SlideShare a Scribd company logo
1 of 74
Disease, and Other Clinical
      Natural Kinds


               Barry Smith
 Gradualist Approaches to Health and Disease
            Berlin, March 23, 2012



                                               1
Natural Kind

Synonyms: universal, type
= entities of the sorts which are referred to by
general terms of natural science

Instances, particulars, individuals
= entities of the sorts which can be observed
in experiments of natural science


                                                   2/
Old biology data




                   3/
New biology data
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSF
YEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFV
EDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLF
YLNRGYYNELSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIV
RSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDT
ERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNF
GAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRL
RKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVA
QETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDTTRRIQLYTD
YNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFN
HDPWMDVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYAT
FRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYES
ATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQ
WLGLESDYHCSFSSTRNAEDVDISRIVLYSYMFLNTAKGCLVEYA
                                              4
TFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYE
How to do biology across the genome?
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVIS
VMVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLER
CHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERL
KRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVC
KLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGIS
LLAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM
DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR
FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM
KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV
MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC
HEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLK
RDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCK
LRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISL
LAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM
DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR
FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM
KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV
MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC
HEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLK
RDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCK
LRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISL
LAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM
DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR
FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM
KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV5
MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC
how to link the kinds of
phenomena represented here




                              6/
or here




          7
or here




          8
MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRK
 to this?
RSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPIPSKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLF
YLNRGYYNELSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLH
VDELSIFSAYQASLPGEKKVDTERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFG
AGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIF
DDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDTTRRIQLYTDYN
KNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMDVVGFEDPNQVTNRDISRI
VLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESATS
ELMANHSVQTGRNIYGVDSFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVVAG
EAASSNHHQKISRVTRKRPREPKSTNDILVAGQKLFGSSFEFRDLHQLRLCYEIYMADTPSVAVQAPP
GYGKTELFHLPLIALASKGDVEYVSFLFVPYTVLLANCMIRLGRRGCLNVAPVRNFIEEGYDGVTDLYV
GIYDDLASTNFTDRIAAWENIVECTFRTNNVKLGYLIVDEFHNFETEVYRQSQFGGITNLDFDAFEKAIF
LSGTAPEAVADAALQRIGLTGLAKKSMDINELKRSEDLSRGLSSYPTRMFNLIKEKSEVPLGHVHKIRK
KVESQPEEALKLLLALFESEPESKAIVVASTTNEVEELACSWRKYFRVVWIHGKLGAAEKVSRTKEFV
TDGSMQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGEL
PPKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLSADTVELIERMDRLAEKQATASMSIVALPS
SFQESNSSDRYRKYCSSDEDSNTCIHGSANASTNASTNAITTASTNVRTNATTNASTNATTNASTNAS
TNATTNASTNATTNSSTNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNATTTESTNSSTNATT
TESTNSNTSATTTASINVRTSATTTESTNSSTSATTTASINVRTSATTTKSINSSTNATTTESTNSNTNA
TTTESTNSSTNATTTESTNSSTNATTTESTNSNTSAATTESTNSNTSATTTESTNASAKEDANKDGNA
EDNRFHPVTDINKESYKRKGSQMVLLERKKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDIYFCP
EGVFTQYGLCKGCQKMFELCVCWAGQKVSYRRIAWEALAVERMLRNDEEYKEYLEDIEPYHGDPVG
YLKYFSVKRREIYSQIQRNYAWYLAITRRRETISVLDSTRGKQGSQVFRMSGRQIKELYFKVWSNLRE
SKTEVLQYFLNWDEKKCQEEWEAKDDTVVVEALEKGGVFQRLRSMTSAGLQGPQYVKLQFSRHHR
QLRSRYELSLGMHLRDQIALGVTPSKVPHWTAFLSMLIGLFYNKTFRQKLEYLLEQISEVWLLPHWLD
LANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGELIGLFYNKTFRQKLEYL 9
LEQISEVWLLPHWLDLANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGELI
or this?




           10
answer: through annotation of data with terms
  from a controlled vocabulary or ‘ontology’


sphingolipid transporter activity

Holliday junction helicase complex




                                          11
this allows integration of databases
MouseEcotope                          GlyProt




                  Holliday junction
                  helicase complex

  DiabetInGene


     GluChem

                                                13
and supports logical reasoning over data




                                           15
‘Ontology’ in PubMed




                       16/24
GO, in particular, is tremendously successful




                                            17
$100 million invested in literature and
      data curation using GO
  over 11 million annotations relating gene
  products described in the UniProt,
  Ensembl and other databases to GO
  terms
  experimental results reported in 52,000
  scientific journal articles manually
  annoted by expert biologists using GO
                                              18
Benefits of the GO
1. rooted in basic experimental biology
2. links people to data and to literature
3. links data to data
  • across species (human, mouse, yeast, fly ...)
  • across granularities (molecule, cell, organ,
    organism, population)
1. links medicine to biological science
2. promotes cumulation of scientific
   knowledge in algorithmically tractable form
                                                   19
National Center for Biomedical Ontology
(NIH Roadmap Center)

   −      Stanford Biomedical Informatics Research
   −      The Mayo Clinic
   −      University at Buffalo Department of
  Philosophy

   http://bioportal.bioontology.org



                                                 24
25
26
GO supports only three types of annotation



what cellular component?

what molecular function?

what biological process?


                     no diseases in GO   27
28
CONTINUANT                     OCCURRENT
    RELATION
     TO TIME


                 INDEPENDENT               DEPENDENT
GRANULARITY


                           Anatomical
                Organism                 Organ
 ORGAN AND                    Entity
                 (NCBI                  Function
  ORGANISM                    (FMA,
               Taxonomy)              (FMP, CPRO) Phenotypic      Biological
                             CARO)                 Quality         Process
                                                    (PaTO)          (GO)
  CELL AND                   Cellular   Cellular
                 Cell
  CELLULAR                 Component Function
                 (CL)
 COMPONENT                 (FMA, GO)     (GO)
                    Molecule
                                        Molecular Function     Molecular Process
  MOLECULE         (ChEBI, SO,
                                              (GO)                  (GO)
                   RnaO, PrO)


         OBO Foundry (first version, 2006)
            Yellow = Gene Ontology                                                 29
http://obofoundry.org




                  30
Current OBO Foundry Ontologies
•   Biological process (GO)
•   Cellular component (GO)
•   Chemical entities of biological interest
•   Molecular function (GO)
•   Phenotypic quality
•   PRotein Ontology (PRO)
•   Xenopus Anatomy and Development
•   Zebrafish Anatomy and Development
                                               31
Foundry ontologies under review
Cell Ontology (CL)
Foundational Model of Anatomy (FMA)
Infectious Disease Ontology (IDO)
    Staph. aureus Ontology (IDO Sa)
    Malaria Ontology (IDO MAL)
    Influenza Ontology (IDO Flu)
    HIV Ontology (IDO HIV)
Ontology for Biomedical Investigations (OBI)
Ontology for General Medical Sciences (OGMS)
Plant Ontology (PO)                            32
Ontologies under construction
Allergy Ontology
Environment Ontology (EnvO)
Immunology Ontology (IDO)
Mental Functioning Ontology (MFO)
      Emotion Ontology (MFO-EM)
           Pain Ontology
Mental Disease Ontology (MDO)
Neurological Disease Ontology (ND)
Vaccine Ontology (VO)
                                     33
Foundational Model of Anatomy Ontology

FMA has 83281 types and 3 million relations
representing canonical adult human anatomy
= the anatomy generated by the coordinated
expression of the organism’s own structural
genes.
        32 teeth                   one nose
        two arms                   two nostrils
        two legs                   two kidneys, …

Canonical ≠ statistically normal
                                                    34
Anatomical
             Anatomical Space
                                                               Structure


    Organ Cavity            Organ
                                               Organ                          Organ Part
     Subdivision            Cavity


      Serous Sac          Serous Sac                           Organ            Organ
        Cavity              Cavity
                                             Serous Sac      Component        Subdivision
                                                                                             Tissue
      Subdivision
   is_a



                                                      Pleural Sac
                                                       Pleural Sac            Pleura(Wall
                             Pleural                                           Pleura(Wall
                              Pleural                                            of Sac)
                                                                                  of Sac)
                              Cavity




                                                                                             of
                               Cavity
                                               Parietal
                                                Parietal
                                                Pleura




                                                                                            t_
                                                 Pleura                    Visceral
                                                                            Visceral
                    Interlobar                                             Pleura
                                                                            Pleura
                     Interlobar




                                                                                    r
                      recess
                       recess           Mediastinal




                                                                                 pa
                                        Mediastinal
                                         Pleura
                                          Pleura             Mesothelium
                                                             Mesothelium
                                                              of Pleura
                                                               of Pleura

                                                                                                      35
dational Model of Anatomy (FMA)
An ontology
is a controlled structured vocabulary
  that includes a backbone taxonomy
  (nodes connected by the is_a [subtype]
  relation)
  together with further logically defined
  relations such as part_of, regulated_by




                                            36
Basic Formal Ontology (BFO)
 A simple top-level ontology to support
 information integration in scientific
 research
 Serves as starting point for OBO
 Foundry ontologies
 Domain ontologies built by downward
 population


                                          38
Continuant             Occurrent
       Basic Formal Ontology
                                Life
Independent       Dependent
          http://www.ifomis.org/bfo/
 Continuant       Continuant
Organism       Temperature




                                          39
Example: The Cell Ontology
Continuant




Independent       Dependent                 TYPES
Continuant        Continuant


                       Realizable
 Non-realizable
                       Dependent
 Dependent
                       Continuant
 Continuant
                       (function, role,


   ..... .....
 (quality)
                       disposition)


                                          INSTANCE
depends_on

       Continuant
                                       TYPES
                           example:
Independent   Dependent    temperature depends
 Continuant   Continuant
                           on bearer
   thing        quality


.... .....                         INSTANCE
Dependent
              Continuant


                     Realizable Dependent
Quality                   Continuant




Disposition        Function          Role

of banana,        of heart,       of employee,
to ripen          to pump blood   to work for pay


                                                    46
process of realization depends_on
             realizable

       Continuant           Occurrent




              Realizable
Independent
              Dependent
 Continuant
              Continuant    Process of
  bearer                    realization


.... ..... .......
              disposition



                                          47
Four distinct classificatory tasks
1.   of people (patients, carriers, …)
2.   of diseases (cases, instances, problems, …)
3.   of courses of disease (symptoms, treatments…)
4.   of representations (records, observations, data,
     diagnoses…)

ICD confuses 1. & 2.
Most standard terminologies confuse 2. and 4
                                                        51
Four distinct BFO categories
1. person (patient, carrier, …)
   – independent continuant
2. disease (case, instance, problem, …)
   – specifically dependent continuant
3. course of disease (symptom, treatment…)
   – occurrent
4. representation (record, datum, diagnosis…)
   – generically dependent continuant

                                                52
Four distinct BFO categories
1. people (patients, carriers, …)
   – independent continuants
2. disease (case, instance, problem, condition …)
   – disposition
3. course of disease (symptom, episode, outbreak …)
   – realization of dispositions
4. representations (records, data, diagnoses…)
   – generically dependent continuants

                                                  53
Big Picture (Ontology for General Medical Science)




                                                     55
Elucidation of Primitive Terms



 ‘extended organism’ = the organism and all
  the material entities located within it

 ‘bodily feature’ = either a physical part of the
  extended organism, a bodily quality, or a
  bodily process.



                                                     56
Elucidation of Primitive Terms
 clinically   abnormal - some bodily feature that
   (1) is not part of the life plan for an organism of the
    relevant type (unlike loss of milk teeth, aging or
    pregnancy),
   (2) is causally linked to an elevated risk either of
    pain or other feelings of illness, or of death or
    dysfunction, and
   (3) is such that the elevated risk exceeds a certain
    threshold level.*

  *Compare: baldness

                                                          57
Disorder
A material entity (fiat object part) which is
clinically abnormal and part of an extended
organism

Compare:
   Downtown Santa Barbara
   Mount Everest
   Peter Hucklenbroich’s pate

                                                58
Definitions - Foundational Terms

   Pathological Process =def. – A bodily process that is
    clinically abnormal.
   Disease =def. – A disposition (i) to undergo
    pathological processes that (ii) exists in an organism
    because of one or more disorders in that organism.




                                                             60
http://code.google.com/p/ogms/   61
Big Picture (Ontology for General Medical Science)




                                                     62
http://code.google.com/p/ogms/   63
Disease Course
=Def. The sum of processes through which a
given disease instance is realized.




                                         65
independent   dependent
                              occurrent
 continuant   continuant




                                             TYPES
              disposition     process

organism
                disease      course of
                              disease




                                             INSTANCE
                              course of
  John          John’s
                            John’s disease
                disease
coronary heart
  in nature, no sharp    disease
    boundaries here

 CHD in phase                               CHD in phase
                    CHD in phase of
of early lesions                              of surface           unstable         stable
                      asymptomatic
    and small                                disruption of          angina          angina
                   (‘silent’) infarction
fibrous plaques                                 plaque


  instantiates          instantiates       instantiates      instantiates     instantiates
      at t1                 at t2              at t3             at t4            at t5


                   John’s coronary heart disease


                                                                                             67
human
in nature, no sharp
  boundaries here


embryo          fetus          neonate         infant         child          adult


 instantiates   instantiates    instantiates   instantiates   instantiates    instantiates
     at t1          at t2           at t3          at t4          at t5           at t6


                                        John


                                                                                        68
A disease is a disposition


                      produces              bears                 realized_in


etiological process              disorder           disposition                 pathological process


                                                                                   produces


diagnosis       interpretive process         signs & symptoms           abnormal bodily features


        produces                     used_in               recognized_as
                                                                                               71
Cirrhosis - environmental exposure
   Etiological process - phenobarbitol-        Symptoms & Signs
    induced hepatic cell death                    used_in

     produces                                  Interpretive process
                                                  produces
   Disorder - necrotic liver
     bears
                                                Hypothesis - rule out cirrhosis
                                                  suggests
   Disposition (disease) - cirrhosis
     realized_in
                                                Laboratory tests
                                                  produces
   Pathological process - abnormal tissue      Test results - elevated liver enzymes
    repair with cell proliferation and           in serum
    fibrosis that exceed a certain                used_in
    threshold; hypoxia-induced cell death
                                                Interpretive process
     produces
                                                  produces
   Abnormal bodily features                    Result - diagnosis that patient X has a
     recognized_as                              disorder that bears the disease
   Symptoms - fatigue, anorexia                 cirrhosis
   Signs - jaundice, splenomegaly                                                   72
Influenza - infectious
   Etiological process - infection of          Symptoms & Signs
    airway epithelial cells with influenza        used_in
    virus                                       Interpretive process
     produces                                    produces

   Disorder - viable cells with influenza      Hypothesis - rule out influenza
    virus                                         suggests

     bears                                     Laboratory tests
                                                  produces
   Disposition (disease) - flu
     realized_in                               Test results - elevated serum antibody titers
                                                  used_in
   Pathological process - acute
    inflammation
                                                Interpretive process
                                                  produces
     produces
                                                Result - diagnosis that patient X has a
   Abnormal bodily features
                                                 disorder that bears the disease flu
     recognized_as

   Symptoms - weakness, dizziness
   Signs - fever                                                                      73
Huntington’s Disease - genetic
   Etiological process - inheritance of
    >39 CAG repeats in the HTT gene              Symptoms & Signs
     produces                                     used_in
   Disorder - chromosome 4 with                 Interpretive process
    abnormal mHTT                                  produces
     bears                                      Hypothesis - rule out Huntington’s
   Disposition (disease) - Huntington’s           suggests
    disease                                      Laboratory tests
     realized_in
                                                   produces
   Pathological process - accumulation of       Test results - molecular detection of
    mHTT protein fragments, abnormal              the HTT gene with >39CAG repeats
    transcription regulation, neuronal cell        used_in
    death in striatum
     produces
                                                 Interpretive process
                                                   produces
   Abnormal bodily features
     recognized_as
                                                 Result - diagnosis that patient X has a
                                                  disorder that bears the disease
   Symptoms - anxiety, depression                Huntington’s disease
   Signs - difficulties in speaking and
    swallowing                                                                        74
Dispositions and Predispositions

Some dispositions are predispositions to
other dispositions.




                                           75
HNPCC - genetic pre-disposition
   Etiological process - inheritance of a mutant mismatch repair gene
     produces
   Disorder - chromosome 3 with abnormal hMLH1
     bears
   Disposition (disease) - Lynch syndrome
     realized_in
   Pathological process - abnormal repair of DNA mismatches
     produces
   Disorder - mutations in proto-oncogenes and tumor suppressor genes with
    microsatellite repeats (e.g. TGF-beta R2)
     bears
   Disposition (disease) - non-polyposis colon cancer
     realized in
   Symptoms (including pain)
                                                                              76
Arterial Aneurysm
Disposition – atherosclerosis
    realized in
Pathological process – fatty material collects within the walls of arteries
    produces
Disorder – artery with weakened wall
    bears
Disposition – of artery to become distended
    realized_in
Pathological process – process of distending
    produces
Disorder – arterial aneurysm
    bears
Disposition – of artery to rupture
    realized in
Pathological process – (catastrophic event) of rupturing
    produces
Disorder – ruptured artery, arterial system with dangerously low blood pressure
    bears
Disposition – circulatory failure
    realized in
Pathological process – exsanguination, failure of homeostasis
    produces                                                                      77

Death
Systemic arterial hypertension
   Etiological process – abnormal               Symptoms & Signs
    reabsorption of NaCl by the kidney             used_in

     produces                                   Interpretive process
                                                   produces
   Disorder – abnormally large scattered
    molecular aggregate of salt in the           Hypothesis - rule out hypertension
    blood                                          suggests

     bears                                      Laboratory tests
                                                   produces
   Disposition (disease) - hypertension
     realized_in                                Test results -
                                                   used_in
   Pathological process – exertion of
    abnormal pressure against arterial wall
                                                 Interpretive process
                                                   produces
     produces
                                                 Result - diagnosis that patient X has a
   Abnormal bodily features
                                                  disorder that bears the disease hypertension
     recognized_as

   Symptoms -
   Signs – elevated blood pressure                                                    82
Type 2 Diabetes Mellitus
   Etiological process –                    Symptoms & Signs
     produces                                 used_in

   Disorder – abnormal pancreatic beta
                                             Interpretive process
                                               produces
    cells and abnormal muscle/fat cells
     bears
                                             Hypothesis - rule out diabetes mellitus
                                               suggests
   Disposition (disease) – diabetes
    mellitus
                                             Laboratory tests – fasting serum blood
                                              glucose, oral glucose challenge test, and/or
     realized_in
                                              blood hemoglobin A1c
   Pathological processes – diminished        produces
    insulin production , diminished          Test results -
    muscle/fat uptake of glucose               used_in
     produces
                                             Interpretive process
   Abnormal bodily features                   produces
     recognized_as                          Result - diagnosis that patient X has a
   Symptoms – polydipsia, polyuria,          disorder that bears the disease type 2
    polyphagia, blurred vision                diabetes mellitus
   Signs – elevated blood glucose and                                              83

    hemoglobin A1c
Type 1 hypersensitivity to penicillin
   Etiological process – sensitizing of mast      Symptoms & Signs
    cells and basophils during exposure to           used_in
    penicillin-class substance                     Interpretive process
     produces                                       produces

   Disorder – mast cells and basophils with       Hypothesis -
    epitope-specific IgE bound to Fc epsilon         suggests
    receptor I                                     Laboratory tests –
     bears                                          produces

   Disposition (disease) – type I                 Test results – occasionally, skin testing
    hypersensitivity                                 used_in

     realized_in                                  Interpretive process
                                                     produces
   Pathological process – type I
    hypersensitivity reaction                      Result - diagnosis that patient X has a
     produces                                      disorder that bears the disease type 1
                                                    hypersensitivity to penicillin
   Abnormal bodily features
     recognized_as

   Symptoms – pruritis, shortness of breath                                              84
   Signs – rash, urticaria, anaphylaxis
Early Onset Alzheimer’s Disease
Disorder – mutations in APP, PSEN1 and PSEN2
     bears
Disposition – impaired APP processing
          realized in
Pathological process – accumulation of intra- and extracellular protein in the
brain
produces
     Disorder – amyloid plaque and neurofibrillary tangles
bears
Disposition – of neurons to die
realized in
Pathological process – neuronal loss
     produces
Disorder – cognitive brain regions damaged and reduced in size
     bears
Disposition (disease) – Alzheimer’s dementia
     realized in
Symptoms – episodic memory loss and other cognitive domain impairment
                                                                            85
Arterial Aneurysm
•   Disposition – atherosclerosis
    –   realized in
•   Pathological process – fatty material collects within the walls of arteries
    –   produces
•   Disorder – artery with weakened wall
    –   bears
•   Disposition – of artery to become distended
    –   realized_in
•   Pathological process – process of distending
    –   produces
•   Disorder – arterial aneurysm
    –   bears
•   Disposition – of artery to rupture
    –   realized in
•   Pathological process – (catastrophic event) of rupturing
    –   produces
•   Disorder – ruptured artery, arterial system with dangerously low blood pressure
    –   bears
•   Disposition – circulatory failure
    –   realized in
•   Pathological process – exsanguination, failure of homeostasis
    –   produces                                                                      86
•   Death
Hemorrhagic stroke
•   Disorder – cerebral arterial aneurysm
    – bears
•   Disposition – of weakened artery to rupture
    – realized in
•   Pathological process – rupturing of weakened blood vessel
    – produces
•   Disorder – Intraparenchymal cerebral hemorrhage
    – bears
•   Disposition (disease) – to increased intra-cranial pressure
    – realized in
•   Pathological process – increasing intra-cranial pressure, compression of brain
    structures
    – produces
•   Disorder – Cerebral ischemia, Cerebral neuronal death
    – bears
•   Disposition (disease) – stroke
    – realized in
•   Symptoms – weakness/paralysis, loss of sensation, etc
                                                                                 87
Advantages of the Disposition Theory

Only something like the disposition
theory enables us to explain why a
fracture is not a disease




PETER HUCKLENBROICH
−Radius fracture loco classico “ is a disease”


                                                 88
PETER HUCKLENBROICH

A disease entity is a set of possible alternative
courses

x has disease entity D ≡
(x has course D1) or (x has course D2) or … or (x
has course Dn)
Only something like the disposition theory can
allow us to determine what does and what does
not belong to this list.

                                                    89
Think of all the different temporal extents of
the disease courses association with any
given disease

  • for those who die in an accident 5 seconds
    after catching the disease
  • for those who have no treatment
  • for those who have truly excellent treatment
  • …


                                                   90
Think of all the different combination cases:
of diseases with other diseases
of diseases with complications
of diseases at different stages of life
of diseases with different environments
       in igloos
       in Ost-Thüringen
       in sub-Saharan Africa
       in space-ships
       …




                                                91
Think of all the different types of patient:

     smoker
     non-smoker
     banana-leaf-smoker
     Am-Sonntag-bei-Mutti-Esser
     Aspirin-vor-dem-Schlafen-Gehen-Nehmer
     Auf-dem-Schiessplatz-Ohrstöpsel-Träger
     Auf-Weihnachtsmarkt-Lebkuchenherz-Käufer
     Auto-in-Waschstrasse-Abschliesser




                                                92
93
human
in nature, no sharp
  boundaries here


embryo          fetus          neonate         infant         child          adult


 instantiates   instantiates    instantiates   instantiates   instantiates    instantiates
     at t1          at t2           at t3          at t4          at t5           at t6


                                        John


                                                                                        94
portion of          Phrase
                   water
                                     transitions

portion of         portion of         portion of
   ice           liquid water            gas

instantiates         instantiates       instantiates
    at t1                at t2              at t3


               this portion of H20


                                                       95
temperature
in nature, no sharp
  boundaries here


37ºC            37.1ºC         37.2ºC           37.3ºC          37.4ºC          37.5ºC


 instantiates   instantiates     instantiates    instantiates    instantiates    instantiates
     at t1          at t2            at t3           at t4           at t5           at t6


                               John’s temperature


                                                                                           96

More Related Content

What's hot

Metabolomics: The Next Generation of Biochemistry
Metabolomics: The Next Generation of BiochemistryMetabolomics: The Next Generation of Biochemistry
Metabolomics: The Next Generation of BiochemistryMargaret Eason
 
Inflammatory Cytokine, Arsenic and Cancer
Inflammatory Cytokine, Arsenic and Cancer Inflammatory Cytokine, Arsenic and Cancer
Inflammatory Cytokine, Arsenic and Cancer Mezbahul Haque
 
Teresa Coque Hospital Universitario Ramón y Cajal.
Teresa Coque  Hospital Universitario Ramón y Cajal. Teresa Coque  Hospital Universitario Ramón y Cajal.
Teresa Coque Hospital Universitario Ramón y Cajal. Fundación Ramón Areces
 
JournalofCancerEpidemiologyandTreatment2
JournalofCancerEpidemiologyandTreatment2JournalofCancerEpidemiologyandTreatment2
JournalofCancerEpidemiologyandTreatment2Christian Schmidt
 
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...IOSR Journals
 
Molecular analysis of Microbial Community
Molecular analysis of Microbial CommunityMolecular analysis of Microbial Community
Molecular analysis of Microbial CommunityRinaldo John
 
2016. Motoaki seki. RIKEN cassava initiative
2016. Motoaki seki. RIKEN cassava initiative2016. Motoaki seki. RIKEN cassava initiative
2016. Motoaki seki. RIKEN cassava initiativeFOODCROPS
 
Biological chemistry
Biological chemistryBiological chemistry
Biological chemistryviveg22
 
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...Antonion Korcari
 
Zebrafish as an alternative method for determining the embryo toxicity of pla...
Zebrafish as an alternative method for determining the embryo toxicity of pla...Zebrafish as an alternative method for determining the embryo toxicity of pla...
Zebrafish as an alternative method for determining the embryo toxicity of pla...Noor Zada
 
Collaboratively Creating the Knowledge Graph of Life
Collaboratively Creating the Knowledge Graph of LifeCollaboratively Creating the Knowledge Graph of Life
Collaboratively Creating the Knowledge Graph of LifeChris Mungall
 
ACR2016 Wermuth Exosome poster
ACR2016 Wermuth Exosome posterACR2016 Wermuth Exosome poster
ACR2016 Wermuth Exosome posterKellan Carney
 
1 s2.0-s0015028214018603-main
1 s2.0-s0015028214018603-main1 s2.0-s0015028214018603-main
1 s2.0-s0015028214018603-main鋒博 蔡
 
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...Bérénice Batut
 
A Brief Introduction to Metabolomics
A Brief Introduction to Metabolomics A Brief Introduction to Metabolomics
A Brief Introduction to Metabolomics Ranjith Raj V
 

What's hot (19)

Metabolomics: The Next Generation of Biochemistry
Metabolomics: The Next Generation of BiochemistryMetabolomics: The Next Generation of Biochemistry
Metabolomics: The Next Generation of Biochemistry
 
Inflammatory Cytokine, Arsenic and Cancer
Inflammatory Cytokine, Arsenic and Cancer Inflammatory Cytokine, Arsenic and Cancer
Inflammatory Cytokine, Arsenic and Cancer
 
Teresa Coque Hospital Universitario Ramón y Cajal.
Teresa Coque  Hospital Universitario Ramón y Cajal. Teresa Coque  Hospital Universitario Ramón y Cajal.
Teresa Coque Hospital Universitario Ramón y Cajal.
 
JournalofCancerEpidemiologyandTreatment2
JournalofCancerEpidemiologyandTreatment2JournalofCancerEpidemiologyandTreatment2
JournalofCancerEpidemiologyandTreatment2
 
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...
Novel Way to Isolate Adipose Derive Mesenchymal Stem Cells & Its Future Clini...
 
Molecular analysis of Microbial Community
Molecular analysis of Microbial CommunityMolecular analysis of Microbial Community
Molecular analysis of Microbial Community
 
2016. Motoaki seki. RIKEN cassava initiative
2016. Motoaki seki. RIKEN cassava initiative2016. Motoaki seki. RIKEN cassava initiative
2016. Motoaki seki. RIKEN cassava initiative
 
Biological chemistry
Biological chemistryBiological chemistry
Biological chemistry
 
Introduction to alternatives to animal testing in toxicology
Introduction to alternatives to animal testing in toxicologyIntroduction to alternatives to animal testing in toxicology
Introduction to alternatives to animal testing in toxicology
 
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...
Deciphering signaling mechanisms of cartilage tissue engineered alginate scaf...
 
Zebrafish as an alternative method for determining the embryo toxicity of pla...
Zebrafish as an alternative method for determining the embryo toxicity of pla...Zebrafish as an alternative method for determining the embryo toxicity of pla...
Zebrafish as an alternative method for determining the embryo toxicity of pla...
 
Collaboratively Creating the Knowledge Graph of Life
Collaboratively Creating the Knowledge Graph of LifeCollaboratively Creating the Knowledge Graph of Life
Collaboratively Creating the Knowledge Graph of Life
 
ACR2016 Wermuth Exosome poster
ACR2016 Wermuth Exosome posterACR2016 Wermuth Exosome poster
ACR2016 Wermuth Exosome poster
 
1 s2.0-s0015028214018603-main
1 s2.0-s0015028214018603-main1 s2.0-s0015028214018603-main
1 s2.0-s0015028214018603-main
 
Suganya Poster Final Update 2
Suganya Poster Final Update 2Suganya Poster Final Update 2
Suganya Poster Final Update 2
 
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...
JOBIM 2015 - ASaiM: an environment to analyze intestinal microbiota - Demo wi...
 
bioinformatics enabling knowledge generation from agricultural omics data
bioinformatics enabling knowledge generation from agricultural omics databioinformatics enabling knowledge generation from agricultural omics data
bioinformatics enabling knowledge generation from agricultural omics data
 
A Brief Introduction to Metabolomics
A Brief Introduction to Metabolomics A Brief Introduction to Metabolomics
A Brief Introduction to Metabolomics
 
L10 freour
L10 freourL10 freour
L10 freour
 

Similar to Basic Formal Ontology (BFO) and Disease

ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...
ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...
ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...Barry Smith
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013Barry Smith
 
Comparative genomics
Comparative genomicsComparative genomics
Comparative genomicsprateek kumar
 
Bioinformatics A Biased Overview
Bioinformatics A Biased OverviewBioinformatics A Biased Overview
Bioinformatics A Biased OverviewPhilip Bourne
 
Building an efficient infrastructure, standards and data flow for metabolomics
Building an efficient infrastructure, standards and data flow for metabolomicsBuilding an efficient infrastructure, standards and data flow for metabolomics
Building an efficient infrastructure, standards and data flow for metabolomicsChristoph Steinbeck
 
Poster rovida lorenzetti v2.0
Poster rovida lorenzetti v2.0Poster rovida lorenzetti v2.0
Poster rovida lorenzetti v2.0crovida
 
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.11521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1MatthewTennant613
 
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.11521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1AnastaciaShadelb
 
Mungall keynote-biocurator-2017
Mungall keynote-biocurator-2017Mungall keynote-biocurator-2017
Mungall keynote-biocurator-2017Chris Mungall
 
GA4GH Phenotype Ontologies Task team update
GA4GH Phenotype Ontologies Task team updateGA4GH Phenotype Ontologies Task team update
GA4GH Phenotype Ontologies Task team updatemhaendel
 
Exploring your personal genome with free, online bioinformatics tools
Exploring your personal genome with free, online bioinformatics toolsExploring your personal genome with free, online bioinformatics tools
Exploring your personal genome with free, online bioinformatics tools01archivist
 
the others our biased perspective
the others our biased perspectivethe others our biased perspective
the others our biased perspectiveJoão Soares
 
Marine Host-Microbiome Interactions: Challenges and Opportunities
Marine Host-Microbiome Interactions: Challenges and OpportunitiesMarine Host-Microbiome Interactions: Challenges and Opportunities
Marine Host-Microbiome Interactions: Challenges and OpportunitiesJonathan Eisen
 

Similar to Basic Formal Ontology (BFO) and Disease (20)

ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...
ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...
ENVO: The Environment Ontology (Presentation at the Genomics Standards Consor...
 
Ontology in-buffalo-2013
Ontology in-buffalo-2013Ontology in-buffalo-2013
Ontology in-buffalo-2013
 
Building Communities Around Ontology Development
Building Communities Around Ontology DevelopmentBuilding Communities Around Ontology Development
Building Communities Around Ontology Development
 
Comparative genomics
Comparative genomicsComparative genomics
Comparative genomics
 
Biology Literature Review Example
Biology Literature Review ExampleBiology Literature Review Example
Biology Literature Review Example
 
Biology Literature Review Example
Biology Literature Review ExampleBiology Literature Review Example
Biology Literature Review Example
 
Bioinformatics A Biased Overview
Bioinformatics A Biased OverviewBioinformatics A Biased Overview
Bioinformatics A Biased Overview
 
Building an efficient infrastructure, standards and data flow for metabolomics
Building an efficient infrastructure, standards and data flow for metabolomicsBuilding an efficient infrastructure, standards and data flow for metabolomics
Building an efficient infrastructure, standards and data flow for metabolomics
 
Comparative genomics
Comparative genomicsComparative genomics
Comparative genomics
 
Poster rovida lorenzetti v2.0
Poster rovida lorenzetti v2.0Poster rovida lorenzetti v2.0
Poster rovida lorenzetti v2.0
 
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.11521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
 
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.11521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
1521-01033462318–327$25.00 httpdx.doi.org10.1124jpet.1
 
Basics of bioinformatics
Basics of bioinformaticsBasics of bioinformatics
Basics of bioinformatics
 
Biology homework help
Biology homework helpBiology homework help
Biology homework help
 
Mungall keynote-biocurator-2017
Mungall keynote-biocurator-2017Mungall keynote-biocurator-2017
Mungall keynote-biocurator-2017
 
GA4GH Phenotype Ontologies Task team update
GA4GH Phenotype Ontologies Task team updateGA4GH Phenotype Ontologies Task team update
GA4GH Phenotype Ontologies Task team update
 
OBO Foundry
OBO FoundryOBO Foundry
OBO Foundry
 
Exploring your personal genome with free, online bioinformatics tools
Exploring your personal genome with free, online bioinformatics toolsExploring your personal genome with free, online bioinformatics tools
Exploring your personal genome with free, online bioinformatics tools
 
the others our biased perspective
the others our biased perspectivethe others our biased perspective
the others our biased perspective
 
Marine Host-Microbiome Interactions: Challenges and Opportunities
Marine Host-Microbiome Interactions: Challenges and OpportunitiesMarine Host-Microbiome Interactions: Challenges and Opportunities
Marine Host-Microbiome Interactions: Challenges and Opportunities
 

More from Barry Smith

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of PhilosophyBarry Smith
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...Barry Smith
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvBarry Smith
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic LaborBarry Smith
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Barry Smith
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyBarry Smith
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of PokerBarry Smith
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Barry Smith
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataBarry Smith
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesBarry Smith
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainBarry Smith
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social MediaBarry Smith
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and ObamacareBarry Smith
 
e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...Barry Smith
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and deathBarry Smith
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataBarry Smith
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)Barry Smith
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Barry Smith
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of DefinitionsBarry Smith
 

More from Barry Smith (20)

Towards an Ontology of Philosophy
Towards an Ontology of PhilosophyTowards an Ontology of Philosophy
Towards an Ontology of Philosophy
 
An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...An application of Basic Formal Ontology to the Ontology of Services and Commo...
An application of Basic Formal Ontology to the Ontology of Services and Commo...
 
Ways of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the EruvWays of Worldmarking: The Ontology of the Eruv
Ways of Worldmarking: The Ontology of the Eruv
 
The Division of Deontic Labor
The Division of Deontic LaborThe Division of Deontic Labor
The Division of Deontic Labor
 
Ontology of Aging (August 2014)
Ontology of Aging (August 2014)Ontology of Aging (August 2014)
Ontology of Aging (August 2014)
 
Meaningful Use
Meaningful UseMeaningful Use
Meaningful Use
 
The Fifth Cycle of Philosophy
The Fifth Cycle of PhilosophyThe Fifth Cycle of Philosophy
The Fifth Cycle of Philosophy
 
Ontology of Poker
Ontology of PokerOntology of Poker
Ontology of Poker
 
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
Clinical trial data wants to be free: Lessons from the ImmPort Immunology Dat...
 
Enhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort DataEnhancing the Quality of ImmPort Data
Enhancing the Quality of ImmPort Data
 
The Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the HumanitiesThe Philosophome: An Exercise in the Ontology of the Humanities
The Philosophome: An Exercise in the Ontology of the Humanities
 
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence DomainIAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
IAO-Intel: An Ontology of Information Artifacts in the Intelligence Domain
 
Science of Emerging Social Media
Science of Emerging Social MediaScience of Emerging Social Media
Science of Emerging Social Media
 
Ethics, Informatics and Obamacare
Ethics, Informatics and ObamacareEthics, Informatics and Obamacare
Ethics, Informatics and Obamacare
 
e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...e‐Human Beings: The contribution of internet ranking systems to the developme...
e‐Human Beings: The contribution of internet ranking systems to the developme...
 
Ontology of aging and death
Ontology of aging and deathOntology of aging and death
Ontology of aging and death
 
ImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial dataImmPort strategies to enhance discoverability of clinical trial data
ImmPort strategies to enhance discoverability of clinical trial data
 
Ontology of Documents (2005)
Ontology of Documents (2005)Ontology of Documents (2005)
Ontology of Documents (2005)
 
Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)Ontology and the National Cancer Institute Thesaurus (2005)
Ontology and the National Cancer Institute Thesaurus (2005)
 
Introduction to the Logic of Definitions
Introduction to the Logic of DefinitionsIntroduction to the Logic of Definitions
Introduction to the Logic of Definitions
 

Basic Formal Ontology (BFO) and Disease

  • 1. Disease, and Other Clinical Natural Kinds Barry Smith Gradualist Approaches to Health and Disease Berlin, March 23, 2012 1
  • 2. Natural Kind Synonyms: universal, type = entities of the sorts which are referred to by general terms of natural science Instances, particulars, individuals = entities of the sorts which can be observed in experiments of natural science 2/
  • 5. How to do biology across the genome? MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVIS VMVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLER CHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERL KRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVC KLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGIS LLAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC HEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLK RDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCK LRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISL LAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC HEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLK RDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCK LRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISL LAFAGPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWM DVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSR FETDLYESATSELMANHSVQTGRNIYGVDFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVM KVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISV5 MVGKNVKKFLTFVEDEPDFQGGPISKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERC
  • 6. how to link the kinds of phenomena represented here 6/
  • 9. MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRK to this? RSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPIPSKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLF YLNRGYYNELSFRVLERCHEIASARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLH VDELSIFSAYQASLPGEKKVDTERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNFG AGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIF DDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFAGPQRNVYVDDTTRRIQLYTDYN KNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMDVVGFEDPNQVTNRDISRI VLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESATS ELMANHSVQTGRNIYGVDSFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVVAG EAASSNHHQKISRVTRKRPREPKSTNDILVAGQKLFGSSFEFRDLHQLRLCYEIYMADTPSVAVQAPP GYGKTELFHLPLIALASKGDVEYVSFLFVPYTVLLANCMIRLGRRGCLNVAPVRNFIEEGYDGVTDLYV GIYDDLASTNFTDRIAAWENIVECTFRTNNVKLGYLIVDEFHNFETEVYRQSQFGGITNLDFDAFEKAIF LSGTAPEAVADAALQRIGLTGLAKKSMDINELKRSEDLSRGLSSYPTRMFNLIKEKSEVPLGHVHKIRK KVESQPEEALKLLLALFESEPESKAIVVASTTNEVEELACSWRKYFRVVWIHGKLGAAEKVSRTKEFV TDGSMQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGEL PPKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLSADTVELIERMDRLAEKQATASMSIVALPS SFQESNSSDRYRKYCSSDEDSNTCIHGSANASTNASTNAITTASTNVRTNATTNASTNATTNASTNAS TNATTNASTNATTNSSTNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNATTTESTNSSTNATT TESTNSNTSATTTASINVRTSATTTESTNSSTSATTTASINVRTSATTTKSINSSTNATTTESTNSNTNA TTTESTNSSTNATTTESTNSSTNATTTESTNSNTSAATTESTNSNTSATTTESTNASAKEDANKDGNA EDNRFHPVTDINKESYKRKGSQMVLLERKKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDIYFCP EGVFTQYGLCKGCQKMFELCVCWAGQKVSYRRIAWEALAVERMLRNDEEYKEYLEDIEPYHGDPVG YLKYFSVKRREIYSQIQRNYAWYLAITRRRETISVLDSTRGKQGSQVFRMSGRQIKELYFKVWSNLRE SKTEVLQYFLNWDEKKCQEEWEAKDDTVVVEALEKGGVFQRLRSMTSAGLQGPQYVKLQFSRHHR QLRSRYELSLGMHLRDQIALGVTPSKVPHWTAFLSMLIGLFYNKTFRQKLEYLLEQISEVWLLPHWLD LANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGELIGLFYNKTFRQKLEYL 9 LEQISEVWLLPHWLDLANVEVLAADDTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGELI
  • 10. or this? 10
  • 11. answer: through annotation of data with terms from a controlled vocabulary or ‘ontology’ sphingolipid transporter activity Holliday junction helicase complex 11
  • 12. this allows integration of databases MouseEcotope GlyProt Holliday junction helicase complex DiabetInGene GluChem 13
  • 13. and supports logical reasoning over data 15
  • 15. GO, in particular, is tremendously successful 17
  • 16. $100 million invested in literature and data curation using GO over 11 million annotations relating gene products described in the UniProt, Ensembl and other databases to GO terms experimental results reported in 52,000 scientific journal articles manually annoted by expert biologists using GO 18
  • 17. Benefits of the GO 1. rooted in basic experimental biology 2. links people to data and to literature 3. links data to data • across species (human, mouse, yeast, fly ...) • across granularities (molecule, cell, organ, organism, population) 1. links medicine to biological science 2. promotes cumulation of scientific knowledge in algorithmically tractable form 19
  • 18. National Center for Biomedical Ontology (NIH Roadmap Center) − Stanford Biomedical Informatics Research − The Mayo Clinic − University at Buffalo Department of Philosophy http://bioportal.bioontology.org 24
  • 19. 25
  • 20. 26
  • 21. GO supports only three types of annotation what cellular component? what molecular function? what biological process? no diseases in GO 27
  • 22. 28
  • 23. CONTINUANT OCCURRENT RELATION TO TIME INDEPENDENT DEPENDENT GRANULARITY Anatomical Organism Organ ORGAN AND Entity (NCBI Function ORGANISM (FMA, Taxonomy) (FMP, CPRO) Phenotypic Biological CARO) Quality Process (PaTO) (GO) CELL AND Cellular Cellular Cell CELLULAR Component Function (CL) COMPONENT (FMA, GO) (GO) Molecule Molecular Function Molecular Process MOLECULE (ChEBI, SO, (GO) (GO) RnaO, PrO) OBO Foundry (first version, 2006) Yellow = Gene Ontology 29
  • 25. Current OBO Foundry Ontologies • Biological process (GO) • Cellular component (GO) • Chemical entities of biological interest • Molecular function (GO) • Phenotypic quality • PRotein Ontology (PRO) • Xenopus Anatomy and Development • Zebrafish Anatomy and Development 31
  • 26. Foundry ontologies under review Cell Ontology (CL) Foundational Model of Anatomy (FMA) Infectious Disease Ontology (IDO) Staph. aureus Ontology (IDO Sa) Malaria Ontology (IDO MAL) Influenza Ontology (IDO Flu) HIV Ontology (IDO HIV) Ontology for Biomedical Investigations (OBI) Ontology for General Medical Sciences (OGMS) Plant Ontology (PO) 32
  • 27. Ontologies under construction Allergy Ontology Environment Ontology (EnvO) Immunology Ontology (IDO) Mental Functioning Ontology (MFO) Emotion Ontology (MFO-EM) Pain Ontology Mental Disease Ontology (MDO) Neurological Disease Ontology (ND) Vaccine Ontology (VO) 33
  • 28. Foundational Model of Anatomy Ontology FMA has 83281 types and 3 million relations representing canonical adult human anatomy = the anatomy generated by the coordinated expression of the organism’s own structural genes. 32 teeth one nose two arms two nostrils two legs two kidneys, … Canonical ≠ statistically normal 34
  • 29. Anatomical Anatomical Space Structure Organ Cavity Organ Organ Organ Part Subdivision Cavity Serous Sac Serous Sac Organ Organ Cavity Cavity Serous Sac Component Subdivision Tissue Subdivision is_a Pleural Sac Pleural Sac Pleura(Wall Pleural Pleura(Wall Pleural of Sac) of Sac) Cavity of Cavity Parietal Parietal Pleura t_ Pleura Visceral Visceral Interlobar Pleura Pleura Interlobar r recess recess Mediastinal pa Mediastinal Pleura Pleura Mesothelium Mesothelium of Pleura of Pleura 35 dational Model of Anatomy (FMA)
  • 30. An ontology is a controlled structured vocabulary that includes a backbone taxonomy (nodes connected by the is_a [subtype] relation) together with further logically defined relations such as part_of, regulated_by 36
  • 31. Basic Formal Ontology (BFO) A simple top-level ontology to support information integration in scientific research Serves as starting point for OBO Foundry ontologies Domain ontologies built by downward population 38
  • 32. Continuant Occurrent Basic Formal Ontology Life Independent Dependent http://www.ifomis.org/bfo/ Continuant Continuant Organism Temperature 39
  • 33. Example: The Cell Ontology
  • 34. Continuant Independent Dependent TYPES Continuant Continuant Realizable Non-realizable Dependent Dependent Continuant Continuant (function, role, ..... ..... (quality) disposition) INSTANCE
  • 35. depends_on Continuant TYPES example: Independent Dependent temperature depends Continuant Continuant on bearer thing quality .... ..... INSTANCE
  • 36. Dependent Continuant Realizable Dependent Quality Continuant Disposition Function Role of banana, of heart, of employee, to ripen to pump blood to work for pay 46
  • 37. process of realization depends_on realizable Continuant Occurrent Realizable Independent Dependent Continuant Continuant Process of bearer realization .... ..... ....... disposition 47
  • 38. Four distinct classificatory tasks 1. of people (patients, carriers, …) 2. of diseases (cases, instances, problems, …) 3. of courses of disease (symptoms, treatments…) 4. of representations (records, observations, data, diagnoses…) ICD confuses 1. & 2. Most standard terminologies confuse 2. and 4 51
  • 39. Four distinct BFO categories 1. person (patient, carrier, …) – independent continuant 2. disease (case, instance, problem, …) – specifically dependent continuant 3. course of disease (symptom, treatment…) – occurrent 4. representation (record, datum, diagnosis…) – generically dependent continuant 52
  • 40. Four distinct BFO categories 1. people (patients, carriers, …) – independent continuants 2. disease (case, instance, problem, condition …) – disposition 3. course of disease (symptom, episode, outbreak …) – realization of dispositions 4. representations (records, data, diagnoses…) – generically dependent continuants 53
  • 41. Big Picture (Ontology for General Medical Science) 55
  • 42. Elucidation of Primitive Terms  ‘extended organism’ = the organism and all the material entities located within it  ‘bodily feature’ = either a physical part of the extended organism, a bodily quality, or a bodily process. 56
  • 43. Elucidation of Primitive Terms  clinically abnormal - some bodily feature that  (1) is not part of the life plan for an organism of the relevant type (unlike loss of milk teeth, aging or pregnancy),  (2) is causally linked to an elevated risk either of pain or other feelings of illness, or of death or dysfunction, and  (3) is such that the elevated risk exceeds a certain threshold level.* *Compare: baldness 57
  • 44. Disorder A material entity (fiat object part) which is clinically abnormal and part of an extended organism Compare: Downtown Santa Barbara Mount Everest Peter Hucklenbroich’s pate 58
  • 45. Definitions - Foundational Terms  Pathological Process =def. – A bodily process that is clinically abnormal.  Disease =def. – A disposition (i) to undergo pathological processes that (ii) exists in an organism because of one or more disorders in that organism. 60
  • 47. Big Picture (Ontology for General Medical Science) 62
  • 49. Disease Course =Def. The sum of processes through which a given disease instance is realized. 65
  • 50. independent dependent occurrent continuant continuant TYPES disposition process organism disease course of disease INSTANCE course of John John’s John’s disease disease
  • 51. coronary heart in nature, no sharp disease boundaries here CHD in phase CHD in phase CHD in phase of of early lesions of surface unstable stable asymptomatic and small disruption of angina angina (‘silent’) infarction fibrous plaques plaque instantiates instantiates instantiates instantiates instantiates at t1 at t2 at t3 at t4 at t5 John’s coronary heart disease 67
  • 52. human in nature, no sharp boundaries here embryo fetus neonate infant child adult instantiates instantiates instantiates instantiates instantiates instantiates at t1 at t2 at t3 at t4 at t5 at t6 John 68
  • 53. A disease is a disposition produces bears realized_in etiological process disorder disposition pathological process produces diagnosis interpretive process signs & symptoms abnormal bodily features produces used_in recognized_as 71
  • 54. Cirrhosis - environmental exposure  Etiological process - phenobarbitol-  Symptoms & Signs induced hepatic cell death  used_in  produces  Interpretive process  produces  Disorder - necrotic liver  bears  Hypothesis - rule out cirrhosis  suggests  Disposition (disease) - cirrhosis  realized_in  Laboratory tests  produces  Pathological process - abnormal tissue  Test results - elevated liver enzymes repair with cell proliferation and in serum fibrosis that exceed a certain  used_in threshold; hypoxia-induced cell death  Interpretive process  produces  produces  Abnormal bodily features  Result - diagnosis that patient X has a  recognized_as disorder that bears the disease  Symptoms - fatigue, anorexia cirrhosis  Signs - jaundice, splenomegaly 72
  • 55. Influenza - infectious  Etiological process - infection of  Symptoms & Signs airway epithelial cells with influenza  used_in virus  Interpretive process  produces  produces  Disorder - viable cells with influenza  Hypothesis - rule out influenza virus  suggests  bears  Laboratory tests  produces  Disposition (disease) - flu  realized_in  Test results - elevated serum antibody titers  used_in  Pathological process - acute inflammation  Interpretive process  produces  produces  Result - diagnosis that patient X has a  Abnormal bodily features disorder that bears the disease flu  recognized_as  Symptoms - weakness, dizziness  Signs - fever 73
  • 56. Huntington’s Disease - genetic  Etiological process - inheritance of >39 CAG repeats in the HTT gene  Symptoms & Signs  produces  used_in  Disorder - chromosome 4 with  Interpretive process abnormal mHTT  produces  bears  Hypothesis - rule out Huntington’s  Disposition (disease) - Huntington’s  suggests disease  Laboratory tests  realized_in  produces  Pathological process - accumulation of  Test results - molecular detection of mHTT protein fragments, abnormal the HTT gene with >39CAG repeats transcription regulation, neuronal cell  used_in death in striatum  produces  Interpretive process  produces  Abnormal bodily features  recognized_as  Result - diagnosis that patient X has a disorder that bears the disease  Symptoms - anxiety, depression Huntington’s disease  Signs - difficulties in speaking and swallowing 74
  • 57. Dispositions and Predispositions Some dispositions are predispositions to other dispositions. 75
  • 58. HNPCC - genetic pre-disposition  Etiological process - inheritance of a mutant mismatch repair gene  produces  Disorder - chromosome 3 with abnormal hMLH1  bears  Disposition (disease) - Lynch syndrome  realized_in  Pathological process - abnormal repair of DNA mismatches  produces  Disorder - mutations in proto-oncogenes and tumor suppressor genes with microsatellite repeats (e.g. TGF-beta R2)  bears  Disposition (disease) - non-polyposis colon cancer  realized in  Symptoms (including pain) 76
  • 59. Arterial Aneurysm Disposition – atherosclerosis realized in Pathological process – fatty material collects within the walls of arteries produces Disorder – artery with weakened wall bears Disposition – of artery to become distended realized_in Pathological process – process of distending produces Disorder – arterial aneurysm bears Disposition – of artery to rupture realized in Pathological process – (catastrophic event) of rupturing produces Disorder – ruptured artery, arterial system with dangerously low blood pressure bears Disposition – circulatory failure realized in Pathological process – exsanguination, failure of homeostasis produces 77 Death
  • 60. Systemic arterial hypertension  Etiological process – abnormal  Symptoms & Signs reabsorption of NaCl by the kidney  used_in  produces  Interpretive process  produces  Disorder – abnormally large scattered molecular aggregate of salt in the  Hypothesis - rule out hypertension blood  suggests  bears  Laboratory tests  produces  Disposition (disease) - hypertension  realized_in  Test results -  used_in  Pathological process – exertion of abnormal pressure against arterial wall  Interpretive process  produces  produces  Result - diagnosis that patient X has a  Abnormal bodily features disorder that bears the disease hypertension  recognized_as  Symptoms -  Signs – elevated blood pressure 82
  • 61. Type 2 Diabetes Mellitus  Etiological process –  Symptoms & Signs  produces  used_in  Disorder – abnormal pancreatic beta  Interpretive process  produces cells and abnormal muscle/fat cells  bears  Hypothesis - rule out diabetes mellitus  suggests  Disposition (disease) – diabetes mellitus  Laboratory tests – fasting serum blood glucose, oral glucose challenge test, and/or  realized_in blood hemoglobin A1c  Pathological processes – diminished  produces insulin production , diminished  Test results - muscle/fat uptake of glucose  used_in  produces  Interpretive process  Abnormal bodily features  produces  recognized_as  Result - diagnosis that patient X has a  Symptoms – polydipsia, polyuria, disorder that bears the disease type 2 polyphagia, blurred vision diabetes mellitus  Signs – elevated blood glucose and 83 hemoglobin A1c
  • 62. Type 1 hypersensitivity to penicillin  Etiological process – sensitizing of mast  Symptoms & Signs cells and basophils during exposure to  used_in penicillin-class substance  Interpretive process  produces  produces  Disorder – mast cells and basophils with  Hypothesis - epitope-specific IgE bound to Fc epsilon  suggests receptor I  Laboratory tests –  bears  produces  Disposition (disease) – type I  Test results – occasionally, skin testing hypersensitivity  used_in  realized_in  Interpretive process  produces  Pathological process – type I hypersensitivity reaction  Result - diagnosis that patient X has a  produces disorder that bears the disease type 1 hypersensitivity to penicillin  Abnormal bodily features  recognized_as  Symptoms – pruritis, shortness of breath 84  Signs – rash, urticaria, anaphylaxis
  • 63. Early Onset Alzheimer’s Disease Disorder – mutations in APP, PSEN1 and PSEN2 bears Disposition – impaired APP processing realized in Pathological process – accumulation of intra- and extracellular protein in the brain produces Disorder – amyloid plaque and neurofibrillary tangles bears Disposition – of neurons to die realized in Pathological process – neuronal loss produces Disorder – cognitive brain regions damaged and reduced in size bears Disposition (disease) – Alzheimer’s dementia realized in Symptoms – episodic memory loss and other cognitive domain impairment 85
  • 64. Arterial Aneurysm • Disposition – atherosclerosis – realized in • Pathological process – fatty material collects within the walls of arteries – produces • Disorder – artery with weakened wall – bears • Disposition – of artery to become distended – realized_in • Pathological process – process of distending – produces • Disorder – arterial aneurysm – bears • Disposition – of artery to rupture – realized in • Pathological process – (catastrophic event) of rupturing – produces • Disorder – ruptured artery, arterial system with dangerously low blood pressure – bears • Disposition – circulatory failure – realized in • Pathological process – exsanguination, failure of homeostasis – produces 86 • Death
  • 65. Hemorrhagic stroke • Disorder – cerebral arterial aneurysm – bears • Disposition – of weakened artery to rupture – realized in • Pathological process – rupturing of weakened blood vessel – produces • Disorder – Intraparenchymal cerebral hemorrhage – bears • Disposition (disease) – to increased intra-cranial pressure – realized in • Pathological process – increasing intra-cranial pressure, compression of brain structures – produces • Disorder – Cerebral ischemia, Cerebral neuronal death – bears • Disposition (disease) – stroke – realized in • Symptoms – weakness/paralysis, loss of sensation, etc 87
  • 66. Advantages of the Disposition Theory Only something like the disposition theory enables us to explain why a fracture is not a disease PETER HUCKLENBROICH −Radius fracture loco classico “ is a disease” 88
  • 67. PETER HUCKLENBROICH A disease entity is a set of possible alternative courses x has disease entity D ≡ (x has course D1) or (x has course D2) or … or (x has course Dn) Only something like the disposition theory can allow us to determine what does and what does not belong to this list. 89
  • 68. Think of all the different temporal extents of the disease courses association with any given disease • for those who die in an accident 5 seconds after catching the disease • for those who have no treatment • for those who have truly excellent treatment • … 90
  • 69. Think of all the different combination cases: of diseases with other diseases of diseases with complications of diseases at different stages of life of diseases with different environments in igloos in Ost-Thüringen in sub-Saharan Africa in space-ships … 91
  • 70. Think of all the different types of patient: smoker non-smoker banana-leaf-smoker Am-Sonntag-bei-Mutti-Esser Aspirin-vor-dem-Schlafen-Gehen-Nehmer Auf-dem-Schiessplatz-Ohrstöpsel-Träger Auf-Weihnachtsmarkt-Lebkuchenherz-Käufer Auto-in-Waschstrasse-Abschliesser 92
  • 71. 93
  • 72. human in nature, no sharp boundaries here embryo fetus neonate infant child adult instantiates instantiates instantiates instantiates instantiates instantiates at t1 at t2 at t3 at t4 at t5 at t6 John 94
  • 73. portion of Phrase water transitions portion of portion of portion of ice liquid water gas instantiates instantiates instantiates at t1 at t2 at t3 this portion of H20 95
  • 74. temperature in nature, no sharp boundaries here 37ºC 37.1ºC 37.2ºC 37.3ºC 37.4ºC 37.5ºC instantiates instantiates instantiates instantiates instantiates instantiates at t1 at t2 at t3 at t4 at t5 at t6 John’s temperature 96

Editor's Notes

  1. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=116006492 sequence of X chromosome in baker’s yeast
  2. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=116006492 sequence of X chromosome in baker’s yeast
  3. http://ehealthadvice.info/what-is-crohns-disease/
  4. http://www.topnews.in/health/why-schizophrenia-patients-may-have-trouble-reading-social-cues-212138
  5. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=116006492
  6. http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=116006492
  7. dir.niehs.nih.gov/ microarray/datamining/
  8. http://www.yeastgenome.org/help/images/cytokinesisDAGrels.jpg
  9. dir.niehs.nih.gov/ microarray/datamining/