SlideShare a Scribd company logo
1 of 17
The Clash OF Civilizations
Impressions
and
Critique
In the post cold-war era, there
have been numerous
attempts at trying to
straighten-out the state of
world-
politics
• The End of History and The Last Man – Francis
Fukuyama (Universalisation of Western Liberal
Democracy) – 1992
• The Clash of Civilizations and Remaking of
World-Order – Samuel Huntington (Perpetual
Clash) – 1993
• Jihad vs. McWorld – Benjamin Barber
(Struggle between Globalization and Tribalism)- 1995
Who is Samuel Huntington?
Political Scientist
White-House coordinator
(Carter Administration)
Professor at Columbia And Harvard
Universities
Genesis of the idea of Clash
• This notion of “Clash of Civilizations” is not original
in Huntington
• In a sort of classic ‘orientalist’ gesture , he took it
from a 1990 Atlantic Magazine article – The Roots
of Muslim Rage by Bernard Lewis
• Its also suggested that Huntington’s proposition was
an attempt to ‘academically’ validate the fictitious
Islamic ‘Green Threat’ for the sustenance of Euro-
American military-industrial complex
Huntington’s
Clash of Civilizations
- First presented as a lecture in 1992 at
American Enterprise Institute
- Foreign Policy Magazine carried it as
a long-read in 1993
- Huntington later expanded it into a
book in 1996
Basic Premises
Dividing the World into ‘Civilizations’
• Western
• Confucian
• Japanese
• Islamic
• Hindu
• Slavic-Orthodox
• Latin-American
• African
The faultlines between civilizations will be
the battle lines of future
- Misappropriating diversity into conflict
- Faultlines don’t necessarily devolve into battle lines
Civilization is the broadest concept of
cultural identity
- Identities can traverse the boundaries civilization
- People can, for example, be western-muslims,
latin-american hindus, Japanese-muslims etc.
Increase in
Intra-Civilization Consciousness
due to increasing interactions
within the civilization
- What about the inter-civilizational exchanges?
- There is a healthy socio-cultural, economic
and political exchange between civilizations,
cutting across Huntington’s “battle lines”
West, at the peak of its power confronts
NON-WESTS that increasingly have
a desire, the will and the resources
to shape the world into non-western ways
- Creating a “non-western” demon
- A demon that “we” are in “confrontation”
with
Economic Regionalism is increasing
amongst civilizations. It can only
succeed only when its rooted in
common civilization
- Inter-Civilizational trade organizations
- BRICS
- Trans-Pacific Partnership
- BRICS contains five different ‘civilizations’
First Arab Nationalism then Islamic
fundamentalism manifested themselves
-As if so called Islamic Fundamentalism is a successor
of Arab Nationalism
- Arab Nationalism was mainly anti-colonial in nature
- Islam has bloody borders. Classic example of
Islamophobic bigotry
Aggrandizing the west
West Versus the Rest
Most of the attention is given to West
West propounds a “universal civilization”
Right-Wing Neocon Agenda
Alarmist Themes
- The Islamic-Confucian alliance has emerged
to challenge western interests, values and power
- Western countries are decreasing their
military power while non-western ones are
increasing it. Only west promotes non-
proliferation
- Flow of weapons is generally from East-Asia
to Middle-East?
Sounds more like policy-recommendation
than a genuine academic research
- To create a “western block”, by roping-in
Latin-America, Europe, Russia and Japan,
against “Confucian and Islamic States
- Maintain Western Military Superiority in East and
South-West Asia
- To “exploit” differences and conflicts among
Confucian and Islamic States. To support, in other
Civilizations, groups sympathetic to the West-
Divide and Rule

More Related Content

What's hot

Balance of power by md sharif hussain
Balance of power by  md sharif hussainBalance of power by  md sharif hussain
Balance of power by md sharif hussainMDSharifHussain
 
End of the history and the last man
End of the history and the last manEnd of the history and the last man
End of the history and the last manSidra Aslam
 
Imperialism notes
Imperialism notesImperialism notes
Imperialism notesjasylvester
 
Gramsci and hegemony
Gramsci and hegemonyGramsci and hegemony
Gramsci and hegemonyjphibbert1979
 
International Relations: Definition, History & Scope
International Relations: Definition, History & ScopeInternational Relations: Definition, History & Scope
International Relations: Definition, History & ScopeShahid Hussain Raja
 
CSS Notes Pakistan Compilation - PDF
CSS Notes Pakistan Compilation - PDFCSS Notes Pakistan Compilation - PDF
CSS Notes Pakistan Compilation - PDFFaHaD .H. NooR
 
Gramsci's theory of cultural hegemony
Gramsci's theory of cultural hegemonyGramsci's theory of cultural hegemony
Gramsci's theory of cultural hegemonyTara_S
 
Theory postmodernism
Theory postmodernismTheory postmodernism
Theory postmodernismJohn Bradford
 
International Political Economy
International Political EconomyInternational Political Economy
International Political Economybrianbelen
 
World systems theory
World systems theoryWorld systems theory
World systems theoryMark Peterson
 
Globalization & the Clash of Civilizations
Globalization & the Clash of Civilizations Globalization & the Clash of Civilizations
Globalization & the Clash of Civilizations Boutkhil Guemide
 
Origin and causes of the cold war
Origin and causes of the cold warOrigin and causes of the cold war
Origin and causes of the cold warAnnumchaudhary
 
Introducing Global Politics.pptx
Introducing Global Politics.pptxIntroducing Global Politics.pptx
Introducing Global Politics.pptxssuser72c9f51
 
Gramsci and hegemony
Gramsci and hegemonyGramsci and hegemony
Gramsci and hegemonyNWsociology
 

What's hot (20)

Balance of power by md sharif hussain
Balance of power by  md sharif hussainBalance of power by  md sharif hussain
Balance of power by md sharif hussain
 
End of the history and the last man
End of the history and the last manEnd of the history and the last man
End of the history and the last man
 
Imperialism notes
Imperialism notesImperialism notes
Imperialism notes
 
Colonialism
ColonialismColonialism
Colonialism
 
Gramsci and hegemony
Gramsci and hegemonyGramsci and hegemony
Gramsci and hegemony
 
Behaviouralism
BehaviouralismBehaviouralism
Behaviouralism
 
Postmodernism, post-structuralism, and post-colonialism in IR
Postmodernism, post-structuralism, and post-colonialism in IRPostmodernism, post-structuralism, and post-colonialism in IR
Postmodernism, post-structuralism, and post-colonialism in IR
 
International Relations: Definition, History & Scope
International Relations: Definition, History & ScopeInternational Relations: Definition, History & Scope
International Relations: Definition, History & Scope
 
Neoliberalism in IR
Neoliberalism in IRNeoliberalism in IR
Neoliberalism in IR
 
CSS Notes Pakistan Compilation - PDF
CSS Notes Pakistan Compilation - PDFCSS Notes Pakistan Compilation - PDF
CSS Notes Pakistan Compilation - PDF
 
Gramsci's theory of cultural hegemony
Gramsci's theory of cultural hegemonyGramsci's theory of cultural hegemony
Gramsci's theory of cultural hegemony
 
Theory postmodernism
Theory postmodernismTheory postmodernism
Theory postmodernism
 
Realism ppt
Realism pptRealism ppt
Realism ppt
 
International Political Economy
International Political EconomyInternational Political Economy
International Political Economy
 
World systems theory
World systems theoryWorld systems theory
World systems theory
 
Globalization & the Clash of Civilizations
Globalization & the Clash of Civilizations Globalization & the Clash of Civilizations
Globalization & the Clash of Civilizations
 
Decolonisation
DecolonisationDecolonisation
Decolonisation
 
Origin and causes of the cold war
Origin and causes of the cold warOrigin and causes of the cold war
Origin and causes of the cold war
 
Introducing Global Politics.pptx
Introducing Global Politics.pptxIntroducing Global Politics.pptx
Introducing Global Politics.pptx
 
Gramsci and hegemony
Gramsci and hegemonyGramsci and hegemony
Gramsci and hegemony
 

Viewers also liked

Clash of civilizations
Clash of civilizationsClash of civilizations
Clash of civilizationschristianedyer
 
Islam within europe, clash of civilizations
Islam within europe, clash of civilizationsIslam within europe, clash of civilizations
Islam within europe, clash of civilizationsNari Hakobian
 
Clash Of Cultures
Clash Of CulturesClash Of Cultures
Clash Of Culturesmragab
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyevmehbaliyev
 
Clash of Civilizations
Clash of CivilizationsClash of Civilizations
Clash of CivilizationsMatthew Gibson
 
The inevitability of The Clash of Civilization
The inevitability of The Clash of CivilizationThe inevitability of The Clash of Civilization
The inevitability of The Clash of Civilizationsbox
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyevmehbaliyev
 
The Book Review of The Clash of Civilization & The Remarking of World Order (...
The Book Review of The Clash of Civilization & The Remarking of World Order (...The Book Review of The Clash of Civilization & The Remarking of World Order (...
The Book Review of The Clash of Civilization & The Remarking of World Order (...Dipty Debnath
 
Bush doctrine by @JWongi
Bush doctrine by @JWongiBush doctrine by @JWongi
Bush doctrine by @JWongihimchanjung
 
European Civilizations - review ideas and questions
European Civilizations - review ideas and questionsEuropean Civilizations - review ideas and questions
European Civilizations - review ideas and questionsNathan Roher
 
Presentation11civilazation new copy
Presentation11civilazation new copyPresentation11civilazation new copy
Presentation11civilazation new copyBENON KAJIBWAMI
 
European Civilizations - Weird Review
European Civilizations - Weird ReviewEuropean Civilizations - Weird Review
European Civilizations - Weird ReviewNathan Roher
 
Islamic Fundamentalism: Religion of Struggle, Ideology of Terror
Islamic Fundamentalism: Religion of Struggle, Ideology of TerrorIslamic Fundamentalism: Religion of Struggle, Ideology of Terror
Islamic Fundamentalism: Religion of Struggle, Ideology of TerrorPhilip Auerswald
 

Viewers also liked (20)

Clash of civilizations
Clash of civilizationsClash of civilizations
Clash of civilizations
 
Islam within europe, clash of civilizations
Islam within europe, clash of civilizationsIslam within europe, clash of civilizations
Islam within europe, clash of civilizations
 
Clash Of Cultures
Clash Of CulturesClash Of Cultures
Clash Of Cultures
 
The End of History? And the last man?
The End of History? And the last man?The End of History? And the last man?
The End of History? And the last man?
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
 
Clash of Civilizations
Clash of CivilizationsClash of Civilizations
Clash of Civilizations
 
Francis fukuyama
Francis fukuyamaFrancis fukuyama
Francis fukuyama
 
The inevitability of The Clash of Civilization
The inevitability of The Clash of CivilizationThe inevitability of The Clash of Civilization
The inevitability of The Clash of Civilization
 
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad MehbaliyevCivilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
Civilizations, their nature and clash possibilities (c) Rashad Mehbaliyev
 
The Book Review of The Clash of Civilization & The Remarking of World Order (...
The Book Review of The Clash of Civilization & The Remarking of World Order (...The Book Review of The Clash of Civilization & The Remarking of World Order (...
The Book Review of The Clash of Civilization & The Remarking of World Order (...
 
Bush doctrine by @JWongi
Bush doctrine by @JWongiBush doctrine by @JWongi
Bush doctrine by @JWongi
 
European Civilizations - review ideas and questions
European Civilizations - review ideas and questionsEuropean Civilizations - review ideas and questions
European Civilizations - review ideas and questions
 
POl 540 Journal 5
POl 540 Journal 5POl 540 Journal 5
POl 540 Journal 5
 
Presentation11civilazation new copy
Presentation11civilazation new copyPresentation11civilazation new copy
Presentation11civilazation new copy
 
Cold War
Cold WarCold War
Cold War
 
Iraq war 2
Iraq war 2Iraq war 2
Iraq war 2
 
European Civilizations - Weird Review
European Civilizations - Weird ReviewEuropean Civilizations - Weird Review
European Civilizations - Weird Review
 
Islamic Fundamentalism: Religion of Struggle, Ideology of Terror
Islamic Fundamentalism: Religion of Struggle, Ideology of TerrorIslamic Fundamentalism: Religion of Struggle, Ideology of Terror
Islamic Fundamentalism: Religion of Struggle, Ideology of Terror
 
Democracy theories
Democracy theoriesDemocracy theories
Democracy theories
 
Structural realism
Structural realismStructural realism
Structural realism
 

Similar to Clash of Civilizations? A critical perspective

CLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptFarahElgendy
 
Globalization Theory
Globalization TheoryGlobalization Theory
Globalization TheoryKhenddro Low
 
Rethinking Social Science Education
Rethinking Social Science EducationRethinking Social Science Education
Rethinking Social Science EducationAsad Zaman
 
globalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxglobalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxRamirSimbre3
 
Global Media cultures
Global Media culturesGlobal Media cultures
Global Media cultureserickajoy4
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfKanikaBansal52
 
A Sense of Siege The Geopolitics of Islam and the West.pdf
A Sense of Siege The Geopolitics of Islam and the West.pdfA Sense of Siege The Geopolitics of Islam and the West.pdf
A Sense of Siege The Geopolitics of Islam and the West.pdfccccccccdddddd
 
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)Ladystellas
 

Similar to Clash of Civilizations? A critical perspective (12)

CLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.pptCLASH_OF_CIVILIZATIONS 2.ppt
CLASH_OF_CIVILIZATIONS 2.ppt
 
Future of civilizations
Future of civilizationsFuture of civilizations
Future of civilizations
 
Globalization Theory
Globalization TheoryGlobalization Theory
Globalization Theory
 
Islamophobia
IslamophobiaIslamophobia
Islamophobia
 
Rethinking Social Science Education
Rethinking Social Science EducationRethinking Social Science Education
Rethinking Social Science Education
 
globalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptxglobalmediacultures-201205091129 (1).pptx
globalmediacultures-201205091129 (1).pptx
 
Global Media cultures
Global Media culturesGlobal Media cultures
Global Media cultures
 
ferneeamericancivilwar.pdf
ferneeamericancivilwar.pdfferneeamericancivilwar.pdf
ferneeamericancivilwar.pdf
 
A Sense of Siege The Geopolitics of Islam and the West.pdf
A Sense of Siege The Geopolitics of Islam and the West.pdfA Sense of Siege The Geopolitics of Islam and the West.pdf
A Sense of Siege The Geopolitics of Islam and the West.pdf
 
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)
Fire in-the-minds-of-men-origins-of-the-revolutionary-faith (1)
 
Etnocentrismo
EtnocentrismoEtnocentrismo
Etnocentrismo
 
Five types of c.s
Five types of c.sFive types of c.s
Five types of c.s
 

Recently uploaded

CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...
CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...
CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...henrik385807
 
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝soniya singh
 
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara Services
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara ServicesVVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara Services
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara ServicesPooja Nehwal
 
George Lever - eCommerce Day Chile 2024
George Lever -  eCommerce Day Chile 2024George Lever -  eCommerce Day Chile 2024
George Lever - eCommerce Day Chile 2024eCommerce Institute
 
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...NETWAYS
 
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdf
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdfOpen Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdf
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdfhenrik385807
 
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...Kayode Fayemi
 
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...NETWAYS
 
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStr
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStrSaaStr Workshop Wednesday w: Jason Lemkin, SaaStr
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStrsaastr
 
Microsoft Copilot AI for Everyone - created by AI
Microsoft Copilot AI for Everyone - created by AIMicrosoft Copilot AI for Everyone - created by AI
Microsoft Copilot AI for Everyone - created by AITatiana Gurgel
 
Motivation and Theory Maslow and Murray pdf
Motivation and Theory Maslow and Murray pdfMotivation and Theory Maslow and Murray pdf
Motivation and Theory Maslow and Murray pdfakankshagupta7348026
 
call girls in delhi malviya nagar @9811711561@
call girls in delhi malviya nagar @9811711561@call girls in delhi malviya nagar @9811711561@
call girls in delhi malviya nagar @9811711561@vikas rana
 
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...Salam Al-Karadaghi
 
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...NETWAYS
 
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...NETWAYS
 
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...Pooja Nehwal
 
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024eCommerce Institute
 
Genesis part 2 Isaiah Scudder 04-24-2024.pptx
Genesis part 2 Isaiah Scudder 04-24-2024.pptxGenesis part 2 Isaiah Scudder 04-24-2024.pptx
Genesis part 2 Isaiah Scudder 04-24-2024.pptxFamilyWorshipCenterD
 
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779Night 7k Call Girls Noida Sector 128 Call Me: 8448380779
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779Delhi Call girls
 
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...Hasting Chen
 

Recently uploaded (20)

CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...
CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...
CTAC 2024 Valencia - Sven Zoelle - Most Crucial Invest to Digitalisation_slid...
 
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝
Call Girls in Sarojini Nagar Market Delhi 💯 Call Us 🔝8264348440🔝
 
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara Services
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara ServicesVVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara Services
VVIP Call Girls Nalasopara : 9892124323, Call Girls in Nalasopara Services
 
George Lever - eCommerce Day Chile 2024
George Lever -  eCommerce Day Chile 2024George Lever -  eCommerce Day Chile 2024
George Lever - eCommerce Day Chile 2024
 
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...
Open Source Camp Kubernetes 2024 | Monitoring Kubernetes With Icinga by Eric ...
 
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdf
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdfOpen Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdf
Open Source Strategy in Logistics 2015_Henrik Hankedvz-d-nl-log-conference.pdf
 
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...
Governance and Nation-Building in Nigeria: Some Reflections on Options for Po...
 
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...
OSCamp Kubernetes 2024 | SRE Challenges in Monolith to Microservices Shift at...
 
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStr
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStrSaaStr Workshop Wednesday w: Jason Lemkin, SaaStr
SaaStr Workshop Wednesday w: Jason Lemkin, SaaStr
 
Microsoft Copilot AI for Everyone - created by AI
Microsoft Copilot AI for Everyone - created by AIMicrosoft Copilot AI for Everyone - created by AI
Microsoft Copilot AI for Everyone - created by AI
 
Motivation and Theory Maslow and Murray pdf
Motivation and Theory Maslow and Murray pdfMotivation and Theory Maslow and Murray pdf
Motivation and Theory Maslow and Murray pdf
 
call girls in delhi malviya nagar @9811711561@
call girls in delhi malviya nagar @9811711561@call girls in delhi malviya nagar @9811711561@
call girls in delhi malviya nagar @9811711561@
 
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...
Exploring protein-protein interactions by Weak Affinity Chromatography (WAC) ...
 
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...
OSCamp Kubernetes 2024 | A Tester's Guide to CI_CD as an Automated Quality Co...
 
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...
Open Source Camp Kubernetes 2024 | Running WebAssembly on Kubernetes by Alex ...
 
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...
Navi Mumbai Call Girls Service Pooja 9892124323 Real Russian Girls Looking Mo...
 
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024
Andrés Ramírez Gossler, Facundo Schinnea - eCommerce Day Chile 2024
 
Genesis part 2 Isaiah Scudder 04-24-2024.pptx
Genesis part 2 Isaiah Scudder 04-24-2024.pptxGenesis part 2 Isaiah Scudder 04-24-2024.pptx
Genesis part 2 Isaiah Scudder 04-24-2024.pptx
 
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779Night 7k Call Girls Noida Sector 128 Call Me: 8448380779
Night 7k Call Girls Noida Sector 128 Call Me: 8448380779
 
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...
Re-membering the Bard: Revisiting The Compleat Wrks of Wllm Shkspr (Abridged)...
 

Clash of Civilizations? A critical perspective

  • 1. The Clash OF Civilizations Impressions and Critique
  • 2. In the post cold-war era, there have been numerous attempts at trying to straighten-out the state of world- politics • The End of History and The Last Man – Francis Fukuyama (Universalisation of Western Liberal Democracy) – 1992 • The Clash of Civilizations and Remaking of World-Order – Samuel Huntington (Perpetual Clash) – 1993 • Jihad vs. McWorld – Benjamin Barber (Struggle between Globalization and Tribalism)- 1995
  • 3. Who is Samuel Huntington? Political Scientist White-House coordinator (Carter Administration) Professor at Columbia And Harvard Universities
  • 4. Genesis of the idea of Clash • This notion of “Clash of Civilizations” is not original in Huntington • In a sort of classic ‘orientalist’ gesture , he took it from a 1990 Atlantic Magazine article – The Roots of Muslim Rage by Bernard Lewis • Its also suggested that Huntington’s proposition was an attempt to ‘academically’ validate the fictitious Islamic ‘Green Threat’ for the sustenance of Euro- American military-industrial complex
  • 5. Huntington’s Clash of Civilizations - First presented as a lecture in 1992 at American Enterprise Institute - Foreign Policy Magazine carried it as a long-read in 1993 - Huntington later expanded it into a book in 1996
  • 7. Dividing the World into ‘Civilizations’ • Western • Confucian • Japanese • Islamic • Hindu • Slavic-Orthodox • Latin-American • African
  • 8. The faultlines between civilizations will be the battle lines of future - Misappropriating diversity into conflict - Faultlines don’t necessarily devolve into battle lines
  • 9. Civilization is the broadest concept of cultural identity - Identities can traverse the boundaries civilization - People can, for example, be western-muslims, latin-american hindus, Japanese-muslims etc.
  • 10. Increase in Intra-Civilization Consciousness due to increasing interactions within the civilization - What about the inter-civilizational exchanges? - There is a healthy socio-cultural, economic and political exchange between civilizations, cutting across Huntington’s “battle lines”
  • 11. West, at the peak of its power confronts NON-WESTS that increasingly have a desire, the will and the resources to shape the world into non-western ways - Creating a “non-western” demon - A demon that “we” are in “confrontation” with
  • 12. Economic Regionalism is increasing amongst civilizations. It can only succeed only when its rooted in common civilization - Inter-Civilizational trade organizations - BRICS - Trans-Pacific Partnership - BRICS contains five different ‘civilizations’
  • 13. First Arab Nationalism then Islamic fundamentalism manifested themselves -As if so called Islamic Fundamentalism is a successor of Arab Nationalism - Arab Nationalism was mainly anti-colonial in nature - Islam has bloody borders. Classic example of Islamophobic bigotry
  • 14. Aggrandizing the west West Versus the Rest Most of the attention is given to West West propounds a “universal civilization”
  • 16. Alarmist Themes - The Islamic-Confucian alliance has emerged to challenge western interests, values and power - Western countries are decreasing their military power while non-western ones are increasing it. Only west promotes non- proliferation - Flow of weapons is generally from East-Asia to Middle-East?
  • 17. Sounds more like policy-recommendation than a genuine academic research - To create a “western block”, by roping-in Latin-America, Europe, Russia and Japan, against “Confucian and Islamic States - Maintain Western Military Superiority in East and South-West Asia - To “exploit” differences and conflicts among Confucian and Islamic States. To support, in other Civilizations, groups sympathetic to the West- Divide and Rule