are either unvaccinated or partially
vaccinated against seven vaccine preventable diseases
i.e., diphtheria, whooping cough, tetanus, polio,
tuberculosis, measles and hepatitis B.
• The goal is to vaccinate all under-fives by the year 2020.
• 201 high focus districts were covered in the first phase.
Presentation title 22
MISSION INDRADHANUSH
Of these 82 districts are from Uttar Pradesh,Bihar, Madhya
Pradesh and Rajasthan.
These 201 districts have nearly 50 per cent of all
unvaccinated children ofthe country.
The drive was througha “catch-up” campaign mode.
The mission was technically supported by WHO, UNICEF,
Rotary International and other donor partners.
Presentation title 23
Governmentof India
However, vaccination on demand to children up to 5 years of
age will be provided during IMI rounds
• IMI focus on children up to 2 years of age and pregnant
women who have missed out on routine immunization
• introduced “Intensified Mission Indradhanush (IMI)” in
selected districts and urban areas of the country to achieve
the target of more than 90% coverage
Presentation title 24
Governmentof India
These 7 days do not include holidays, Sundays and the routine
immunization days planned in that week.
• Intensified Mission Indradhanush Immunization drive will
be spread over 7 working days starting from 7th of every
month.
Presentation title 25
NEW VACCINES
• In April 2016, India introduced the use of fractional dose IPV (fIPV)
into the routine immunization programme in eight states
• Since March 2017 has been scaled up nationwide in all 36 states.
Two fractional doses of IPV 0.1ml, are being given intradermally at 6
and 14 weeks.
Presentation title 26
NEW VACCINES
Two fractional doses of IPV 0.1ml, are being given intradermally at 6
and 14 weeks.
• On 5 Feb 2017, The Ministry of Health and Family Welfare launched
Measles Rubella (MR) vaccination campaign in the country, following
the campaign, Measles-Rubella vaccine will be introduced in routine
immunization,
replacing the currently given two doses of measles vaccine, at 9-12
months and 16-24 months of age in five States/UTs (Karnataka, Tamil
Nadu, Pondicherry, Goa and Lakshadweep).
Presentation title 27
• In March 2016, the Rotavirus vaccine was first introduced in four
states namely Haryana, Himachal Pradesh,Andhra Pradesh and
Odisha.
On 18 Feb 2017, Union Minister for Health and Family Welfare
announced the expansion of the Rotavirus vaccine under its UIP
in five additional states ofAssam, Tripura, Madhya Pradesh,
Rajasthan and Tamil Nadu.
• On 13 May 2017, Union Minister for Health and Family Welfare,
announced the introduction of pneumococcal conjugate vaccine
(PCV) in the UIP.
Presentation title 28
Currently, the vaccine is being rolled out to approximately 21
lakh children in Himachal Pradesh and parts of Bihar and Uttar
Pradesh in the first phase.
This will be followed by introduction in Madhya Pradesh and
Rajasthan next year, and eventually be expanded to the
country in a phased manner.
Presentation title 29
Implementation of Routine Immunization
• RI targets to vaccinate 26 million new born each year with all primary
doses and ~100 million children of 1-5 year age with booster doses of UIP
vaccines. In addition, 30 million pregnant mothers are targeted for TT
vaccination each year.
• To vaccinate this cohort of 156 million beneficiaries, ~9 million
immunization sessions are conducted, majority of these are at village
level.
• ASHA and AWW support ANM by mobilizing eligible children to session
site thus try to ensure that no child is missed.
ASHA is also provided an incentive of Rs. 150/session for this activity.
Presentation title 30
Implementation of Routine Immunization
• To ensure potent and safe vaccines are delivered to children, a network
of ~27,000 cold chain points have been created across the country where
vaccines are stored at recommended temperatures.
• To ensure safe injection practices, Government of India endeavors to
ensure continuous supply of injection safety equipments (AD syringes,
reconstitution syringes, hub cutters and waste disposal bags).
Presentation title 31
Achievements: • The biggest
Achievement of the
immunization program is
the eradication of small
pox.
• One more
significant
milestoneis that
India is free of
Poliomyelitis caused
by Wild Polio Virus
(WPV)
• Vaccination has
contributed
significantly to the
decline in the cases
and deaths due to
the Vaccine
Preventable
Diseases (VPDs).
Presentation title 32
THANK YOU

More Related Content

What's hot

Chapter 6.1 national tobacco control program
Chapter 6.1 national tobacco control programChapter 6.1 national tobacco control program
Chapter 6.1 national tobacco control programNilesh Kucha
 
pulse polio immunization programme:an overview
pulse polio immunization programme:an overviewpulse polio immunization programme:an overview
pulse polio immunization programme:an overviewBhagya Vijayan
 
National filarial control programme
National filarial control programmeNational filarial control programme
National filarial control programmeTriptiSharma72
 
Pulse polio programme.pptx
Pulse polio programme.pptxPulse polio programme.pptx
Pulse polio programme.pptxSneha Gaurkar
 
Universal immunization programme
Universal immunization programmeUniversal immunization programme
Universal immunization programmeDaulal Chouhan
 
Universal Immunisation Programme.pptx
Universal Immunisation Programme.pptxUniversal Immunisation Programme.pptx
Universal Immunisation Programme.pptxEasy Concept
 
Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization ProgramSravani Ambati
 
National Leprosy Eradication Programme
National Leprosy Eradication ProgrammeNational Leprosy Eradication Programme
National Leprosy Eradication ProgrammeVivek Varat
 
Integrated diseases surveillance programme
Integrated diseases surveillance programmeIntegrated diseases surveillance programme
Integrated diseases surveillance programmeSharon Treesa Antony
 
National tuberculosis program (INDIA)
National tuberculosis program (INDIA)National tuberculosis program (INDIA)
National tuberculosis program (INDIA)Rahul Ratnakumar
 
Pulse polio immunizaton program
Pulse polio immunizaton programPulse polio immunizaton program
Pulse polio immunizaton programJobin Jacob
 
National tobacco control program (ntcp) in india
National tobacco control program (ntcp) in india National tobacco control program (ntcp) in india
National tobacco control program (ntcp) in india AhmadAbdussalam1
 
8.Leprosy Control Programmes In India
8.Leprosy Control Programmes In India8.Leprosy Control Programmes In India
8.Leprosy Control Programmes In IndiaPrasanna Vadhanan
 
Universal Immunization Programme
Universal Immunization ProgrammeUniversal Immunization Programme
Universal Immunization ProgrammeLalit Kumar
 
National AIDS Control Programme NACP
National AIDS Control Programme NACPNational AIDS Control Programme NACP
National AIDS Control Programme NACPHarsh Rastogi
 

What's hot (20)

Chapter 6.1 national tobacco control program
Chapter 6.1 national tobacco control programChapter 6.1 national tobacco control program
Chapter 6.1 national tobacco control program
 
AIDS CONTROL PROGRAMME
AIDS CONTROL PROGRAMMEAIDS CONTROL PROGRAMME
AIDS CONTROL PROGRAMME
 
pulse polio immunization programme:an overview
pulse polio immunization programme:an overviewpulse polio immunization programme:an overview
pulse polio immunization programme:an overview
 
National filarial control programme
National filarial control programmeNational filarial control programme
National filarial control programme
 
Malaria
MalariaMalaria
Malaria
 
Pulse polio programme.pptx
Pulse polio programme.pptxPulse polio programme.pptx
Pulse polio programme.pptx
 
Universal immunization programme
Universal immunization programmeUniversal immunization programme
Universal immunization programme
 
Universal Immunisation Programme.pptx
Universal Immunisation Programme.pptxUniversal Immunisation Programme.pptx
Universal Immunisation Programme.pptx
 
Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization Program
 
National Leprosy Eradication Programme
National Leprosy Eradication ProgrammeNational Leprosy Eradication Programme
National Leprosy Eradication Programme
 
Integrated diseases surveillance programme
Integrated diseases surveillance programmeIntegrated diseases surveillance programme
Integrated diseases surveillance programme
 
National tuberculosis program (INDIA)
National tuberculosis program (INDIA)National tuberculosis program (INDIA)
National tuberculosis program (INDIA)
 
Pulse polio immunizaton program
Pulse polio immunizaton programPulse polio immunizaton program
Pulse polio immunizaton program
 
Pulse polio
Pulse polioPulse polio
Pulse polio
 
National tobacco control program (ntcp) in india
National tobacco control program (ntcp) in india National tobacco control program (ntcp) in india
National tobacco control program (ntcp) in india
 
Polio
PolioPolio
Polio
 
8.Leprosy Control Programmes In India
8.Leprosy Control Programmes In India8.Leprosy Control Programmes In India
8.Leprosy Control Programmes In India
 
Universal Immunization Programme
Universal Immunization ProgrammeUniversal Immunization Programme
Universal Immunization Programme
 
IDSP
IDSPIDSP
IDSP
 
National AIDS Control Programme NACP
National AIDS Control Programme NACPNational AIDS Control Programme NACP
National AIDS Control Programme NACP
 

Similar to universal immunization program.pptx

ExtendedImmunizationProgrammeEPIlecture.pptx
ExtendedImmunizationProgrammeEPIlecture.pptxExtendedImmunizationProgrammeEPIlecture.pptx
ExtendedImmunizationProgrammeEPIlecture.pptxAnamFatima487809
 
NATIONAL IMMUNISATION PROGRAMME ...
NATIONAL IMMUNISATION PROGRAMME ...NATIONAL IMMUNISATION PROGRAMME ...
NATIONAL IMMUNISATION PROGRAMME ...amol askar
 
Universal Immunisation program .pptx
Universal Immunisation program .pptxUniversal Immunisation program .pptx
Universal Immunisation program .pptxRahulKumar924284
 
Universal immunisation program
Universal immunisation programUniversal immunisation program
Universal immunisation programShivangi dixit
 
Universal vaccination programme
Universal  vaccination programmeUniversal  vaccination programme
Universal vaccination programmePaavana0809
 
National immunization programme
National immunization programmeNational immunization programme
National immunization programmeAnju sapkota
 
National Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB PerspectivesNational Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB PerspectivesMohammad Aslam Shaiekh
 
Pulse Polio Program by Mujahid
Pulse Polio Program by MujahidPulse Polio Program by Mujahid
Pulse Polio Program by MujahidHOME
 
Vaccine Preventable Diseases Nepal EBPH.pptx
Vaccine Preventable Diseases Nepal EBPH.pptxVaccine Preventable Diseases Nepal EBPH.pptx
Vaccine Preventable Diseases Nepal EBPH.pptxHarishBhatta5
 
Presentation (3) (1).pptx polio eradication programme
Presentation (3) (1).pptx polio eradication programmePresentation (3) (1).pptx polio eradication programme
Presentation (3) (1).pptx polio eradication programmeKanchanDyal
 
finalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdffinalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdfjyothi132223
 
Final newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptFinal newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptIMS-BHU VARANASI
 
Presentation on pulse polio program pihu.pptx
Presentation on pulse polio program pihu.pptxPresentation on pulse polio program pihu.pptx
Presentation on pulse polio program pihu.pptxKanchanDyal
 
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptx
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptxPULSE POLIO ,IMMUNIZATION PROGRAMME.pptx
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptx M.Josephin Dayana
 
National health and family welfare programmers
National health and family welfare programmersNational health and family welfare programmers
National health and family welfare programmersSreethaAkhil
 
Health programmes in india
Health programmes in indiaHealth programmes in india
Health programmes in indiaSREESHNAKC
 
National Health Programme Part 2
National Health  Programme Part 2National Health  Programme Part 2
National Health Programme Part 2theerthapk
 
National programs dr jason [autosaved]
National programs dr jason [autosaved]National programs dr jason [autosaved]
National programs dr jason [autosaved]Jason Dsouza
 

Similar to universal immunization program.pptx (20)

ExtendedImmunizationProgrammeEPIlecture.pptx
ExtendedImmunizationProgrammeEPIlecture.pptxExtendedImmunizationProgrammeEPIlecture.pptx
ExtendedImmunizationProgrammeEPIlecture.pptx
 
NATIONAL IMMUNISATION PROGRAMME ...
NATIONAL IMMUNISATION PROGRAMME ...NATIONAL IMMUNISATION PROGRAMME ...
NATIONAL IMMUNISATION PROGRAMME ...
 
Universal Immunisation program .pptx
Universal Immunisation program .pptxUniversal Immunisation program .pptx
Universal Immunisation program .pptx
 
Universal immunisation program
Universal immunisation programUniversal immunisation program
Universal immunisation program
 
Universal vaccination programme
Universal  vaccination programmeUniversal  vaccination programme
Universal vaccination programme
 
National immunization programme
National immunization programmeNational immunization programme
National immunization programme
 
National Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB PerspectivesNational Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB Perspectives
 
Pulse Polio Program by Mujahid
Pulse Polio Program by MujahidPulse Polio Program by Mujahid
Pulse Polio Program by Mujahid
 
Vaccine Preventable Diseases Nepal EBPH.pptx
Vaccine Preventable Diseases Nepal EBPH.pptxVaccine Preventable Diseases Nepal EBPH.pptx
Vaccine Preventable Diseases Nepal EBPH.pptx
 
Child health
Child healthChild health
Child health
 
Presentation (3) (1).pptx polio eradication programme
Presentation (3) (1).pptx polio eradication programmePresentation (3) (1).pptx polio eradication programme
Presentation (3) (1).pptx polio eradication programme
 
finalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdffinalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdf
 
Final newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptFinal newer vaccines akhilesh ppt
Final newer vaccines akhilesh ppt
 
Presentation on pulse polio program pihu.pptx
Presentation on pulse polio program pihu.pptxPresentation on pulse polio program pihu.pptx
Presentation on pulse polio program pihu.pptx
 
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptx
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptxPULSE POLIO ,IMMUNIZATION PROGRAMME.pptx
PULSE POLIO ,IMMUNIZATION PROGRAMME.pptx
 
National health and family welfare programmers
National health and family welfare programmersNational health and family welfare programmers
National health and family welfare programmers
 
Health programmes in india
Health programmes in indiaHealth programmes in india
Health programmes in india
 
National Health Programme Part 2
National Health  Programme Part 2National Health  Programme Part 2
National Health Programme Part 2
 
National programs dr jason [autosaved]
National programs dr jason [autosaved]National programs dr jason [autosaved]
National programs dr jason [autosaved]
 
Exhibition on Family Planning
Exhibition on Family PlanningExhibition on Family Planning
Exhibition on Family Planning
 

More from bharatibakde1

EVALUATION OF PARENTERALS.pptx
EVALUATION OF PARENTERALS.pptxEVALUATION OF PARENTERALS.pptx
EVALUATION OF PARENTERALS.pptxbharatibakde1
 
National programme for prevention and control of Deafness.pptx
National programme for prevention and control of Deafness.pptxNational programme for prevention and control of Deafness.pptx
National programme for prevention and control of Deafness.pptxbharatibakde1
 
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptx
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptxNATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptx
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptxbharatibakde1
 
Personality Defects Removal Process UPDATED.pptx
Personality Defects Removal Process UPDATED.pptxPersonality Defects Removal Process UPDATED.pptx
Personality Defects Removal Process UPDATED.pptxbharatibakde1
 
VANISHING CREAM.pptx
VANISHING CREAM.pptxVANISHING CREAM.pptx
VANISHING CREAM.pptxbharatibakde1
 
OPTHALMIC PRODUCTS.pptx
OPTHALMIC PRODUCTS.pptxOPTHALMIC PRODUCTS.pptx
OPTHALMIC PRODUCTS.pptxbharatibakde1
 
PARENTERAL PRODUCTS.pptx
PARENTERAL PRODUCTS.pptxPARENTERAL PRODUCTS.pptx
PARENTERAL PRODUCTS.pptxbharatibakde1
 

More from bharatibakde1 (15)

EVALUATION OF PARENTERALS.pptx
EVALUATION OF PARENTERALS.pptxEVALUATION OF PARENTERALS.pptx
EVALUATION OF PARENTERALS.pptx
 
National programme for prevention and control of Deafness.pptx
National programme for prevention and control of Deafness.pptxNational programme for prevention and control of Deafness.pptx
National programme for prevention and control of Deafness.pptx
 
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptx
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptxNATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptx
NATIONAL TOBACCO CONTROL PROGRAMME [Autosaved].pptx
 
SARS.pptx
SARS.pptxSARS.pptx
SARS.pptx
 
INFLUENZA.pptx
INFLUENZA.pptxINFLUENZA.pptx
INFLUENZA.pptx
 
EBOLA.pptx
EBOLA.pptxEBOLA.pptx
EBOLA.pptx
 
Chickengunea.pptx
Chickengunea.pptxChickengunea.pptx
Chickengunea.pptx
 
PNEUMONIA.pptx
PNEUMONIA.pptxPNEUMONIA.pptx
PNEUMONIA.pptx
 
Personality Defects Removal Process UPDATED.pptx
Personality Defects Removal Process UPDATED.pptxPersonality Defects Removal Process UPDATED.pptx
Personality Defects Removal Process UPDATED.pptx
 
VANISHING CREAM.pptx
VANISHING CREAM.pptxVANISHING CREAM.pptx
VANISHING CREAM.pptx
 
TABLETS UPLOAD.pptx
TABLETS UPLOAD.pptxTABLETS UPLOAD.pptx
TABLETS UPLOAD.pptx
 
AEROSOL.pptx
AEROSOL.pptxAEROSOL.pptx
AEROSOL.pptx
 
OPTHALMIC PRODUCTS.pptx
OPTHALMIC PRODUCTS.pptxOPTHALMIC PRODUCTS.pptx
OPTHALMIC PRODUCTS.pptx
 
PELLETS.pptx
PELLETS.pptxPELLETS.pptx
PELLETS.pptx
 
PARENTERAL PRODUCTS.pptx
PARENTERAL PRODUCTS.pptxPARENTERAL PRODUCTS.pptx
PARENTERAL PRODUCTS.pptx
 

Recently uploaded

VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591
VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591
VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591adityaroy0215
 
Leading transformational change: inner and outer skills
Leading transformational change: inner and outer skillsLeading transformational change: inner and outer skills
Leading transformational change: inner and outer skillsHelenBevan4
 
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012Call Girls Service Gurgaon
 
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...Call Girls Noida
 
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar Suman
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar SumanCall Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar Suman
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar SumanCall Girls Service Chandigarh Ayushi
 
Basics of Anatomy- Language of Anatomy.pptx
Basics of Anatomy- Language of Anatomy.pptxBasics of Anatomy- Language of Anatomy.pptx
Basics of Anatomy- Language of Anatomy.pptxAyush Gupta
 
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Me
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near MeVIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Me
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Memriyagarg453
 
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real MeetCall Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meetpriyashah722354
 
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknow
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in LucknowRussian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknow
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknowgragteena
 
Udaipur Call Girls 📲 9999965857 Call Girl in Udaipur
Udaipur Call Girls 📲 9999965857 Call Girl in UdaipurUdaipur Call Girls 📲 9999965857 Call Girl in Udaipur
Udaipur Call Girls 📲 9999965857 Call Girl in Udaipurseemahedar019
 
Jalandhar Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...
Jalandhar  Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...Jalandhar  Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...
Jalandhar Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...Call Girls Service Chandigarh Ayushi
 
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking Models
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking ModelsDehradun Call Girls Service 8854095900 Real Russian Girls Looking Models
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking Modelsindiancallgirl4rent
 
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅gragmanisha42
 
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service Dehradun
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service DehradunDehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service Dehradun
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service DehradunNiamh verma
 
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service Gurgaon
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service GurgaonCall Girl Gurgaon Saloni 9711199012 Independent Escort Service Gurgaon
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service GurgaonCall Girls Service Gurgaon
 
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR Call G...
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR   Call G...❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR   Call G...
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR Call G...Gfnyt.com
 
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...indiancallgirl4rent
 

Recently uploaded (20)

VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591
VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591
VIP Call Girl Sector 88 Gurgaon Delhi Just Call Me 9899900591
 
Leading transformational change: inner and outer skills
Leading transformational change: inner and outer skillsLeading transformational change: inner and outer skills
Leading transformational change: inner and outer skills
 
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012
VIP Call Girls Sector 67 Gurgaon Just Call Me 9711199012
 
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...
pOOJA sexy Call Girls In Sector 49,9999965857 Young Female Escorts Service In...
 
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar Suman
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar SumanCall Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar Suman
Call Girl Price Amritsar ❤️🍑 9053900678 Call Girls in Amritsar Suman
 
Basics of Anatomy- Language of Anatomy.pptx
Basics of Anatomy- Language of Anatomy.pptxBasics of Anatomy- Language of Anatomy.pptx
Basics of Anatomy- Language of Anatomy.pptx
 
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Me
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near MeVIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Me
VIP Call Girls Noida Jhanvi 9711199171 Best VIP Call Girls Near Me
 
Call Girls in Lucknow Esha 🔝 8923113531 🔝 🎶 Independent Escort Service Lucknow
Call Girls in Lucknow Esha 🔝 8923113531  🔝 🎶 Independent Escort Service LucknowCall Girls in Lucknow Esha 🔝 8923113531  🔝 🎶 Independent Escort Service Lucknow
Call Girls in Lucknow Esha 🔝 8923113531 🔝 🎶 Independent Escort Service Lucknow
 
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real MeetCall Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meet
Call Girls Chandigarh 👙 7001035870 👙 Genuine WhatsApp Number for Real Meet
 
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknow
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in LucknowRussian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknow
Russian Escorts Aishbagh Road * 9548273370 Naughty Call Girls Service in Lucknow
 
Udaipur Call Girls 📲 9999965857 Call Girl in Udaipur
Udaipur Call Girls 📲 9999965857 Call Girl in UdaipurUdaipur Call Girls 📲 9999965857 Call Girl in Udaipur
Udaipur Call Girls 📲 9999965857 Call Girl in Udaipur
 
Jalandhar Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...
Jalandhar  Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...Jalandhar  Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...
Jalandhar Female Call Girls Contact Number 9053900678 💚Jalandhar Female Call...
 
Call Girl Dehradun Aashi 🔝 7001305949 🔝 💃 Independent Escort Service Dehradun
Call Girl Dehradun Aashi 🔝 7001305949 🔝 💃 Independent Escort Service DehradunCall Girl Dehradun Aashi 🔝 7001305949 🔝 💃 Independent Escort Service Dehradun
Call Girl Dehradun Aashi 🔝 7001305949 🔝 💃 Independent Escort Service Dehradun
 
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking Models
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking ModelsDehradun Call Girls Service 8854095900 Real Russian Girls Looking Models
Dehradun Call Girls Service 8854095900 Real Russian Girls Looking Models
 
Call Girl Lucknow Gauri 🔝 8923113531 🔝 🎶 Independent Escort Service Lucknow
Call Girl Lucknow Gauri 🔝 8923113531  🔝 🎶 Independent Escort Service LucknowCall Girl Lucknow Gauri 🔝 8923113531  🔝 🎶 Independent Escort Service Lucknow
Call Girl Lucknow Gauri 🔝 8923113531 🔝 🎶 Independent Escort Service Lucknow
 
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅
Russian Call Girls Kota * 8250192130 Service starts from just ₹9999 ✅
 
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service Dehradun
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service DehradunDehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service Dehradun
Dehradun Call Girls Service ❤️🍑 8854095900 👄🫦Independent Escort Service Dehradun
 
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service Gurgaon
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service GurgaonCall Girl Gurgaon Saloni 9711199012 Independent Escort Service Gurgaon
Call Girl Gurgaon Saloni 9711199012 Independent Escort Service Gurgaon
 
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR Call G...
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR   Call G...❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR   Call G...
❤️♀️@ Jaipur Call Girls ❤️♀️@ Meghna Jaipur Call Girls Number CRTHNR Call G...
 
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...
(Sonam Bajaj) Call Girl in Jaipur- 09257276172 Escorts Service 50% Off with C...
 

universal immunization program.pptx

  • 2. Introduction • Smallpox Eradication Program, it was experienced that immunization is the most powerful and cost- effective weapon for the prevention and control and even eradication of a disease. • In 1974, WHO officially launched a global immunization program, known as Expanded Program of Immunization for the prevention and control of six killer diseases of children namely tuberculosis, diphtheria, pertussis, tetanus, poliomyelitis and measles, all over the world. Presentation title 2
  • 3. It was called Expanded because: • Adding more disease controlling antigens of vaccination schedules. • Extending coverage to all corners of a country. • Spreading services to reach the less privileged sectors of the society • The primary healthcare concept as enunciated in the 1978 Alma-Ata Declaration included immunization as one of the strategies for reaching the goal of “Health For All” by the year 2000. • The Government of India launched EPI in1978 with objective of reducing mortality and morbidity resulting from vaccine-preventable diseases of childhood and to achieve self sufficiency in the production of vaccines. Presentation title 3
  • 4. • In October 1985, UNICEF emphasized the goal of achieving universal immunization by 1990 so the global program was renamed as ‘Universal Child Immunization’. • On 19 November 1985, GOI renamed EPI program, modifying the schedule as ‘Universal Immunization Program’ dedicated to the memory of Late Prime Minister Mrs Indira Gandhi. • UIP has two vital components: immunization of pregnant women against tetanus, and immunization of children in their first year of life against the six EPI target diseases. • The aim was to achieve 100 per cent coverage of pregnant women with 2 doses of tetanus toxoid (or a booster dose), and at least 85 per cent coverage of infants with 3 doses each of DPT, OPV, one dose of BCG and one dose of measles vaccine by 1990. Presentation title 4
  • 5. Universal immunization was first taken up in 30 selected districts and catchment areas of 50 Medical Colleges in November 1985 • A “Technology Mission on Vaccination and Immunization of Vulnerable Population, specially Children” was set up to cover all aspects of the immunization activity from research and development to actual delivery of services to the target population. Presentation title 5
  • 6. Universal immunization was first taken up in 30 selected districts and catchment areas of 50 Medical Colleges in November 1985. • A “Technology Mission on Vaccination and Immunization of VulnerablePopulation, speciallyChildren”was set up to cover all aspects of the immunization activity from research and development to actual deliveryof services to the target population. • The immunization services are being provided through the existing health care delivery system (i.e., MCH centres, primary health centres and subcentres, hospitals, dispensaries and ICD units). • During 1992 , immunization program become a componentof Child Survival and Safe Motherhood (CSSM) program. It was recommendedto cover 100% among infant also. • In 1995, Pulse Polio Immunization Programwas launched as a strategy to eradicate poliomyelitis. Presentation title 6
  • 7. • In 1997, immunization activities have been an important component of National Reproductive and Child Health Program. • In 2005, immunization schedule was revised incorporating hepatitis vaccine, 2 doses of JE vaccine in selected endemic districts 1st during 9- 12 months and 2nd during 16-24 months and 2 doses of measles vaccine, 1st dose during 9-12 months and 2nd dose during 16-24 months, under National Rural Health Mission (NRHM). Presentation title 7
  • 8. • In 2012, GOI declared 2012 as the “Year of Intensification of Routine Immunization”. • In 2013, GOI along with other S-E Asia regions, declared commitment towards measles elimination and congenital rubella syndrome control by 2020. • In 2014, India was certified as “Polio free country”. Presentation title 8
  • 9. • Although the target was “universal” immunization by 1990, in practice, no country, even in the industrialized world, has ever achieved 100 per cent immunization in children. • ‘Universal’ immunization is, therefore, best interpreted as implying the ideal that no child should be denied immunization against tuberculosis, diphtheria, whooping cough, tetanus, polio and measles. Presentation title 9
  • 10. agreed that when immunization coverage reaches a figure of 80 per cent or more, then disease transmission patterns are so severely disrupted as to provide a degree of protection even for the remaining children who have not been immunized, because of “herd immunity”. It is also important that children are immunized during the first year of life and that levels of immunization are sustained so that each new generation is protected. Presentation title 10
  • 11. Significant achievements have been made in India. • At the beginning of the programme in 1985-86, vaccine coverage ranged between 29 per cent for BCG and 41 per cent for DPT. • By the end of 2014, coverage levels had gone up significantly to about • 87 per cent for tetanus toxoid for pregnant women • about 91 per cent for BCG Presentation title 11
  • 12. • 83 per cent for measles • 82 per cent for OPV 3 doses and • 70 per cent for HepB3 and • 20 percent for Hib3. Presentation title 12
  • 13. • To strengthen routine immunization, Government of India has planned the State Programme Implementation Plan (PIP) part C . • It consists of: (a) Support for alternate vaccine delivery from PHC to sub-centre and outreach sessions; (b) Deploying retired manpower to carry out immunization activities in urban slums and underserved areas, where services are deficient; (c) Mobility support to district immunization officer as per state plan for monitoring and supportive supervision; Presentation title 13
  • 14. (d) Review meeting at the state level with the districts at 6 monthly intervals; (e) Training of ANM, cold chain handlers, mid-level managers, refrigerator mechanics etc.; (f) Support for mobilization of children to immunization session sites by ASHA, women self-help groups etc.; (g) Printing of immunization cards, monitoring sheet, cold chain chart vaccine inventory charts etc. Presentation title 14
  • 15. • In addition, central government is supporting in supplies of auto- disposable syringes, downsizing the BCG vial from 20 doses to 10 doses to ensure that BCG vaccine is available in all immunizationsession sites, strengthening and maintenance of the cold chain system in the states, and supply of vaccines and vaccine van. Presentation title 15
  • 16. PULSE POLIO IMMUNIZATION PROGRAMME Pulse Polio Immunization Programme was launched in the country in the year 1995. • In this programme children under five years of age are given additional oral polio drops in December and January every year on fixed days. • From 1999-2000,house to house vaccination of missed children was also introduced. Presentation title 16
  • 17. PULSE POLIO IMMUNIZATION PROGRAMME Pulse Polio Immunization The NIDs rounds cover approximately 172 million children and SNIDs rounds cover 40-80 million children. In addition, large scale multi- district mop-ups have been conducted. • As a result only one case of polio was reported in 2011 in the month of January. • As on 25th Feb 2012, India was removed from the list of polio endemic countries, and on 27th March 2014, India was certified as polio-free country. Presentation title 17
  • 18. INTRODUCTION OF HEPATITIS-B VACCINE • In 2010-2011, Government of India universalized hepatitis B vaccination to all States/UTs in the country. • Monovalent hepatitis B vaccine is given as intramuscular injection to the infant at 6th, 10th and 14th week along with primary series of DPT and polio vaccines. • In addition one dose of hepatitis B is given at birth for institutional deliveries within 24 hours of birth. 18
  • 19. INTRODUCTION OF JE VACCINE • The programme was introduced in 2006 to cover 104 endemic districts in phased manner, using SA 14-14-2 vaccine, imported from China. • Single dose of JE vaccine was given to all children between 1 to 15 years of age through campaigns . • The JE vaccine is being integrated into routine immunization in the districts where campaign had already been conducted to immunize the new cohort of children by vaccinating with two doses at 9-12 months and 16-24 months. Presentation title 19
  • 20. INTRODUCTION OF MEASLES VACCINE SECOND OPPORTUNITY • In order to accelerate the reduction of measles related morbidity and mortality, second opportunity for measles vaccination is being implemented. • The National Technical Advisory Group on immunization recommended introduction of 2nd dose of measles vaccine to children between 9 months and 10 years of age through supplementary immunization activity (SIA) for states where evaluated coverage of first dose of measles vaccination is less than 80 per cent. • In states, with coverage of measles vaccination more than 80 per cent, the second dose of vaccine was given through routine immunization at 16-24 months. Presentation title 20
  • 21. INTRODUCTION OF PENTAVALENT VACCINE (DPT + Hep-B + Hib) • India introduced pentavalent vaccine containing DPT, hepatitis B and Hib vaccines in two states viz. Kerala and Tamil Nadu under routine immunization programme from December 2011 • DPT and hepatitis B vaccination require 6 injections to deliver primary doses . • With the introduction of pentavalent vaccine, a new antigen, i.e., Hib has been added which protects against haemophilus influenzae type B (associated with pneumonia and meningitis) and the number of injections are reduced to 3 • The vaccinehas been expanded to 6 more states, i.e., Haryana, Jammu and Kashmir, Gujarat, Karnataka, Goa and Puducherry in 2012-13 Now pentavalent vaccine is being given in all states Presentation title
  • 22. MISSION INDRADHANUSH • The Government of India launched Mission Indradhanush on 25th December 2014 to cover children who are either unvaccinated or partially vaccinated against seven vaccine preventable diseases i.e., diphtheria, whooping cough, tetanus, polio, tuberculosis, measles and hepatitis B. • The goal is to vaccinate all under-fives by the year 2020. • 201 high focus districts were covered in the first phase. Presentation title 22
  • 23. MISSION INDRADHANUSH Of these 82 districts are from Uttar Pradesh,Bihar, Madhya Pradesh and Rajasthan. These 201 districts have nearly 50 per cent of all unvaccinated children ofthe country. The drive was througha “catch-up” campaign mode. The mission was technically supported by WHO, UNICEF, Rotary International and other donor partners. Presentation title 23
  • 24. Governmentof India However, vaccination on demand to children up to 5 years of age will be provided during IMI rounds • IMI focus on children up to 2 years of age and pregnant women who have missed out on routine immunization • introduced “Intensified Mission Indradhanush (IMI)” in selected districts and urban areas of the country to achieve the target of more than 90% coverage Presentation title 24
  • 25. Governmentof India These 7 days do not include holidays, Sundays and the routine immunization days planned in that week. • Intensified Mission Indradhanush Immunization drive will be spread over 7 working days starting from 7th of every month. Presentation title 25
  • 26. NEW VACCINES • In April 2016, India introduced the use of fractional dose IPV (fIPV) into the routine immunization programme in eight states • Since March 2017 has been scaled up nationwide in all 36 states. Two fractional doses of IPV 0.1ml, are being given intradermally at 6 and 14 weeks. Presentation title 26
  • 27. NEW VACCINES Two fractional doses of IPV 0.1ml, are being given intradermally at 6 and 14 weeks. • On 5 Feb 2017, The Ministry of Health and Family Welfare launched Measles Rubella (MR) vaccination campaign in the country, following the campaign, Measles-Rubella vaccine will be introduced in routine immunization, replacing the currently given two doses of measles vaccine, at 9-12 months and 16-24 months of age in five States/UTs (Karnataka, Tamil Nadu, Pondicherry, Goa and Lakshadweep). Presentation title 27
  • 28. • In March 2016, the Rotavirus vaccine was first introduced in four states namely Haryana, Himachal Pradesh,Andhra Pradesh and Odisha. On 18 Feb 2017, Union Minister for Health and Family Welfare announced the expansion of the Rotavirus vaccine under its UIP in five additional states ofAssam, Tripura, Madhya Pradesh, Rajasthan and Tamil Nadu. • On 13 May 2017, Union Minister for Health and Family Welfare, announced the introduction of pneumococcal conjugate vaccine (PCV) in the UIP. Presentation title 28
  • 29. Currently, the vaccine is being rolled out to approximately 21 lakh children in Himachal Pradesh and parts of Bihar and Uttar Pradesh in the first phase. This will be followed by introduction in Madhya Pradesh and Rajasthan next year, and eventually be expanded to the country in a phased manner. Presentation title 29
  • 30. Implementation of Routine Immunization • RI targets to vaccinate 26 million new born each year with all primary doses and ~100 million children of 1-5 year age with booster doses of UIP vaccines. In addition, 30 million pregnant mothers are targeted for TT vaccination each year. • To vaccinate this cohort of 156 million beneficiaries, ~9 million immunization sessions are conducted, majority of these are at village level. • ASHA and AWW support ANM by mobilizing eligible children to session site thus try to ensure that no child is missed. ASHA is also provided an incentive of Rs. 150/session for this activity. Presentation title 30
  • 31. Implementation of Routine Immunization • To ensure potent and safe vaccines are delivered to children, a network of ~27,000 cold chain points have been created across the country where vaccines are stored at recommended temperatures. • To ensure safe injection practices, Government of India endeavors to ensure continuous supply of injection safety equipments (AD syringes, reconstitution syringes, hub cutters and waste disposal bags). Presentation title 31
  • 32. Achievements: • The biggest Achievement of the immunization program is the eradication of small pox. • One more significant milestoneis that India is free of Poliomyelitis caused by Wild Polio Virus (WPV) • Vaccination has contributed significantly to the decline in the cases and deaths due to the Vaccine Preventable Diseases (VPDs). Presentation title 32