SlideShare a Scribd company logo
1 of 16
A quantum (plural: quanta)
is the smallest discrete unit
of a phenomenon. For
example, a quantum of light
is a photon, and a quantum
of electricity is an electron.
Quantum comes from Latin,
meaning "an amount" or
"how much?" If something
is quantifiable, then it can
be measured.
Electromagnetic
(EM) waves
Hertz (Hz)
Speed
Wave equation
Max Planck
Planck’s constant
(6.626x10−34
J•s
E=hf=
ℎ𝑐
λ
Photons
Visible light
Amplitude
Wavelength
Frequency
Light propagates through space in the form of electromagnetic
(EM) waves, which have both electric and magnetic properties.
Visible light –is the portion of the eye which we can see using
our naked eye.
This visible light consists of 7 different colors (ROYGBIV); each
color with distinct characteristics.
Can be described in terms of:
Amplitude
Wavelength
frequency
The distance
from the equilibrium point(x-axis) of a
propagating wave to the highest (or
lowest) point of the waveform.
(λ) is the distance between identical
points in successive cycles in a
propagating wave and is usually
measured in nanometers (nm) for the
visible light regions.
(f) Is the number of cycles that a wave
makes per unit of time and is usually
expressed in units of Hertz (Hz) of 1/s
(read as “per second”)
The frequency and wavelength of a wave
is related to its speed (v)in the basic wave
equation:
This equation is used in describing
the energy associated with light.
When travelling in a vacuum, the
speed of light is 3.0x108m/s and
represented with the symbol c.
He is a German
theoretical
physicist who in
1900, proposed the
Quantum Theory,
which won him the
Nobel prize in
Physics in 1918.
According to this theory, light energy is
“quantized” in multiples of hf. Each
quantized energy, called a ‘quantum’, can
be calculated using the equation;
E=hf
Where h is the Planck’s constant with a
value of 6.626x𝟏𝟎−𝟑𝟒
J•s
f is the frequency in Hertz (Hz)
The energy of light of a certain
wavelength can be calculated using
the equation;
Where λ is expressed in meters.
Proposed that light, aside
from being an
electromagnetic wave, also
exists as a tiny particles,
which were later called
photons. These two
characteristics of light came
to be known as the dual
nature of light, which is
consistent with the quantum
theory known today.
The photons can be
considered as the
quantized form of
light. The energy of a
photon can be
measured in
quantities of hf.
Quantum theory orbitals, quantum number.pptx

More Related Content

Similar to Quantum theory orbitals, quantum number.pptx

Ch06 outline
Ch06 outlineCh06 outline
Ch06 outlineAP_Chem
 
chapter 1 cotli(1).pdf properties of X ray
chapter 1 cotli(1).pdf properties of X raychapter 1 cotli(1).pdf properties of X ray
chapter 1 cotli(1).pdf properties of X rayZabeehUllah18
 
Ch7 z5e at structure
Ch7 z5e at structureCh7 z5e at structure
Ch7 z5e at structureblachman
 
Unit 6 Presentation.ppt
Unit 6 Presentation.pptUnit 6 Presentation.ppt
Unit 6 Presentation.pptssuser2ac9e9
 
Chapter4electronsinatoms 111110092817-phpapp02
Chapter4electronsinatoms 111110092817-phpapp02Chapter4electronsinatoms 111110092817-phpapp02
Chapter4electronsinatoms 111110092817-phpapp02Cleophas Rwemera
 
Black body radiation.
Black body radiation.Black body radiation.
Black body radiation.Suni Pm
 
Thesis on the masses of photons with different wavelengths.pdf
Thesis on the masses of photons with different wavelengths.pdf Thesis on the masses of photons with different wavelengths.pdf
Thesis on the masses of photons with different wavelengths.pdf WilsonHidalgo8
 
Wave particle duality of light- A changing Notion in Science
Wave particle duality of light- A changing Notion in ScienceWave particle duality of light- A changing Notion in Science
Wave particle duality of light- A changing Notion in ScienceSubhankar Roy
 
Max Planck (student preso)
Max Planck (student preso)Max Planck (student preso)
Max Planck (student preso)Roppon Picha
 
2. Introduction to Spectroscopy 2022.pptx
2. Introduction to Spectroscopy 2022.pptx2. Introduction to Spectroscopy 2022.pptx
2. Introduction to Spectroscopy 2022.pptxWilliamkambi
 
light lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrelight lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrecarlmanaay
 
Unit-IV_22UCH101_Theory-1.pptx
Unit-IV_22UCH101_Theory-1.pptxUnit-IV_22UCH101_Theory-1.pptx
Unit-IV_22UCH101_Theory-1.pptxgokul736292
 
Optical Instrumentation - 2. Basics of Optics
Optical Instrumentation - 2.   Basics of OpticsOptical Instrumentation - 2.   Basics of Optics
Optical Instrumentation - 2. Basics of OpticsBurdwan University
 
5_2020_03_25!07_16_23_PM (1).ppt
5_2020_03_25!07_16_23_PM (1).ppt5_2020_03_25!07_16_23_PM (1).ppt
5_2020_03_25!07_16_23_PM (1).pptMihirDatir1
 
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.pptSaiyma Fatima Raza
 
5_2020_03_25!07_16_23_PM.ppt
5_2020_03_25!07_16_23_PM.ppt5_2020_03_25!07_16_23_PM.ppt
5_2020_03_25!07_16_23_PM.pptssuser8298f2
 

Similar to Quantum theory orbitals, quantum number.pptx (20)

Ch06 outline
Ch06 outlineCh06 outline
Ch06 outline
 
Module 3 Engg Phys.pptx
Module 3 Engg Phys.pptxModule 3 Engg Phys.pptx
Module 3 Engg Phys.pptx
 
chapter 1 cotli(1).pdf properties of X ray
chapter 1 cotli(1).pdf properties of X raychapter 1 cotli(1).pdf properties of X ray
chapter 1 cotli(1).pdf properties of X ray
 
Ch7 z5e at structure
Ch7 z5e at structureCh7 z5e at structure
Ch7 z5e at structure
 
1f properties of light eng
1f properties of light eng1f properties of light eng
1f properties of light eng
 
Unit 6 Presentation.ppt
Unit 6 Presentation.pptUnit 6 Presentation.ppt
Unit 6 Presentation.ppt
 
Chapter4electronsinatoms 111110092817-phpapp02
Chapter4electronsinatoms 111110092817-phpapp02Chapter4electronsinatoms 111110092817-phpapp02
Chapter4electronsinatoms 111110092817-phpapp02
 
Black body radiation.
Black body radiation.Black body radiation.
Black body radiation.
 
Thesis on the masses of photons with different wavelengths.pdf
Thesis on the masses of photons with different wavelengths.pdf Thesis on the masses of photons with different wavelengths.pdf
Thesis on the masses of photons with different wavelengths.pdf
 
Wave particle duality of light- A changing Notion in Science
Wave particle duality of light- A changing Notion in ScienceWave particle duality of light- A changing Notion in Science
Wave particle duality of light- A changing Notion in Science
 
Max Planck (student preso)
Max Planck (student preso)Max Planck (student preso)
Max Planck (student preso)
 
2. Introduction to Spectroscopy 2022.pptx
2. Introduction to Spectroscopy 2022.pptx2. Introduction to Spectroscopy 2022.pptx
2. Introduction to Spectroscopy 2022.pptx
 
light lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrelight lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrre
 
C H6
C H6C H6
C H6
 
Unit-IV_22UCH101_Theory-1.pptx
Unit-IV_22UCH101_Theory-1.pptxUnit-IV_22UCH101_Theory-1.pptx
Unit-IV_22UCH101_Theory-1.pptx
 
Optical Instrumentation - 2. Basics of Optics
Optical Instrumentation - 2.   Basics of OpticsOptical Instrumentation - 2.   Basics of Optics
Optical Instrumentation - 2. Basics of Optics
 
Chapter one
Chapter oneChapter one
Chapter one
 
5_2020_03_25!07_16_23_PM (1).ppt
5_2020_03_25!07_16_23_PM (1).ppt5_2020_03_25!07_16_23_PM (1).ppt
5_2020_03_25!07_16_23_PM (1).ppt
 
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt
5_2020_03_25!07_16_23_PM_34_2vdjj_3493439.ppt
 
5_2020_03_25!07_16_23_PM.ppt
5_2020_03_25!07_16_23_PM.ppt5_2020_03_25!07_16_23_PM.ppt
5_2020_03_25!07_16_23_PM.ppt
 

More from MAHAZELTEOLOGO3

Q2C5L2 The Study of Life science- Copy.pptx
Q2C5L2 The Study of Life science- Copy.pptxQ2C5L2 The Study of Life science- Copy.pptx
Q2C5L2 The Study of Life science- Copy.pptxMAHAZELTEOLOGO3
 
genetically modified organisms. earth and life science
genetically modified organisms. earth and life sciencegenetically modified organisms. earth and life science
genetically modified organisms. earth and life scienceMAHAZELTEOLOGO3
 
evolution-161023055712 (1) geology .pptx
evolution-161023055712 (1) geology .pptxevolution-161023055712 (1) geology .pptx
evolution-161023055712 (1) geology .pptxMAHAZELTEOLOGO3
 
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.ppt
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.pptChapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.ppt
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.pptMAHAZELTEOLOGO3
 
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptx
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptxQ1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptx
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptxMAHAZELTEOLOGO3
 
Q1C1L2 The Origin of the Solar System.pptx
Q1C1L2 The Origin of the Solar System.pptxQ1C1L2 The Origin of the Solar System.pptx
Q1C1L2 The Origin of the Solar System.pptxMAHAZELTEOLOGO3
 
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptx
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptx
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptxMAHAZELTEOLOGO3
 
Calvin cycle general biology 2 stem 11pptx
Calvin cycle general biology 2 stem 11pptxCalvin cycle general biology 2 stem 11pptx
Calvin cycle general biology 2 stem 11pptxMAHAZELTEOLOGO3
 
fire hazard ppt final disaster rrr.pdf.pptx
fire hazard ppt final disaster rrr.pdf.pptxfire hazard ppt final disaster rrr.pdf.pptx
fire hazard ppt final disaster rrr.pdf.pptxMAHAZELTEOLOGO3
 
Q1C2L1 Types of Solutions general chemistry 2.pptx
Q1C2L1 Types of Solutions general chemistry 2.pptxQ1C2L1 Types of Solutions general chemistry 2.pptx
Q1C2L1 Types of Solutions general chemistry 2.pptxMAHAZELTEOLOGO3
 
ACIDS AND BASES general chemistry senior high school.pptx
ACIDS AND BASES general chemistry senior high school.pptxACIDS AND BASES general chemistry senior high school.pptx
ACIDS AND BASES general chemistry senior high school.pptxMAHAZELTEOLOGO3
 
B.1 Collision Theory PHYSICAL SCIENCE.pptx
B.1 Collision Theory PHYSICAL SCIENCE.pptxB.1 Collision Theory PHYSICAL SCIENCE.pptx
B.1 Collision Theory PHYSICAL SCIENCE.pptxMAHAZELTEOLOGO3
 
Cell Cycle Oral Recitation graded recitation.pptx
Cell Cycle Oral Recitation graded recitation.pptxCell Cycle Oral Recitation graded recitation.pptx
Cell Cycle Oral Recitation graded recitation.pptxMAHAZELTEOLOGO3
 
ancient astronomy physical science grade 12
ancient astronomy physical science grade 12ancient astronomy physical science grade 12
ancient astronomy physical science grade 12MAHAZELTEOLOGO3
 
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptxMAHAZELTEOLOGO3
 
B.1DRRR Earthquake Hazards.pdf
B.1DRRR Earthquake Hazards.pdfB.1DRRR Earthquake Hazards.pdf
B.1DRRR Earthquake Hazards.pdfMAHAZELTEOLOGO3
 
MixturesandPureSubstances.ppt
MixturesandPureSubstances.pptMixturesandPureSubstances.ppt
MixturesandPureSubstances.pptMAHAZELTEOLOGO3
 
Earth Science Table of Specifications .pdf
Earth Science Table of Specifications .pdfEarth Science Table of Specifications .pdf
Earth Science Table of Specifications .pdfMAHAZELTEOLOGO3
 

More from MAHAZELTEOLOGO3 (20)

Q2C5L2 The Study of Life science- Copy.pptx
Q2C5L2 The Study of Life science- Copy.pptxQ2C5L2 The Study of Life science- Copy.pptx
Q2C5L2 The Study of Life science- Copy.pptx
 
genetically modified organisms. earth and life science
genetically modified organisms. earth and life sciencegenetically modified organisms. earth and life science
genetically modified organisms. earth and life science
 
evolution-161023055712 (1) geology .pptx
evolution-161023055712 (1) geology .pptxevolution-161023055712 (1) geology .pptx
evolution-161023055712 (1) geology .pptx
 
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.ppt
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.pptChapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.ppt
Chapter 11 DNA Structure and Replication RNA and Protien Synthesis 2017.ppt
 
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptx
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptxQ1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptx
Q1C1L3 Life on Earth.pptx Q1C1L3 Life on Earth.pptx
 
Q1C1L2 The Origin of the Solar System.pptx
Q1C1L2 The Origin of the Solar System.pptxQ1C1L2 The Origin of the Solar System.pptx
Q1C1L2 The Origin of the Solar System.pptx
 
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptx
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptx
Q2C6L2 Animal Reproduction.pptxQ2C6L2 Animal Reproduction.pptx
 
Calvin cycle general biology 2 stem 11pptx
Calvin cycle general biology 2 stem 11pptxCalvin cycle general biology 2 stem 11pptx
Calvin cycle general biology 2 stem 11pptx
 
fire hazard ppt final disaster rrr.pdf.pptx
fire hazard ppt final disaster rrr.pdf.pptxfire hazard ppt final disaster rrr.pdf.pptx
fire hazard ppt final disaster rrr.pdf.pptx
 
Q1C2L1 Types of Solutions general chemistry 2.pptx
Q1C2L1 Types of Solutions general chemistry 2.pptxQ1C2L1 Types of Solutions general chemistry 2.pptx
Q1C2L1 Types of Solutions general chemistry 2.pptx
 
ACIDS AND BASES general chemistry senior high school.pptx
ACIDS AND BASES general chemistry senior high school.pptxACIDS AND BASES general chemistry senior high school.pptx
ACIDS AND BASES general chemistry senior high school.pptx
 
B.1 Collision Theory PHYSICAL SCIENCE.pptx
B.1 Collision Theory PHYSICAL SCIENCE.pptxB.1 Collision Theory PHYSICAL SCIENCE.pptx
B.1 Collision Theory PHYSICAL SCIENCE.pptx
 
Cell Cycle Oral Recitation graded recitation.pptx
Cell Cycle Oral Recitation graded recitation.pptxCell Cycle Oral Recitation graded recitation.pptx
Cell Cycle Oral Recitation graded recitation.pptx
 
ancient astronomy physical science grade 12
ancient astronomy physical science grade 12ancient astronomy physical science grade 12
ancient astronomy physical science grade 12
 
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx
(1) elimination FAMILY_FEUD Curriculum Day - - Copy.pptx
 
enzyme_class2.ppt
enzyme_class2.pptenzyme_class2.ppt
enzyme_class2.ppt
 
B.1DRRR Earthquake Hazards.pdf
B.1DRRR Earthquake Hazards.pdfB.1DRRR Earthquake Hazards.pdf
B.1DRRR Earthquake Hazards.pdf
 
MixturesandPureSubstances.ppt
MixturesandPureSubstances.pptMixturesandPureSubstances.ppt
MixturesandPureSubstances.ppt
 
Day 02 Pro and Eu.pptx
Day 02 Pro and Eu.pptxDay 02 Pro and Eu.pptx
Day 02 Pro and Eu.pptx
 
Earth Science Table of Specifications .pdf
Earth Science Table of Specifications .pdfEarth Science Table of Specifications .pdf
Earth Science Table of Specifications .pdf
 

Recently uploaded

Bentham & Hooker's Classification. along with the merits and demerits of the ...
Bentham & Hooker's Classification. along with the merits and demerits of the ...Bentham & Hooker's Classification. along with the merits and demerits of the ...
Bentham & Hooker's Classification. along with the merits and demerits of the ...Nistarini College, Purulia (W.B) India
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxAArockiyaNisha
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.PraveenaKalaiselvan1
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...Sérgio Sacani
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsSérgio Sacani
 
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...Sérgio Sacani
 
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...anilsa9823
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoSérgio Sacani
 
Grafana in space: Monitoring Japan's SLIM moon lander in real time
Grafana in space: Monitoring Japan's SLIM moon lander  in real timeGrafana in space: Monitoring Japan's SLIM moon lander  in real time
Grafana in space: Monitoring Japan's SLIM moon lander in real timeSatoshi NAKAHIRA
 
zoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzohaibmir069
 
TOPIC 8 Temperature and Heat.pdf physics
TOPIC 8 Temperature and Heat.pdf physicsTOPIC 8 Temperature and Heat.pdf physics
TOPIC 8 Temperature and Heat.pdf physicsssuserddc89b
 
Artificial Intelligence In Microbiology by Dr. Prince C P
Artificial Intelligence In Microbiology by Dr. Prince C PArtificial Intelligence In Microbiology by Dr. Prince C P
Artificial Intelligence In Microbiology by Dr. Prince C PPRINCE C P
 
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.aasikanpl
 
Recombinant DNA technology( Transgenic plant and animal)
Recombinant DNA technology( Transgenic plant and animal)Recombinant DNA technology( Transgenic plant and animal)
Recombinant DNA technology( Transgenic plant and animal)DHURKADEVIBASKAR
 
Recombination DNA Technology (Microinjection)
Recombination DNA Technology (Microinjection)Recombination DNA Technology (Microinjection)
Recombination DNA Technology (Microinjection)Jshifa
 
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝soniya singh
 
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxAnalytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxSwapnil Therkar
 
Animal Communication- Auditory and Visual.pptx
Animal Communication- Auditory and Visual.pptxAnimal Communication- Auditory and Visual.pptx
Animal Communication- Auditory and Visual.pptxUmerFayaz5
 
Genomic DNA And Complementary DNA Libraries construction.
Genomic DNA And Complementary DNA Libraries construction.Genomic DNA And Complementary DNA Libraries construction.
Genomic DNA And Complementary DNA Libraries construction.k64182334
 

Recently uploaded (20)

Bentham & Hooker's Classification. along with the merits and demerits of the ...
Bentham & Hooker's Classification. along with the merits and demerits of the ...Bentham & Hooker's Classification. along with the merits and demerits of the ...
Bentham & Hooker's Classification. along with the merits and demerits of the ...
 
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptxPhysiochemical properties of nanomaterials and its nanotoxicity.pptx
Physiochemical properties of nanomaterials and its nanotoxicity.pptx
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
 
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
All-domain Anomaly Resolution Office U.S. Department of Defense (U) Case: “Eg...
 
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroidsHubble Asteroid Hunter III. Physical properties of newly found asteroids
Hubble Asteroid Hunter III. Physical properties of newly found asteroids
 
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
PossibleEoarcheanRecordsoftheGeomagneticFieldPreservedintheIsuaSupracrustalBe...
 
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
Lucknow 💋 Russian Call Girls Lucknow Finest Escorts Service 8923113531 Availa...
 
Isotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on IoIsotopic evidence of long-lived volcanism on Io
Isotopic evidence of long-lived volcanism on Io
 
Grafana in space: Monitoring Japan's SLIM moon lander in real time
Grafana in space: Monitoring Japan's SLIM moon lander  in real timeGrafana in space: Monitoring Japan's SLIM moon lander  in real time
Grafana in space: Monitoring Japan's SLIM moon lander in real time
 
zoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistan
 
TOPIC 8 Temperature and Heat.pdf physics
TOPIC 8 Temperature and Heat.pdf physicsTOPIC 8 Temperature and Heat.pdf physics
TOPIC 8 Temperature and Heat.pdf physics
 
Artificial Intelligence In Microbiology by Dr. Prince C P
Artificial Intelligence In Microbiology by Dr. Prince C PArtificial Intelligence In Microbiology by Dr. Prince C P
Artificial Intelligence In Microbiology by Dr. Prince C P
 
The Philosophy of Science
The Philosophy of ScienceThe Philosophy of Science
The Philosophy of Science
 
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Munirka Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
 
Recombinant DNA technology( Transgenic plant and animal)
Recombinant DNA technology( Transgenic plant and animal)Recombinant DNA technology( Transgenic plant and animal)
Recombinant DNA technology( Transgenic plant and animal)
 
Recombination DNA Technology (Microinjection)
Recombination DNA Technology (Microinjection)Recombination DNA Technology (Microinjection)
Recombination DNA Technology (Microinjection)
 
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝
Call Girls in Munirka Delhi 💯Call Us 🔝8264348440🔝
 
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxAnalytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
 
Animal Communication- Auditory and Visual.pptx
Animal Communication- Auditory and Visual.pptxAnimal Communication- Auditory and Visual.pptx
Animal Communication- Auditory and Visual.pptx
 
Genomic DNA And Complementary DNA Libraries construction.
Genomic DNA And Complementary DNA Libraries construction.Genomic DNA And Complementary DNA Libraries construction.
Genomic DNA And Complementary DNA Libraries construction.
 

Quantum theory orbitals, quantum number.pptx

  • 1.
  • 2. A quantum (plural: quanta) is the smallest discrete unit of a phenomenon. For example, a quantum of light is a photon, and a quantum of electricity is an electron. Quantum comes from Latin, meaning "an amount" or "how much?" If something is quantifiable, then it can be measured.
  • 3. Electromagnetic (EM) waves Hertz (Hz) Speed Wave equation Max Planck Planck’s constant (6.626x10−34 J•s E=hf= ℎ𝑐 λ Photons Visible light Amplitude Wavelength Frequency
  • 4. Light propagates through space in the form of electromagnetic (EM) waves, which have both electric and magnetic properties. Visible light –is the portion of the eye which we can see using our naked eye. This visible light consists of 7 different colors (ROYGBIV); each color with distinct characteristics.
  • 5. Can be described in terms of: Amplitude Wavelength frequency The distance from the equilibrium point(x-axis) of a propagating wave to the highest (or lowest) point of the waveform. (λ) is the distance between identical points in successive cycles in a propagating wave and is usually measured in nanometers (nm) for the visible light regions. (f) Is the number of cycles that a wave makes per unit of time and is usually expressed in units of Hertz (Hz) of 1/s (read as “per second”)
  • 6.
  • 7. The frequency and wavelength of a wave is related to its speed (v)in the basic wave equation:
  • 8. This equation is used in describing the energy associated with light. When travelling in a vacuum, the speed of light is 3.0x108m/s and represented with the symbol c.
  • 9. He is a German theoretical physicist who in 1900, proposed the Quantum Theory, which won him the Nobel prize in Physics in 1918.
  • 10. According to this theory, light energy is “quantized” in multiples of hf. Each quantized energy, called a ‘quantum’, can be calculated using the equation; E=hf Where h is the Planck’s constant with a value of 6.626x𝟏𝟎−𝟑𝟒 J•s f is the frequency in Hertz (Hz)
  • 11. The energy of light of a certain wavelength can be calculated using the equation; Where λ is expressed in meters.
  • 12.
  • 13.
  • 14. Proposed that light, aside from being an electromagnetic wave, also exists as a tiny particles, which were later called photons. These two characteristics of light came to be known as the dual nature of light, which is consistent with the quantum theory known today.
  • 15. The photons can be considered as the quantized form of light. The energy of a photon can be measured in quantities of hf.