SlideShare a Scribd company logo
1 of 63
What is database????
• Database are convenient system to properly store, search and
retrieve any type of data.
• A database helps to easily handle and share large amount of data
and supports large scale analysis by easy access and data updating.
What is Biological Database
• Biological databases are libraries of life sciences information
,collected from scientific experiments, published literature, high-
throughput experiment technology and computational analysis.
• They contain information from genomics, proteomics, microarray
gene expression.
• Information contained in biological databases includes gene
function, structure, localization(both cellular and
chromosomal),biological sequences and structures.
Databases Architecture
Information system
)Query system
Storage System
Data
(The Google, Entrez
SRS)
Your search key words
Oracle,MySQL,PC binary
files,Unix text
files,Bookshelves
GenBank flat file
PDB file
Interaction Record
Title of a book
Book
A Sequence Retrieving and
Manipulation Network
DNA Protein
NCBI-GenBANK PIR
DDBJ SWISSPROT
EBI-EMBL EXPASY, PDB
GCG
SeqWEB
Vector NTI
GenoMAX
Entrez
SRS
Sequnece, Pdb, Image
GenBANK
GCG
FASTA
Staden
Image Sequence
Converter
Databases
Softwares
Formats
Retrival
System
Information
Types of biological databases
 Primary Database.
Secondary database.
Primary databases
Theses are the primary sources of data used to store nucleic acid, protein sequences and
structural information of biological macromolecules.
Some primary databases-
• NCBI(The National Centre for Biotechnology Information)
• GenBank
• DDBJ (DNA data bank of Japan)
• SWISS-PROT(Swiss-Prot )
• PIR (Protein Information Resource)
• PDB(Protein Data Bank)
This sequence collection of this database is due to the efforts of basic research from
academic industrial and sequencing lab)
IAM: International Advisory Meeting
ICM: International Collaborative Meeting
GenBank/EMBL/DDBJ
International
Nucleotide Sequence Database
EMBL:
European Molecular Biology
Laboratory
EBI:
European Bioinformatics
Institute
DDBJ: DNA Data Bank of Japan
CIB: Center for Information Biology and
DNA Data Bank of Japan
NIG: National Institute of Genetics
NCBI:
National Center for Biotechnology Information
NLM:
National Library of Medicine
Secondary Database
• A Secondary database contain additional information derived from the analysis
of data available in primary sources.
• Secondary databases are analysed in a variety of ways and contain different
information in different formats.
• Some secondary databases
• TrEMBL
• Pfam
• PROSITE
• Profiles
• SCOP
• CATH
PRIMARY VS. Secondary SEQUENCE DATABASES
Sequencing
Centers
TATAGCCG TATAGCCGTATAGCCG TATAGCCG
Labs
Algorithms
UniGene
Curators
RefSeq
Genome
Assembly
TATAGCCG
AGCTCCGATA
CCGATGACAA
Updated
continually
by NCBI
Updated ONLY
by submitters
Flat File Storage Data Formats
• When GenBank, EMBL and DDBJ formed a collaboration (1986), sequence
databases had moved to a defined flat file format with a shared feature
table format and annotation standards.
• The flat file formats from the sequence databases are still used to access
and display sequence and annotation. They are also convenient for storage
of local copies.
The National Center for
Biotechnology Information
Created in 1988 as a part of the
National Library of Medicine at NIH
– Establish public databases
– Research in computational biology
– Develop software tools for sequence analysis
– Disseminate biomedical information
Bethesda,
MD
NCBI Databases and Services
• GenBank primary sequence database
• Free public access to biomedical literature
• PubMed free Medline (3 million searches per day)
• PubMed Central full text online access
• Entrez integrated molecular and literature databases
• BLAST highest volume sequence search service
(100 – 200 K searches per day)
• VAST structure similarity searches
• Software and Databases
GenBank (Genetic Sequence Databank)
• GenBank® is the genetic sequence database at the National
Center for Biotechnology Information (NCBI).
• It was established in the year 1982 and now maintained by the
NationalCenter for Biotechnology (NCBI).
• DNA sequences can be submitted to GenBank using several
different methods.
• It contains publicly available nucleotide sequences for more than
240 000 named organisms, obtained primarily through
submissions from individual laboratories and batch submissions
from large-scale sequencing projects.
• It has a flat file structure that is an ASCII text file,
readable & downloadable by both humans and
computers.
• There are two main ways of making batch sequence
submissions to GenBank: NCBI’s Barcode
SubmissionTool (BarSTool) and Sequin.
EMBL
• The European Molecular Biology Laboratory (EMBL) is a molecular biology research
institution supported by 22 member states, four prospect and two associate member
states.
• EMBL was created in 1974 and is an intergovernmental organisation funded by public
research money from its member states.
• The Laboratory operates from five sites: the main laboratory in Heidelberg, and
outstations in Hinxton (the European Bioinformatics Institute (EBI), in England),
Grenoble (France), Hamburg (Germany), and Monterotondo (near Rome).
• EMBL groups and laboratories perform basic research in molecular biology and
molecular medicine as well as training for scientists, students and visitors.
• Israel is the only Asian state that has full membership.
• The EMBL Nucleotide Sequence Database (http:// www.ebi.ac.uk/embl/), maintained
at the European Bioinformatics Institute (EBI),
• It is used to incorporate and distributes nucleotide sequences from
public sources.
• The database is a part of an international collaboration with DDBJ
(Japan) and GenBank (USA).
• Data are exchanged between the collaborating databases on a
daily basis.
• The web-based tool, Webin, is the preferred system for individual
submission of nucleotide sequences, including Third Party
Annotation (TPA) and alignment data.
• Automatic submission procedures are used for submission of data
from large-scale genome sequencing
• The latest data collection can be accessed via FTP, email and
WWW interfaces.
• The EBI's Sequence Retrieval System (SRS) integrates and links
the main nucleotide and protein databases as well as many other
specialist molecular biology databases.
• For sequence similarity searching, a variety of tools (e.g. FASTA
and BLAST) are available that allow external users to compare
their own sequences against the data in the EMBL Nucleotide
Sequence Database and other databases.
• All available resources can be accessed via the EBI home page at
EMBL format
ID LISOD standard; DNA; PRO; 756 BP.
XX
AC X64011; S78972;
XX
SV X64011.1
XX
DT 28-APR-1992 (Rel. 31, Created)
DT 30-JUN-1993 (Rel. 36, Last updated, Version 6)
XX
DE L.ivanovii sod gene for superoxide dismutase
XX
KW sod gene; superoxide dismutase.
XX
OS Listeria ivanovii
OC Bacteria; Firmicutes; Bacillus/Clostridium group;
OC Bacillus/Staphylococcus group; Listeria.
XX
RN [1]
RX MEDLINE; 92140371.
RA Haas A., Goebel W.;
RT "Cloning of a superoxide dismutase gene from Listeria ivanovii by
RT functional complementation in Escherichia coli and characterization of
the
RT gene product.";
RL Mol. Gen. Genet. 231:313-322(1992).
XX
RN [2]
RP 1-756
RA Kreft J.;
RT ;
RL Submitted (21-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL J. Kreft, Institut f. Mikrobiologie, Universitaet Wuerzburg, Biozentrum
Am
RL Hubland, 8700 Wuerzburg, FRG
XX
DR SWISS-PROT; P28763; SODM_LISIV.
XX
FH Key Location/Qualifiers
FH
FT source 1..756
FT /db_xref="taxon:1638"
FT /organism="Listeria ivanovii"
FT /strain="ATCC 19119"
FT RBS 95..100
FT /gene="sod"
FT terminator 723..746
FT /gene="sod"
FT CDS 109..717
FT /db_xref="SWISS-PROT:P28763"
FT /transl_table=11
FT /gene="sod"
FT /EC_number="1.15.1.1"
FT /product="superoxide dismutase"
FT /protein_id="CAA45406.1"
FT /translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEA
VSG
FT HAELASKPGEELVANLDSVPEEIRGAVRNHGGGHANHTLFWSSLSPNGGGAPTGNL
KAA
FT IESEFGTFDEFKEKFNAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPV
LGL
FT DVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK"
XX
SQ Sequence 756 BP; 247 A; 136 C; 151 G; 222 T; 0 other;
cgttatttaa ggtgttacat agttctatgg aaatagggtc tatacctttc
gccttacaat 60
gtaatttctt ttcacataaa taataaacaa tccgaggagg aatttttaat
gacttacgaa 120
ttaccaaaat taccttatac ttatgatgct ttggagccga attttgataa
agaaacaatg 180
gaaattcact atacaaagca ccacaatatt tatgtaacaa aactaaatga
agcagtctca 240
ggacacgcag aacttgcaag taaacctggg gaagaattag ttgctaatct
agatagcgtt 300
cctgaagaaa ttcgtggcgc agtacgtaac cacggtggtg gacatgctaa
ccatacttta 360
ttctggtcta gtcttagccc aaatggtggt ggtgctccaa ctggtaactt
aaaagcagca 420
atcgaaagcg aattcggcac atttgatgaa ttcaaagaaa aattcaatgc
ggcagctgcg 480
gctcgttttg gttcaggatg ggcatggcta gtagtgaaca atggtaaact
agaaattgtt 540
ID - Identification.
AC - Accession number(s).
DT - Date.
DE - Description.
GN - Gene name(s).
OS - Organism species.
OG - Organelle.
OC - Organism classification.
RN - Reference number.
RP - Reference position.
RC - Reference comments.
RX - Reference cross-references.
RA - Reference authors.
RL - Reference location.
CC - Comments or notes.
DR - Database cross-references.
KW - Keywords.
FT - Feature table data.
SQ - Sequence header.
- (blanks) sequence data.
// - Termination line.
Some entries do not contain all of the line types, and some line types occur many times in a single
entry. Each entry must begin with an identification line (ID) and end with a terminator line (//).
PubMed
• PubMed is a free search engine accessing primarily
the MEDLINE database of references and abstracts on
sciences and biomedical topics.
• The PubMed system was offered free to the public in
1997.
• The United States National Library of Medicine (NLM)
the National Institutes of Health maintains the
part of the Entrez system of information retrieval.
• PMID is the unique identifier number used in
• They are assigned to each article record when it enters the
PubMed system.
• The PMID# is always found at the end of a PubMed
citation.
• PubMed Central (PMC) is a free digital system that
archives publicly accessible full-text scholarly articles that
have been published within the biomedical and life
sciences journal literature.
• A "PubMed Mobile" option, providing access to a mobile
Entrez
• WWW-based data retrieval system.
• Developed by NCBI (National Centre for Biotechnology
Information).
• - Integrates information held in different DBs.
Data bases covered by Entrez are
• Nucleic acid - GenBank,
RefSeq, PDB.
• Protein seqs - SWISS-
PROT, PIR.
• 3D structures – MMDB
• Genomes – Many
sources
• PopSet – From GenBank
• OMIM – OMIM
• Taxonomy – NCBI taxonomy
database
• Books- Bookshelf
• ProbeSet – GEO (Gene
Expression Omnibus)
• Literature - PubMed
SRS
• SRS is a Sequence Retrieval System
• - Data retrieval tool developed by EBI
• - Integrates 80 molecular biology DBs
• - An Open source software (Can be installed locally)
• SRS has an associated scripting language called Icarus
• Central resource for molecular biology data
• - more than 250 databanks have been indexed. More than 35 SRS
servers over theWWW(world wide)
• Information retrieval
• Easy way to retrieve information from sequence and sequence-related
databases
• Possibility to search for multiple words/other criteria
• Linkage between different databases
• E.g. Find all primary structures with known three-dimensional
• Different types of database in SRS
• Sequence & structure
• DNA, protein, three-dimensional structures
• Sequence-related
• Gene-related
• Genome, mapping, mutations, transcription factors
• SNP
• Bibliographic
• SRS main toolbar tabs:
• Top Page: displays databases in different database groups
• Query: displays either the standard or extended query form
• Results or “the query manager”: maintains a history of all the
results obtained during a session
• Projects or “the project manager”: maintains a history of all
queries and views used during a session
• Views: allows a user to define a user specific view for one or
more databases
• Databanks: contains a list and some facts about the databases
available in the system
• Search terms in SRS
• SRS indexed fields can be searched using any of the
• Single word search
• Multiple word phrases
• Numbers and dates
• Regular expressions
• Wildcards
•
LocusLink
• LocusLink (http://www.ncbi.nlm.nih.gov/LocusLink) is a National
Center for Biotechnology Information (NCBI) online resource.
• It is principally intended for use by graduate students and
professional researchers in the biomedical sciences.
• It is designed to bring together related information on genetic loci
and gene products from several sources.
• LocusLink provides a central point of access for basic biomedical
information and molecular data for genes, transcripts, and proteins
from model organisms, currently including human, rat, mouse,
fruit fly, and zebrafish.
• Now it is not available in NCBI.
The National Center for Biotechnology Information
The National Center for Biotechnology Information

More Related Content

What's hot (20)

NCBI
NCBINCBI
NCBI
 
Swiss prot database
Swiss prot databaseSwiss prot database
Swiss prot database
 
Data Retrieval Systems
Data Retrieval SystemsData Retrieval Systems
Data Retrieval Systems
 
Protein data bank
Protein data bankProtein data bank
Protein data bank
 
Primary and secondary databases ppt by puneet kulyana
Primary and secondary databases ppt by puneet kulyanaPrimary and secondary databases ppt by puneet kulyana
Primary and secondary databases ppt by puneet kulyana
 
History and scope in bioinformatics
History and scope in bioinformaticsHistory and scope in bioinformatics
History and scope in bioinformatics
 
Proteins databases
Proteins databasesProteins databases
Proteins databases
 
BLAST (Basic local alignment search Tool)
BLAST (Basic local alignment search Tool)BLAST (Basic local alignment search Tool)
BLAST (Basic local alignment search Tool)
 
Ddbj
DdbjDdbj
Ddbj
 
Introduction OF BIOLOGICAL DATABASE
Introduction OF BIOLOGICAL DATABASEIntroduction OF BIOLOGICAL DATABASE
Introduction OF BIOLOGICAL DATABASE
 
blast bioinformatics
blast bioinformaticsblast bioinformatics
blast bioinformatics
 
Prosite
PrositeProsite
Prosite
 
Biological database
Biological databaseBiological database
Biological database
 
BLAST
BLASTBLAST
BLAST
 
Nucleic Acid Sequence databases
Nucleic Acid Sequence databasesNucleic Acid Sequence databases
Nucleic Acid Sequence databases
 
Introduction to ncbi, embl, ddbj
Introduction to ncbi, embl, ddbjIntroduction to ncbi, embl, ddbj
Introduction to ncbi, embl, ddbj
 
Biological databases
Biological databasesBiological databases
Biological databases
 
Protein data bank
Protein data bankProtein data bank
Protein data bank
 
Fasta
FastaFasta
Fasta
 
Gene bank by kk sahu
Gene bank by kk sahuGene bank by kk sahu
Gene bank by kk sahu
 

Viewers also liked (20)

Biological databases
Biological databasesBiological databases
Biological databases
 
Data retrieval
Data retrievalData retrieval
Data retrieval
 
BIOLOGICAL SEQUENCE DATABASES
BIOLOGICAL SEQUENCE DATABASES BIOLOGICAL SEQUENCE DATABASES
BIOLOGICAL SEQUENCE DATABASES
 
Biological Databases
Biological DatabasesBiological Databases
Biological Databases
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
Bioinformatics
BioinformaticsBioinformatics
Bioinformatics
 
100505 koenig biological_databases
100505 koenig biological_databases100505 koenig biological_databases
100505 koenig biological_databases
 
Introduction to Bioinformatics
Introduction to BioinformaticsIntroduction to Bioinformatics
Introduction to Bioinformatics
 
Introduction to Data Mining / Bioinformatics
Introduction to Data Mining / BioinformaticsIntroduction to Data Mining / Bioinformatics
Introduction to Data Mining / Bioinformatics
 
Introduction to Bioinformatics
Introduction to BioinformaticsIntroduction to Bioinformatics
Introduction to Bioinformatics
 
EMBL
EMBLEMBL
EMBL
 
Protein sequence databases
Protein sequence databasesProtein sequence databases
Protein sequence databases
 
Table manners
Table mannersTable manners
Table manners
 
Negotiation skill
Negotiation skillNegotiation skill
Negotiation skill
 
Community ecology
Community ecologyCommunity ecology
Community ecology
 
Food chain
Food chainFood chain
Food chain
 
Locus link
Locus linkLocus link
Locus link
 
Bioinformatics - Discovering the Bio Logic Of Nature
Bioinformatics - Discovering the Bio Logic Of NatureBioinformatics - Discovering the Bio Logic Of Nature
Bioinformatics - Discovering the Bio Logic Of Nature
 
Group discussion
Group discussionGroup discussion
Group discussion
 
Bioinformatics assignment
Bioinformatics assignmentBioinformatics assignment
Bioinformatics assignment
 

Similar to The National Center for Biotechnology Information

Biological Database (1)pptxpdfpdfpdf.pdf
Biological Database (1)pptxpdfpdfpdf.pdfBiological Database (1)pptxpdfpdfpdf.pdf
Biological Database (1)pptxpdfpdfpdf.pdfBioinformaticsCentre
 
Primary Bioinformatics Database.pptx
Primary Bioinformatics Database.pptxPrimary Bioinformatics Database.pptx
Primary Bioinformatics Database.pptxVandana Yadav03
 
Databases_CSS2.pptx
Databases_CSS2.pptxDatabases_CSS2.pptx
Databases_CSS2.pptxSilpa87
 
Nucleic acid database
Nucleic acid databaseNucleic acid database
Nucleic acid databaseEsakkiammal S
 
Data retreival system
Data retreival systemData retreival system
Data retreival systemShikha Thakur
 
System biology and its tools
System biology and its toolsSystem biology and its tools
System biology and its toolsGaurav Diwakar
 
Introduction to Biological database ppt(1).pptx
Introduction to Biological database ppt(1).pptxIntroduction to Biological database ppt(1).pptx
Introduction to Biological database ppt(1).pptxRAJESHKUMAR428748
 
Primary, secondary, tertiary biological database
Primary, secondary, tertiary biological databasePrimary, secondary, tertiary biological database
Primary, secondary, tertiary biological databaseKAUSHAL SAHU
 
Bioinformatic databases 2
Bioinformatic databases 2Bioinformatic databases 2
Bioinformatic databases 2Razzaqe
 
Bioinformatic_Databases_2.ppt
Bioinformatic_Databases_2.pptBioinformatic_Databases_2.ppt
Bioinformatic_Databases_2.pptNaglaaFathy42
 
Bioinformatic_Databases_2xcxzczxcxzxcxzc
Bioinformatic_Databases_2xcxzczxcxzxcxzcBioinformatic_Databases_2xcxzczxcxzxcxzc
Bioinformatic_Databases_2xcxzczxcxzxcxzcAdiM27
 
Bioinformatic databases 2
Bioinformatic databases 2Bioinformatic databases 2
Bioinformatic databases 2Razzaqe
 
Bioinformatics مي.pdf
Bioinformatics  مي.pdfBioinformatics  مي.pdf
Bioinformatics مي.pdfnedalalazzwy
 
Proteomics resources at the EBI & ExPASy
Proteomics resources at the EBI & ExPASyProteomics resources at the EBI & ExPASy
Proteomics resources at the EBI & ExPASyChrist College, Rajkot
 
Role of bioinformatics in life sciences research
Role of bioinformatics in life sciences researchRole of bioinformatics in life sciences research
Role of bioinformatics in life sciences researchAnshika Bansal
 
Genomic Big Data Management, Integration and Mining - Emanuel Weitschek
Genomic Big Data Management, Integration and Mining - Emanuel WeitschekGenomic Big Data Management, Integration and Mining - Emanuel Weitschek
Genomic Big Data Management, Integration and Mining - Emanuel WeitschekData Driven Innovation
 
Hands on training_biological_databases.ppt
Hands on training_biological_databases.pptHands on training_biological_databases.ppt
Hands on training_biological_databases.pptSoumen Barman
 

Similar to The National Center for Biotechnology Information (20)

Data base in detail
Data base in detailData base in detail
Data base in detail
 
Biological Database (1)pptxpdfpdfpdf.pdf
Biological Database (1)pptxpdfpdfpdf.pdfBiological Database (1)pptxpdfpdfpdf.pdf
Biological Database (1)pptxpdfpdfpdf.pdf
 
Primary Bioinformatics Database.pptx
Primary Bioinformatics Database.pptxPrimary Bioinformatics Database.pptx
Primary Bioinformatics Database.pptx
 
Databases_CSS2.pptx
Databases_CSS2.pptxDatabases_CSS2.pptx
Databases_CSS2.pptx
 
Nucleic acid database
Nucleic acid databaseNucleic acid database
Nucleic acid database
 
Data retreival system
Data retreival systemData retreival system
Data retreival system
 
System biology and its tools
System biology and its toolsSystem biology and its tools
System biology and its tools
 
Introduction to Biological database ppt(1).pptx
Introduction to Biological database ppt(1).pptxIntroduction to Biological database ppt(1).pptx
Introduction to Biological database ppt(1).pptx
 
Intro to databases
Intro to databasesIntro to databases
Intro to databases
 
Primary, secondary, tertiary biological database
Primary, secondary, tertiary biological databasePrimary, secondary, tertiary biological database
Primary, secondary, tertiary biological database
 
Bioinformatic databases 2
Bioinformatic databases 2Bioinformatic databases 2
Bioinformatic databases 2
 
Bioinformatic_Databases_2.ppt
Bioinformatic_Databases_2.pptBioinformatic_Databases_2.ppt
Bioinformatic_Databases_2.ppt
 
Bioinformatic_Databases_2xcxzczxcxzxcxzc
Bioinformatic_Databases_2xcxzczxcxzxcxzcBioinformatic_Databases_2xcxzczxcxzxcxzc
Bioinformatic_Databases_2xcxzczxcxzxcxzc
 
Bioinformatic databases 2
Bioinformatic databases 2Bioinformatic databases 2
Bioinformatic databases 2
 
Bioinformatics مي.pdf
Bioinformatics  مي.pdfBioinformatics  مي.pdf
Bioinformatics مي.pdf
 
Proteomics resources at the EBI & ExPASy
Proteomics resources at the EBI & ExPASyProteomics resources at the EBI & ExPASy
Proteomics resources at the EBI & ExPASy
 
Role of bioinformatics in life sciences research
Role of bioinformatics in life sciences researchRole of bioinformatics in life sciences research
Role of bioinformatics in life sciences research
 
Genomic Big Data Management, Integration and Mining - Emanuel Weitschek
Genomic Big Data Management, Integration and Mining - Emanuel WeitschekGenomic Big Data Management, Integration and Mining - Emanuel Weitschek
Genomic Big Data Management, Integration and Mining - Emanuel Weitschek
 
PDF文档.pdf
PDF文档.pdfPDF文档.pdf
PDF文档.pdf
 
Hands on training_biological_databases.ppt
Hands on training_biological_databases.pptHands on training_biological_databases.ppt
Hands on training_biological_databases.ppt
 

More from Vidya Kalaivani Rajkumar

Transgenic plants- Abiotic stress tolerance
Transgenic plants- Abiotic stress toleranceTransgenic plants- Abiotic stress tolerance
Transgenic plants- Abiotic stress toleranceVidya Kalaivani Rajkumar
 
Protein structure visualization tools-RASMOL
Protein structure visualization tools-RASMOLProtein structure visualization tools-RASMOL
Protein structure visualization tools-RASMOLVidya Kalaivani Rajkumar
 

More from Vidya Kalaivani Rajkumar (20)

Recombinant vaccines-Peptide Vaccines
Recombinant vaccines-Peptide Vaccines Recombinant vaccines-Peptide Vaccines
Recombinant vaccines-Peptide Vaccines
 
Transgenic plants- Abiotic stress tolerance
Transgenic plants- Abiotic stress toleranceTransgenic plants- Abiotic stress tolerance
Transgenic plants- Abiotic stress tolerance
 
Bioreactors in tissue engineering
Bioreactors in tissue engineeringBioreactors in tissue engineering
Bioreactors in tissue engineering
 
Tissue assembly in microgravity
Tissue assembly in microgravityTissue assembly in microgravity
Tissue assembly in microgravity
 
In vivo synthesis of tissues and organs
In vivo synthesis of tissues and organsIn vivo synthesis of tissues and organs
In vivo synthesis of tissues and organs
 
Bioartificial pancreas
Bioartificial pancreasBioartificial pancreas
Bioartificial pancreas
 
Biomaterials for tissue engineering
Biomaterials for tissue engineeringBiomaterials for tissue engineering
Biomaterials for tissue engineering
 
Haematopoietic system
Haematopoietic systemHaematopoietic system
Haematopoietic system
 
Fasta
FastaFasta
Fasta
 
Water vascular system of star fish
Water vascular system of star fishWater vascular system of star fish
Water vascular system of star fish
 
Cephalopodes are advance molluscs
Cephalopodes are advance molluscsCephalopodes are advance molluscs
Cephalopodes are advance molluscs
 
Beat air pollution
Beat air pollution Beat air pollution
Beat air pollution
 
Birth control methods
Birth control methodsBirth control methods
Birth control methods
 
Future of human evolution
Future of human evolutionFuture of human evolution
Future of human evolution
 
Sequence alignment
Sequence alignmentSequence alignment
Sequence alignment
 
Assignment on developmental zoology
Assignment on developmental zoologyAssignment on developmental zoology
Assignment on developmental zoology
 
Development of chick
Development of chickDevelopment of chick
Development of chick
 
Major biological nucleotide databases
Major biological nucleotide databasesMajor biological nucleotide databases
Major biological nucleotide databases
 
Protein structure visualization tools-RASMOL
Protein structure visualization tools-RASMOLProtein structure visualization tools-RASMOL
Protein structure visualization tools-RASMOL
 
Swiss pdb viewer
Swiss pdb viewerSwiss pdb viewer
Swiss pdb viewer
 

Recently uploaded

Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsSumit Kumar yadav
 
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...anilsa9823
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTSérgio Sacani
 
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCESTERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCEPRINCE C P
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRDelhi Call girls
 
Broad bean, Lima Bean, Jack bean, Ullucus.pptx
Broad bean, Lima Bean, Jack bean, Ullucus.pptxBroad bean, Lima Bean, Jack bean, Ullucus.pptx
Broad bean, Lima Bean, Jack bean, Ullucus.pptxjana861314
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksSérgio Sacani
 
Chemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfChemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfSumit Kumar yadav
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...jana861314
 
A relative description on Sonoporation.pdf
A relative description on Sonoporation.pdfA relative description on Sonoporation.pdf
A relative description on Sonoporation.pdfnehabiju2046
 
Biological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfBiological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfmuntazimhurra
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...RohitNehra6
 
Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )aarthirajkumar25
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptxRajatChauhan518211
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsSérgio Sacani
 
Nanoparticles synthesis and characterization​ ​
Nanoparticles synthesis and characterization​  ​Nanoparticles synthesis and characterization​  ​
Nanoparticles synthesis and characterization​ ​kaibalyasahoo82800
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxgindu3009
 
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |aasikanpl
 
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Sérgio Sacani
 

Recently uploaded (20)

Botany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questionsBotany krishna series 2nd semester Only Mcq type questions
Botany krishna series 2nd semester Only Mcq type questions
 
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
 
Disentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOSTDisentangling the origin of chemical differences using GHOST
Disentangling the origin of chemical differences using GHOST
 
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCESTERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
STERILITY TESTING OF PHARMACEUTICALS ppt by DR.C.P.PRINCE
 
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCRStunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
Stunning ➥8448380779▻ Call Girls In Panchshil Enclave Delhi NCR
 
Broad bean, Lima Bean, Jack bean, Ullucus.pptx
Broad bean, Lima Bean, Jack bean, Ullucus.pptxBroad bean, Lima Bean, Jack bean, Ullucus.pptx
Broad bean, Lima Bean, Jack bean, Ullucus.pptx
 
Formation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disksFormation of low mass protostars and their circumstellar disks
Formation of low mass protostars and their circumstellar disks
 
Chemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdfChemistry 4th semester series (krishna).pdf
Chemistry 4th semester series (krishna).pdf
 
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
Traditional Agroforestry System in India- Shifting Cultivation, Taungya, Home...
 
A relative description on Sonoporation.pdf
A relative description on Sonoporation.pdfA relative description on Sonoporation.pdf
A relative description on Sonoporation.pdf
 
Biological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdfBiological Classification BioHack (3).pdf
Biological Classification BioHack (3).pdf
 
The Philosophy of Science
The Philosophy of ScienceThe Philosophy of Science
The Philosophy of Science
 
Biopesticide (2).pptx .This slides helps to know the different types of biop...
Biopesticide (2).pptx  .This slides helps to know the different types of biop...Biopesticide (2).pptx  .This slides helps to know the different types of biop...
Biopesticide (2).pptx .This slides helps to know the different types of biop...
 
Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )Recombination DNA Technology (Nucleic Acid Hybridization )
Recombination DNA Technology (Nucleic Acid Hybridization )
 
Green chemistry and Sustainable development.pptx
Green chemistry  and Sustainable development.pptxGreen chemistry  and Sustainable development.pptx
Green chemistry and Sustainable development.pptx
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
 
Nanoparticles synthesis and characterization​ ​
Nanoparticles synthesis and characterization​  ​Nanoparticles synthesis and characterization​  ​
Nanoparticles synthesis and characterization​ ​
 
Presentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptxPresentation Vikram Lander by Vedansh Gupta.pptx
Presentation Vikram Lander by Vedansh Gupta.pptx
 
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |
Call Us ≽ 9953322196 ≼ Call Girls In Mukherjee Nagar(Delhi) |
 
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
Discovery of an Accretion Streamer and a Slow Wide-angle Outflow around FUOri...
 

The National Center for Biotechnology Information

  • 1.
  • 2. What is database???? • Database are convenient system to properly store, search and retrieve any type of data. • A database helps to easily handle and share large amount of data and supports large scale analysis by easy access and data updating.
  • 3. What is Biological Database • Biological databases are libraries of life sciences information ,collected from scientific experiments, published literature, high- throughput experiment technology and computational analysis. • They contain information from genomics, proteomics, microarray gene expression. • Information contained in biological databases includes gene function, structure, localization(both cellular and chromosomal),biological sequences and structures.
  • 4. Databases Architecture Information system )Query system Storage System Data (The Google, Entrez SRS) Your search key words Oracle,MySQL,PC binary files,Unix text files,Bookshelves GenBank flat file PDB file Interaction Record Title of a book Book
  • 5. A Sequence Retrieving and Manipulation Network DNA Protein NCBI-GenBANK PIR DDBJ SWISSPROT EBI-EMBL EXPASY, PDB GCG SeqWEB Vector NTI GenoMAX Entrez SRS Sequnece, Pdb, Image GenBANK GCG FASTA Staden Image Sequence Converter Databases Softwares Formats Retrival System Information
  • 6. Types of biological databases  Primary Database. Secondary database.
  • 7. Primary databases Theses are the primary sources of data used to store nucleic acid, protein sequences and structural information of biological macromolecules. Some primary databases- • NCBI(The National Centre for Biotechnology Information) • GenBank • DDBJ (DNA data bank of Japan) • SWISS-PROT(Swiss-Prot ) • PIR (Protein Information Resource) • PDB(Protein Data Bank) This sequence collection of this database is due to the efforts of basic research from academic industrial and sequencing lab)
  • 8. IAM: International Advisory Meeting ICM: International Collaborative Meeting GenBank/EMBL/DDBJ International Nucleotide Sequence Database EMBL: European Molecular Biology Laboratory EBI: European Bioinformatics Institute DDBJ: DNA Data Bank of Japan CIB: Center for Information Biology and DNA Data Bank of Japan NIG: National Institute of Genetics NCBI: National Center for Biotechnology Information NLM: National Library of Medicine
  • 9. Secondary Database • A Secondary database contain additional information derived from the analysis of data available in primary sources. • Secondary databases are analysed in a variety of ways and contain different information in different formats. • Some secondary databases • TrEMBL • Pfam • PROSITE • Profiles • SCOP • CATH
  • 10. PRIMARY VS. Secondary SEQUENCE DATABASES Sequencing Centers TATAGCCG TATAGCCGTATAGCCG TATAGCCG Labs Algorithms UniGene Curators RefSeq Genome Assembly TATAGCCG AGCTCCGATA CCGATGACAA Updated continually by NCBI Updated ONLY by submitters
  • 11. Flat File Storage Data Formats • When GenBank, EMBL and DDBJ formed a collaboration (1986), sequence databases had moved to a defined flat file format with a shared feature table format and annotation standards. • The flat file formats from the sequence databases are still used to access and display sequence and annotation. They are also convenient for storage of local copies.
  • 12.
  • 13.
  • 14.
  • 15.
  • 16. The National Center for Biotechnology Information Created in 1988 as a part of the National Library of Medicine at NIH – Establish public databases – Research in computational biology – Develop software tools for sequence analysis – Disseminate biomedical information Bethesda, MD
  • 17. NCBI Databases and Services • GenBank primary sequence database • Free public access to biomedical literature • PubMed free Medline (3 million searches per day) • PubMed Central full text online access • Entrez integrated molecular and literature databases • BLAST highest volume sequence search service (100 – 200 K searches per day) • VAST structure similarity searches • Software and Databases
  • 18. GenBank (Genetic Sequence Databank) • GenBank® is the genetic sequence database at the National Center for Biotechnology Information (NCBI). • It was established in the year 1982 and now maintained by the NationalCenter for Biotechnology (NCBI). • DNA sequences can be submitted to GenBank using several different methods. • It contains publicly available nucleotide sequences for more than 240 000 named organisms, obtained primarily through submissions from individual laboratories and batch submissions from large-scale sequencing projects.
  • 19. • It has a flat file structure that is an ASCII text file, readable & downloadable by both humans and computers. • There are two main ways of making batch sequence submissions to GenBank: NCBI’s Barcode SubmissionTool (BarSTool) and Sequin.
  • 20.
  • 21.
  • 22. EMBL • The European Molecular Biology Laboratory (EMBL) is a molecular biology research institution supported by 22 member states, four prospect and two associate member states. • EMBL was created in 1974 and is an intergovernmental organisation funded by public research money from its member states. • The Laboratory operates from five sites: the main laboratory in Heidelberg, and outstations in Hinxton (the European Bioinformatics Institute (EBI), in England), Grenoble (France), Hamburg (Germany), and Monterotondo (near Rome). • EMBL groups and laboratories perform basic research in molecular biology and molecular medicine as well as training for scientists, students and visitors. • Israel is the only Asian state that has full membership. • The EMBL Nucleotide Sequence Database (http:// www.ebi.ac.uk/embl/), maintained at the European Bioinformatics Institute (EBI),
  • 23. • It is used to incorporate and distributes nucleotide sequences from public sources. • The database is a part of an international collaboration with DDBJ (Japan) and GenBank (USA). • Data are exchanged between the collaborating databases on a daily basis. • The web-based tool, Webin, is the preferred system for individual submission of nucleotide sequences, including Third Party Annotation (TPA) and alignment data.
  • 24. • Automatic submission procedures are used for submission of data from large-scale genome sequencing • The latest data collection can be accessed via FTP, email and WWW interfaces. • The EBI's Sequence Retrieval System (SRS) integrates and links the main nucleotide and protein databases as well as many other specialist molecular biology databases. • For sequence similarity searching, a variety of tools (e.g. FASTA and BLAST) are available that allow external users to compare their own sequences against the data in the EMBL Nucleotide Sequence Database and other databases. • All available resources can be accessed via the EBI home page at
  • 25.
  • 26.
  • 27.
  • 28.
  • 29.
  • 30.
  • 31.
  • 32. EMBL format ID LISOD standard; DNA; PRO; 756 BP. XX AC X64011; S78972; XX SV X64011.1 XX DT 28-APR-1992 (Rel. 31, Created) DT 30-JUN-1993 (Rel. 36, Last updated, Version 6) XX DE L.ivanovii sod gene for superoxide dismutase XX KW sod gene; superoxide dismutase. XX OS Listeria ivanovii OC Bacteria; Firmicutes; Bacillus/Clostridium group; OC Bacillus/Staphylococcus group; Listeria. XX RN [1] RX MEDLINE; 92140371. RA Haas A., Goebel W.; RT "Cloning of a superoxide dismutase gene from Listeria ivanovii by RT functional complementation in Escherichia coli and characterization of the RT gene product.";
  • 33. RL Mol. Gen. Genet. 231:313-322(1992). XX RN [2] RP 1-756 RA Kreft J.; RT ; RL Submitted (21-APR-1992) to the EMBL/GenBank/DDBJ databases. RL J. Kreft, Institut f. Mikrobiologie, Universitaet Wuerzburg, Biozentrum Am RL Hubland, 8700 Wuerzburg, FRG XX DR SWISS-PROT; P28763; SODM_LISIV. XX FH Key Location/Qualifiers FH FT source 1..756 FT /db_xref="taxon:1638" FT /organism="Listeria ivanovii" FT /strain="ATCC 19119" FT RBS 95..100 FT /gene="sod" FT terminator 723..746 FT /gene="sod" FT CDS 109..717 FT /db_xref="SWISS-PROT:P28763" FT /transl_table=11 FT /gene="sod" FT /EC_number="1.15.1.1" FT /product="superoxide dismutase" FT /protein_id="CAA45406.1" FT /translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEA VSG FT HAELASKPGEELVANLDSVPEEIRGAVRNHGGGHANHTLFWSSLSPNGGGAPTGNL KAA FT IESEFGTFDEFKEKFNAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGKTPV LGL FT DVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK" XX SQ Sequence 756 BP; 247 A; 136 C; 151 G; 222 T; 0 other; cgttatttaa ggtgttacat agttctatgg aaatagggtc tatacctttc gccttacaat 60 gtaatttctt ttcacataaa taataaacaa tccgaggagg aatttttaat gacttacgaa 120 ttaccaaaat taccttatac ttatgatgct ttggagccga attttgataa agaaacaatg 180 gaaattcact atacaaagca ccacaatatt tatgtaacaa aactaaatga agcagtctca 240 ggacacgcag aacttgcaag taaacctggg gaagaattag ttgctaatct agatagcgtt 300 cctgaagaaa ttcgtggcgc agtacgtaac cacggtggtg gacatgctaa ccatacttta 360 ttctggtcta gtcttagccc aaatggtggt ggtgctccaa ctggtaactt aaaagcagca 420 atcgaaagcg aattcggcac atttgatgaa ttcaaagaaa aattcaatgc ggcagctgcg 480 gctcgttttg gttcaggatg ggcatggcta gtagtgaaca atggtaaact agaaattgtt 540
  • 34. ID - Identification. AC - Accession number(s). DT - Date. DE - Description. GN - Gene name(s). OS - Organism species. OG - Organelle. OC - Organism classification. RN - Reference number. RP - Reference position. RC - Reference comments. RX - Reference cross-references. RA - Reference authors. RL - Reference location. CC - Comments or notes. DR - Database cross-references. KW - Keywords. FT - Feature table data. SQ - Sequence header. - (blanks) sequence data. // - Termination line. Some entries do not contain all of the line types, and some line types occur many times in a single entry. Each entry must begin with an identification line (ID) and end with a terminator line (//).
  • 35. PubMed • PubMed is a free search engine accessing primarily the MEDLINE database of references and abstracts on sciences and biomedical topics. • The PubMed system was offered free to the public in 1997. • The United States National Library of Medicine (NLM) the National Institutes of Health maintains the part of the Entrez system of information retrieval. • PMID is the unique identifier number used in
  • 36. • They are assigned to each article record when it enters the PubMed system. • The PMID# is always found at the end of a PubMed citation. • PubMed Central (PMC) is a free digital system that archives publicly accessible full-text scholarly articles that have been published within the biomedical and life sciences journal literature. • A "PubMed Mobile" option, providing access to a mobile
  • 37.
  • 38.
  • 39.
  • 40.
  • 41.
  • 42.
  • 43.
  • 44. Entrez • WWW-based data retrieval system. • Developed by NCBI (National Centre for Biotechnology Information). • - Integrates information held in different DBs.
  • 45. Data bases covered by Entrez are • Nucleic acid - GenBank, RefSeq, PDB. • Protein seqs - SWISS- PROT, PIR. • 3D structures – MMDB • Genomes – Many sources • PopSet – From GenBank • OMIM – OMIM • Taxonomy – NCBI taxonomy database • Books- Bookshelf • ProbeSet – GEO (Gene Expression Omnibus) • Literature - PubMed
  • 46.
  • 47.
  • 48.
  • 49.
  • 50.
  • 51.
  • 52.
  • 53.
  • 54. SRS • SRS is a Sequence Retrieval System • - Data retrieval tool developed by EBI • - Integrates 80 molecular biology DBs • - An Open source software (Can be installed locally) • SRS has an associated scripting language called Icarus • Central resource for molecular biology data • - more than 250 databanks have been indexed. More than 35 SRS servers over theWWW(world wide)
  • 55. • Information retrieval • Easy way to retrieve information from sequence and sequence-related databases • Possibility to search for multiple words/other criteria • Linkage between different databases • E.g. Find all primary structures with known three-dimensional • Different types of database in SRS • Sequence & structure • DNA, protein, three-dimensional structures • Sequence-related • Gene-related • Genome, mapping, mutations, transcription factors • SNP • Bibliographic
  • 56. • SRS main toolbar tabs: • Top Page: displays databases in different database groups • Query: displays either the standard or extended query form • Results or “the query manager”: maintains a history of all the results obtained during a session • Projects or “the project manager”: maintains a history of all queries and views used during a session • Views: allows a user to define a user specific view for one or more databases • Databanks: contains a list and some facts about the databases available in the system
  • 57. • Search terms in SRS • SRS indexed fields can be searched using any of the • Single word search • Multiple word phrases • Numbers and dates • Regular expressions • Wildcards •
  • 58.
  • 59.
  • 60.
  • 61. LocusLink • LocusLink (http://www.ncbi.nlm.nih.gov/LocusLink) is a National Center for Biotechnology Information (NCBI) online resource. • It is principally intended for use by graduate students and professional researchers in the biomedical sciences. • It is designed to bring together related information on genetic loci and gene products from several sources. • LocusLink provides a central point of access for basic biomedical information and molecular data for genes, transcripts, and proteins from model organisms, currently including human, rat, mouse, fruit fly, and zebrafish. • Now it is not available in NCBI.