![?=B?C8Q 6DF070C808I0F;
In a major flare-up at the
Mizoram-Assam border, at
least six Assam Police officials
were killed and 50 others,
including an SP, were injured in
a sudden escalation of the sim-
mering border dispute between
the two States.
The two Chief Ministers
blamed each other’s police for
the violence and sought the
Centre’s intervention. Union
Home Minister Amit Shah
spoke to the Chief Ministers of
Assam and Mizoram, Himanta
Biswa Sarma and Zoramthanga
respectively, and urged them to
ensure peace along the disput-
ed border and find an amica-
ble settlement.
Assam’s Barak Valley dis-
tricts of Cachar, Karimganj
and Hailakandi share a 164 km
long border with Mizoram’s
three districts of Aizawl,
Kolasib and Mamit.
This is third time in less
than two years that violence has
erupted following the territor-
ial dispute. There inter-State
border dispute saw violence in
August 2020 and February this
year also. The Assam Chief
Minister announced on Twitter
that six personnel of the Assam
Police were killed in firing by
“miscreants” from Mizoram
along the inter-State border in
the Cachar district.
“I am deeply pained to
inform that six brave jawans of
@assampolice have sacrificed
their lives while defending the
constitutional boundary of our
State at the Assam-Mizoram
border. My heartfelt condo-
lences to the bereaved families,”
Sarma tweeted.
While the Assam CM put
the blame on miscreants,
Mizoram Home Minister
Lalchamliana, in a statement,
said Mizoram Police respond-
ed “spontaneously by firing
back” at Assam Police after its
200 personnel forcibly crossed
a duty post manned by the
CRPF personnel and indulged
in arson, assault on unarmed
persons and firing.
A senior Assam Police offi-
cer, who is still inside the for-
est amid continuous firing
from across the State border,
told PTI that at least 50 per-
sonnel, including Cachar
Superintendent of Police
Nimbalkar Vaibhav
Chandrakant, were injured in
firing and stone-pelting.
The senior police officer
said miscreants from across the
State border suddenly started
firing when civil officials of
both sides were trying to sort
out the differences.
“I immediately cannot say
how many people have been
injured, but my guess is at least
50 personnel. Our SP was also
injured in the firing and a bul-
let hit his leg,” he said
over phone.
?=BQ =4F34;78
Parliament could not func-
tion once again on Monday
amid noisy protests by
Opposition members who
raised slogans and showed
placards on the Pegasus snoop-
ing row and farmers’ issue.
The Rajya Sabha witnessed
several adjournments and car-
ried no business where as the
Lok Sabha was adjourned for
the day after passage of two
bills without discussion. The
pre-lunch session in the Rajya
Sabha saw two adjournments
and it was the same in the after-
noon session also.
The Upper House assem-
bled at 2 pm and adjourned
within minutes to reassemble at
3 pm which too got adjourned
to meet again at 4 pm after
which a Bill on Indecent
Representation of Women by
Union Minister Smriti Irani
was taken and discussed amid
the din. The agitated
Opposition was in no mood to
relent and the upper house was
finally adjourned for the day
within 15 minutes of function.
The protesting members
did not pay heed to repeated
appeals made by Chairman M
Venkaiah Naidu and some
members stormed in the Well
of the House displaying plac-
ards and yet others raised slo-
gans forcing two adjournments
in the post-lunch session.
The unruly scenes saw
Naidu saying it was a “helpless”
situation and members were
unable to flag issues of public
concern. When Naidu called
for the members to raise their
issues in the Zero Hour,
the Opposition created a
ruckus.
The Chairman lamented
that several important issues
could not be raised.
New Delhi: Evidence is mount-
ing that the Delta variant of
coronavirus is capable of infect-
ing fully vaccinated people at a
greater rate than previous ver-
sions, and concerns have been
raised that they may even
spread the virus, experts said,
according a Reuters report.
“The biggest risk to the
world at the moment is simply
Delta,” said microbiologist
Sharon Peacock, who runs
Britain’s efforts to sequence
the genomes of coronavirus
variants, calling it the “fittest
and fastest variant yet”.
The major worry about
the Delta variant is not that it
makes people sicker, but that it
spreads far more easily from
person to person, increasing
infections and hospitalisations
among the unvaccinated.
344?0::D?A4C8Q =4F34;78
It’s the end of the road for
four-time Karnataka Chief
Minister BS Yediyurappa. BSY,
as he is popularly known,
resigned on Monday after
“negotiating” his exit with the
BJP central leadership.
The party is yet to take a deci-
sion on naming a successor to
the 78-year-old “Lingayat”
strongman.
BSY, who submitted his
resignation to Governor
Thaawarchand Gehlot at Raj
Bhavan, will continue as care-
taker Chief Minister. Karnataka
BJP Legislative Party will meet
soon to “elect” a new leader.
The BJP is pushing
younger leadership across other
States, but the
choice for the successor in
Karnataka would also be influ-
enced by the consideration of
2023 State Assembly polls,
sources said.
Union Home Minister
Amit Shah, BJP president JP
Nadda and Union Minister
Pralhad Joshi engaged in dis-
cussion in the Parliament house
soon after Yediyurappa sub-
mitted his letter of resignation
to the Governor.
BJP General Secretary and
Karnataka-in-charge Arun
Singh and Union HRD
Minister Dharmendra
Pradhan are expected to reach
the State Capital as central
observers to oversee the elec-
tion of a new leader.
Ending days of speculation
over his departure,
Yediyurappa announced his
resignation after holding days
of negotiations with beseech-
ing right political slots for his
sons BY Vijayendra, already a
State BJP vice-president, and B
Y Raghvendra, MP, and also a
“safe passage” for himself
against several pending court
cases.
His lobbying with
“Lingayat” seers did not find
favour with the top BJP lead-
ers who asked him to make an
“honourable exit”.
“Not out of grief, but with
happiness. I thank Prime
Minister Narendra Modi and
home minister Amit Shah for
allowing me to continue even
after 75 years of age. I will be
involved in party building
activities in future,” said an
emotional Yediyurappa after
submitting his letter of resig-
nation in ‘Raj Bhawan’.
“Nobody pressured me to
resigna. I did it on my own so
that someone else can take over
as CM after the completion of
two years of Government. I’ll
work to bring BJP back in
power in the next election. I’ve
not suggested the name of my
successor,” he said.
Karnataka Health and
Education Minister K
Sudhakar, who had moved to
the BJP from the Congress in
2019 at the behest of
Yediyurappa, termed his step-
ping out as “surprising”, stating
that the latter had told him that
he may receive a favourable
decision from the high com-
mand by July 26.
?C8Q C:H
Veteran paddler A Sharath
Kamal turned back the
clock to make the next round
and fencer CA Bhavani Devi
showed some spark in her
debut but India’s Olympic cam-
paign on day 3 of the compe-
titions was littered with disap-
pointments in archery, shoot-
ing, boxing and tennis.
The 39-year-old Sharath
defeated world bronze-medal-
list Tiago Polonia of Portugal,
prevailing 2-11 11-8 11-5 9-11
11-6 11-9 in 49 minutes to set
up a clash with Olympic and
world champion Ma Long from
China who is arguably the
greatest table tennis player
of all time.
But the women’s singles
campaign in the same sport
came to an end with Manika
Batra and Sutirtha Mukherjee
losing their respective prelim-
inary round matches.
Loss awaited India’s first
ever fencer in the Olympics,
CA Bhavani Devi, too.
0ah2WXTU6T]TaP[=PaPeP]T0Xa5^aRT2WXTU0Xa2WXTUPabWP[A:B1WPSPdaXP=PehEXRT2WXTUEXRT0SXaP[60bW^Z
:dPaP]S28B2EXRT0SXaP[0cd[9PX]_PhcaXQdcTc^cWTPachab^U:PaVX[FPa^]cWT^RRPbX^]^U:PaVX[EXYPh3XfPbPc
=PcX^]P[FPaT^aXP[X]=Tf3T[WX^]^]SPh ?C8
2ddR^Zk`S`cUVchRc
VdTR]ReVd'T`adZ]]VU
%6PDNHVµKRQRXUDEOH¶
H[LWKRSHVIRUVRQV¶ULVH
3URFHHGLQJV
ZDVKHGRXWDV
2SSPHPEHUV
FUHDWHEHGODP
?=BQ =4F34;78
The phone numbers of then
BSF chief KK Sharma, Joint
Director of the Enforcement
Directorate Rajeshwar Singh
and his family members, Delhi
Chief Minister Arvind
Kejriwal’s former chief consul-
tant VK Jain, two Army
Colonels and one RAW officer,
and one under secretary from
PMO too were targets of
snooping done through the
use of Pegasus spyware.
Bihar Cricket Association
Secretary and BJP leader
Rakesh Tiwary too
has found a place in the snoop-
ing list, said a report by The
Wire portal.
The leaked database also
shows that a BSF Inspector
General of Police, Jagdish
Maithani, was selected as a
potential target for surveil-
lance around the same time
along with then BSF chief KK
Sharma. ED officer Rajeshwar
Singh, who investigated many
key cases like 2G Scam and
Aircel-Maxis, had troubles with
then Finance Secretary
Hasmukh Adhia. Rajeshwar
Singh was considered in the
camp of CBI Director Alok
Verma during his tussle with
Special Director Rakesh
Asthana during 2017-2018.
The phones of Singh’s wife
and two sisters also figured in
the tapped list.
Kejriwal’s former chief con-
sultant Jain was handling key
files and was a witness in the
case of assault on then Delhi
Chief Secretary Anshu Prakash
by AAP MLAs.
!
NQRRS
?TVPbdba^fUPaTab´
XbbdTa^RZ?Pa[XPT]c
B0D60AB4=6D?C0Q :;:0C0
The Trinamool Congress
Government on Monday
formed a two-member judicial
panel to enquire into the
Pegasus phone hacking case,
Bengal Chief Minister Mamata
Banerjee said on Monday. The
judicial commission will com-
prise retired Supreme Court
Judge MB Lokur and former
Calcutta High Court Chief
Justice Jyotirmoy Bhattacharya.
“We are the first
Government to set up a judicial
commission to enquire into the
phone hacking issue,” the Chief
Minister said hours before she
flew off to Delhi where she will
meet Prime Minister Narendra
Modi on Tuesday evening.
“The situation is such that
everyone is Nazarband (under
surveillance) today,” the CM
said on the Pegasus
spyware row.
“We thought that after the
Opposition raised its voice,
the Centre will order a court-
headed enquiry into it.”
R^ReRW`c^d
[fUZTZR]aR_V]
e`Z_gVdeZXReV
AVXRdfdTRdV
:_UZR¶d[`S]Vdd_Vddd`Rcde`(%
?=BQ =4F34;78
India’s unemployment rate
stood at 7.14 per cent in the
week ending July 25, a rise of
1.16 per cent from the previous
week ending July 18, as job-
lessness increased both in
urban areas and the hinterland.
Fresh data from the Centre
for Monitoring Indian
Economy (CMIE) on Monday
showed the national joblessness
rate climbed to 7.14 per cent in
the past one week. The nation-
al joblessness rate last week
stood at 5.98 per cent. Since the
beginning of July, the unem-
ployment rate in urban India
stayed below 9 per cent while
at the national level, it
remained under 8 per cent.
However, a 7 per cent to 8
per cent unemployment rate in
an Indian labour market is high
and shows the struggle in the
job market.
The CMIE, which tracks
the labour market with pro-
prietary tools, shows that urban
unemployment continues to
be higher than that in the
rural at 8.03 per cent,
up from 7.94 per cent in the
previous week.
The rural joblessness rate
stood at 6.50 per cent, a sharp-
er rise from 5.1 per cent in the
previous week.
77YHWHUDQ6KDUDWKDGYDQFHVIHQFHU%KDYDQLPDNHVPDUN
5V]eRgRcZR_e
Z_WVTeZ_XWf]]j
gRTTZ_ReVU`_Vd
@=JA:4D+52J%652=E2==J
A0=: 2D=CAH 6;3 B8;E4A 1A=I4 CC0;
9P_P] ' !
! DB0 # #
2WX]P % $ '
# A2 # $ !
$ 6aTPc1aXcPX]
% :^aTP #
0dbcaP[XP ! %
' :^b^e^ ! !
( 8cP[h # # (
5aP]RT ! ! $
8]SXP
5ZdRaa`Z_e^V_edZ_RcTYVcjdY``eZ_XS`iZ_XR_UeV__Zd
;A?aPeX]9PSWPe0cP]d3PbP]SCPad]STT_APXSdaX]VcWTXaBdTa[h_XRb
!!`dPacTaUX]P[PcRWPVPX]bcAT_dQ[XR^U:^aTPX]C^Zh^^]^]SPh ?C8
:Pa]PcPZP21BHTSXhdaP__PSdaX]VP_a^VaPTR^T^aPcX]Vcf^hTPab^U
cWT19?6^eTa]T]cX]:Pa]PcPZPPcEXSWP]Pb^dSWPX]1T]VP[dad^]^]SPh ?C8
;^RP[bSdaX]VPR[PbWfXcW_^[XRT_Tab^]]T[Pc0bbPXi^aPQ^aSTaPc;PX[P_daX]2PRWPaSXbcaXRc^]^]SPh ?C8
3D7ViTYZVW65;e5Zc
V[cZhR]¶dW`c^VcRZUV
#T`]`_V]dd_``aVU
?=BQ 347A03D=
The State Government has
once again extended the
Covid-curfew in the State by
seven days.
The curfew which was to
end on July 27 has been extend-
ed till 6 am on August 4.
All social, political, educa-
tional, entertainment and other
large gatherings will remain
prohibited but will be allowed
with permission from the
authorised official.
Government offices will
start functioning with cent per
cent attendance. As earlier, the
market will remain open from
8 am to 9 pm.
Further, all saloons and
spas in the State will be allowed
to open and operate at 50 per
cent capacity. The night curfew
will be observed as before from
10 pm to 6 am. No other
major changes have been made
in the restrictions and relax-
ations in the previous phase of
the Covid-curfew.
4`gZUTfcWVhVieV_UVU
Sj`_V^`cVhVV
20?BD;4
58ABCD=2A4F438BB8=
=C?BB81;48=342)8BA
1T]VP[dad)CWT[Pd]RW^UcWT
UXabcD]RaTfTSXbbX^]_[P]]TS
X]3TRTQTaPb_Pac^UcWT
WdP]b_PRTU[XVWc_a^VaPT
²6PVP]hPP]³fX[[QTST[PhTSSdT
c^cWT2^eXS (X]SdRTS
SXbad_cX^]X]ST[XeTah^U
WPaSfPaTT[TT]cbU^acWT
PQXcX^dbeT]cdaT8BA
R^]UXaTS^]^]SPh
24=CA454G24;;4=24
C24D?8==4
=Tf3T[WX)CWTX]Xbcah^U
BRXT]RTP]SCTRW]^[^VhXb
bTccX]Vd_PUXabc^UXcbZX]S
2T]caT^U4gRT[[T]RT
X]cWT=^acWTPbcPRR^aSX]Vc^
P]^UUXRXP[bcPcTT]c^]
^]SPh
94403E0=243C14
2=3D2C43=2C
=Tf3T[WX)CWT9^X]c4]caP]RT
4gPX]PcX^]9440SeP]RTS
fX[[QTR^]SdRcTS^]Rc^QTa
D]X^]4SdRPcX^]X]XbcTa
3WPaT]SaP?aPSWP]
P]]^d]RTS^]^]SPh
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !#
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=CD4B30H9D;H !!! *?064B !C!
DA@CE#
=060;704A43
DC1H43E434E
m
m
H@C=5)
CD=8B80=43640B?A4I
BDB?4=3B?0A;58A4B?
I1=9µC;BC
7?5C?
6??BC
!!F9F139DI
@A:?:@?'
C74A45AB5! $
0A45AD2C85H8=6=F](https://image.slidesharecdn.com/pioneer-dehradun-english-edition-2021-07-27-210727020623/85/Pioneer-dehradun-english-edition-2021-07-27-1-320.jpg)
![347A03D=kCD4B30H k9D;H !!! ]PcX^]!
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 347A03D=
The Dehradun district
administration is all set to
commence the second phase of
the Padho Doon Badho Doon
campaign from next month
after receiving a positive report
from the third-party audit.
On January 25, the district
administration had claimed of
educating about 32,000 illiter-
ate residents under this cam-
paign and declared Dehradun
as the first district to achieve a
100 per cent literacy rate in
Uttarakhand. Those illiterates
who remained outside the dis-
trict, seriously ill or who died
during the campaign were not
included in this figure.
However, the administra-
tion decided to conduct the
audit under the District
Institute of Education and
Training (DIET) and a non-
profit organisation Room to
Read, to determine the litera-
cy level of locals taught under
this campaign. Since the
administration received a pos-
itive response from the third-
party audit, it has decided to
commence the second phase of
the campaign in August.
Chief development officer
(CDO) Nitika Khandelwal said
the overall result of all the peo-
ple who studied under the
campaign was satisfying.
According to her, all the
blocks scored over 92 per cent
in learning outcomes except
Doiwala and Chakrata which
have learning outcomes of 80
per cent.
She informed that in the
second phase of the campaign,
the administration will focus
on revision of the previous stu-
dents besides educating those
locals who came back to their
homes in the district in the last
six months.
“Education is a continuous
process that needs regular class-
es. Though many organisations
associated with the administra-
tion in this campaign continued
to teach them, it is possible that
many did not continue their
studies by reading and writing
during the Covid curfew. In the
third party audit, we found
some students who could read
but could not write properly or
could write but failed to recite
and read properly. We aim to
focus on this issue during the
second phase,” asserted
Khandelwal.
ARUY`5``_3RUY`
5``_e`cVdf^VZ_2fX
?=BQ =4FC47A8
Within about 24 hours of a
young girl being killed by a
leopard in Silla-Brahmingaon area of
Agastyamuni block in Rudraprayag
district, the big cat was shot dead by
hunter Joy Hukil authorised by the
department to kill the leopard
declared a man-eater.
The girl, aged about two years
was sitting in the courtyard of her
home on Saturday night when she
was picked up by a leopard and
killed. Local resident and Panchayat
member Sawan Negi informed the
forest department about the incident.
Action was taken at the depart-
mental level to declare the leopard as
a man-eater. The villagers traced the
girl and recovered her body at some
distance. After that the forest
department called three hunters on
the demand of the people to kill the
leopard.
The leopard revisited the village
on Sunday night and was shot by
Hukil. The injured leopard then also
tried to attack the forest department
employees after which the leopard
was shot again resulting in its death.
/HRSDUGNLOOHG
DIWHUJLUO¶V
GHDWKLQYLOODJH
?=BQ 70A83F0A
The Haridwar Roorkee Development Authority (HRDA)
has recently undertaken an initiative to not only improve
the environment but also boost public health.
HRDA Secretary Lalit Narayan Mishra said an oxygen
strip has been developed on a 2.5 kilometre stretch from
Sinh Dwar to Jatwada on which about 250 trees
have been planted.
These include trees of medicinal and environmental
importance like Peepal, banyan, Amla and Neem among
others. These trees will not only provide fresh air to the peo-
ple but also improve the environment in the city.
All the saplings have been protected with tree guards.
Mishra said authority aims to connect progressive youths
and volunteers to this initiative. Peepal trees have been given
more space on this stretch as this tree lives longer and pro-
vides fresh oxygen.
He further informed that inspired by this initiative, some
voluntary organisations are developing a patch near Daksh
Prajapati temple in Kankhal where they have planted
saplings of various species. The authority will also attempt
to encourage plantation of at least one tree of medicinal value
in each home in the city, added Mishra.
9C52af^adfa
T]VR_RZchZeY#!
ecVVd`_`ijXV_decZa
?=BQ 17D10=4BF0A
While funds of over Rs
861.96 crore would be
available under an Emergency
Covid Response Package
(ECRP) for Odisha, the State
Government has chalked out
an action plan to implement
the package in a time-bound
manner.
The Government of India
has announced the ECRP of Rs
23,123 crore for the country.
This is a Central programme
funded at the ratio of 60:40 per
cent between and the Centre
and the States.
So, out of the Rs 861.96
crore for Odisha, the Central
share will be Rs 517.18 crore
and the State share Rs 344.78
crore.
ACS Health FW, PK
Mohapatra has chalked out
the action plan for ECRP
implementation, which
involves infrastructure devel-
opment and Covid manage-
ment provisions.
Infrastructure develop-
ment includes one RTPCR lab-
oratory at a public health facil-
ity in each district. At all
District Headquarters Hospital
(DHHs), liquid medical oxygen
(LMO) facility with a medical
gas pipeline system will be in
place.
Each DHH will be provid-
ed with two Advanced Life
Support (ALS) ambulances
while one each for a Sub-
Division Hospital
and for a block will be made
available.
Covid Care Centres will be
set up at selected Primary
Health Centres (PHCs) and
Community Health Centres
(CHCs).
Steps will be taken for
strengthening the telemedi-
cine hubs at the DHHs. There
will be Paediatric Intensive
Care Units (ICUs) at
selected DHHs looking at the
requirement.
C)'#Tc`cVW`c@UZdYR¶d
4`gZUcVda`_dVaRTRXV
1SdY_^`Q^
SXQ[UT_ed
?=BQ 909?DA
Rakesh, a young painter
from Jajpur, recently
created half-centimeter-tall
idols of Lord Jagannath,
Lord Balabhadra and Devi
Subhadra out of
lemon wood. Earlier, he
had made a 2-inch-tall
Shiva statue and currently
is building a 3.5-cm-tall
Buddha statue. He expects
to earn a world record for
his mineature art.
Rakesh is son of
Chakradhar Patra of
Nathsahi village under
Nathsahi panchayat in
Jajpur block.
He was interested in
painting since childhood.
He wanted to make all sorts
of tiny images afterwards.
;R[afc]RUVjVdh`c]U
cVT`cUW`ceZ_jZU`]d
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Saturday directed the officers
concerned to increase the num-
ber of procurement centres
for Kharif season so as to
ensure hassle-free procure-
ment.
Presiding over a review
meeting regarding planning
for Kharif season 2021-22 held
here in which Deputy Chief
Minister Dushyant Chautala
was also present, the Chief
Minister while directing the
officers concerned regarding
making procurement schedul-
ing plans for farmers said that
along with strengthening the
Mandi system and increasing
the number of Centres if
required, timely
arrangements for the availabil-
ity of labourers, ensure an ade-
quate number of weighing
scales, gunny bags, sewing
machines, etc. in the Mandis
should also be ensured.
Khattar was apprised that
for the Kharif season 2020-21
as many as 198 Mandis for
Paddy, 23 for Moong, 19 for
Maize and 7 for groundnut
have been established.
He was informed that dur-
ing Kharif procurement 2020-
21 around 56.54 LMT Paddy
has been procured, while
1099.65 MT Moong has been
procured, 4016.55 MT Maize
has been procured and 650.36
MT groundnut has been pro-
cured.
9RcjR_R4TYRZcdcVgZVh^VVeW`cYRcZWdVRd`_
?=BQ 270=3860A7
Haryana Governor Bandaru
Dattatreya and Chief
Minister Manohar Lal Khattar
on Monday paid homage to the
soldiers who made the supreme
sacrifice in the 1999 Kargil war.
They said the nation will always
be indebted to the soldiers who
sacrificed their lives for the
country. Dattatreya and Khattar
paid tributes to the valiant sol-
diers who gave a befitting reply
to the Pakistani armed forces
that had intruded in Kargil,
Drass and Batalik areas in July
1999. The governor said during
the Kargil war, more than 100
sons of Haryana had attained
martyrdom.
Noting that more than 10
per cent soldiers in the Indian
Army are from Haryana,
Dattatreya, the former governor
of Himachal Pradesh, said ear-
lier he had got a chance to serve
“Dev Bhoomi” (HP) before his
appointment as governor of the
“VeerBhoomi”(Haryana).“This
shows the spirit of patriotism
which is filled in every youth of
Haryana,” he said.
Khattar,whileremembering
the Kargil martyrs, said the sac-
rifice made by the brave sons of
the soil will always inspire the
future generations. “The sacri-
fice, courage and dedication of
oursoldiersintheKargilwarcan
never be forgotten,” he said.
PUNJAB CM PAYS
HOMAGE, EXHORTS
YOUTH TO JOIN ARMED
FORCES
With a call to youth to join
the Armed Forces to serve the
nation, Punjab Chief Minister
Capt Amarinder Singh on
Monday paid homage to the
martyrs of the Kargil war.
On the 22nd anniversary of
Kargil War, the Chief Minister
laid a wreath at the War
Memorial at the Bougainvillea
GardeninChandigarh.Hesalut-
ed the 54 brave sons of Punjab
who laid their lives during the
Kargil Operations.
Remembering their sacri-
fices on the Kargil Vijay Divas,
CaptAmarinderpaidtributesto
the valiant Indian soldiers who
braved the harsh weather to give
a befitting reply to the Pakistani
armed forces that had intruded
in Kargil, Drass, and Batalik
areas in July 1999.
During a brief interaction
with the young NCC Cadets
and Lady Cadets of Mai Bhago
Armed Forces Preparatory
Institute, Capt Amarinder
exhorted them to join the
armed forces to uphold the
country’s sovereignty and
integrity.
.DUJLO9LMD'LZDV+DUDQD*RYHUQRU
0SDWULEXWHVWRZDUKHURHV
?=BQ 270=3860A7
With only 5.35 percent pop-
ulation fully vaccinated so
far, Punjab Government on
Monday once again urged the
Centre to ramp up the vaccine
supply.
To stem the rise in the
number of coronavirus infec-
tions in the near future, vacci-
nation drive in the State needs
more push although figure of
people with both doses of vac-
cine in Punjab stands at just 5.35
percent, said the state Health
and Family Welfare Minister
Balbir Singh Sidhu on Monday.
He said that Punjab has
been able to vaccinate 94,79,351
persons, out of which 77,16,433
have received the first dose and
17,62,918 have completed their
vaccination with two doses.
Sidhu pointed out that
Punjab has been receiving less
supply of vaccines.
“I have urged the Central
Government many times to
expedite the vaccine supply so
that the State Government can
safeguard its population by vac-
cinating them with both doses
of vaccine,” he said.
The Minister said that
presently, the figure of people
with both doses of
vaccine in Punjab stands at just
5.35 percent.
?^i%#%
_V@e^ZQRVei
fQSSY^QdUT
?=BQ B78;0
Himachal Chief Minister Jai
Ram Thakur on Monday
presided over the Kargil Vijay
Diwas function at Gaiety
Theatre, Shimla and paid trib-
ute to the martyrs of Kargil War.
He said that the Kargil war was
a symbol of valour and bravery
of the Indian soldiers and on
this day of Kargil Vijay Diwas
we salute the brave soldiers of
our armed forces. He said this
victory saga was written 22
years ago at the peaks of Kargil
and would be motivating the
generation to come. He said that
in 1999 after the Pakistani
intruders infiltrated the Indian
peaks, the Indian soldiers initi-
ated Operation Vijay against
them on 8th May, which went
on till 26th July, 1999.
Thakur said that out of 527
soldiers martyred during Kargil
War, 52 martyrs were from
Himachal Pradesh and out of
four Param Vir Chakra winners
two were from the State.
Captain Vikram Batra was one
such braveheart from
Himachal Pradesh’s Palampur,
who sacrificed his life for the
country. He said that Hawaldar
Sanjay Kumar of District
Bilaspur was also honoured
with Param Vir Chakar, for his
gallantry during Kargil War.
He said that it was a mat-
ter of great pride for Himachal
Pradesh that till date the state
has received 1096 gallantry
awards and 1246 soldiers of the
state have made supreme sac-
rifice for the country.
He also honoured the fam-
ily members of Kargil war
martyrs. Artists of Information
and Public Relations
Department sang patriotic
songs and documentary was
also showcased on this occa-
sion. MP Shimla Parliamentary
Constituency Suresh Kashyap,
Mayor Municipal Corporation
Shimla Satya Kaundal, Deputy
Mayor Shailender Chauhan,
Former MP Vimla Kashyap,
Chairman HIMFED Ganesh
Dutt, Chairperson Saksham
Gudiya Board Roopa Sharma,
Chairman APMC Naresh
Sharma, Chief Secretary Anil
Khachi, Deputy Commissioner
Aaditya Negi, Superintendent
of Police Mohit Chawala,
Brigadier R. Sihag, Brigadier
A.K. Sharma, Colonel Yudhvir
Singh, Colonel Vikram Jeet
Singh were also present on the
occasion.
9Z^RTYR]4aRjd
ecZSfeVe`^Rcejcd
`WRcXZ]HRc
E890H34970Q A0=278
Ranchi police have consti-
tuted four special teams
headed by Ranchi DSP (Sadar)
to investigate sensational case
of alleged attempt to topple the
Hemant Soren led
Government and one team is
set to visit Delhi and another
to Mumbai to conduct inves-
tigation.
Police arrested three sus-
pects namely Amit Singh,
Nivaran Prasad Mahto and
Abhishek Kumar
Dubey on
Friday night
from Hotel
Le Lac
Sarovar in
Ranchi. But,
given their non-
descript back-
ground the BJP
came quick to outright-
ly reject that accused can act
even as pimps in the power
portal.
They are accused of col-
laborating with two of the
Maharashtra based BJP politi-
cians Chandrashekhar Rao
Babankule and Charan Singh
and some financers to bribe
Congress MLAs to destabilize
the Hemant Soren led JMM-
Congress-RJD government.
The Congress has 16
MLAs in Jharkhand and four
of them are ministers in the
alliance government.
Police claim that the
accused had gone to Delhi
along with two of the Congress
MLAs Irfan Ansari and
Umashankar Akela and inde-
pendent MLA Amit Yadav.
Police said that meetings of
these MLAs with some of the
top BJP leaders were arranged.
Police claimed that there is a
high level conspiracy to pull
down the government by
defecting as many as 11
Congress MLAs and if police
is believed eight Congress
MLAs are in the regular touch.
It may or may not be a
coincidence that police arrest-
ed them on a written com-
plaint of one
of the
C o n g r e s s
M L A
Jai m ang a l
Singh, who
claimed that a
conspiracy is going
on to break MLAs of
ruling alliance.
Another Congress
MLA Naman Bixal
Kongari too revealed
that once he was also contact-
ed with a big offer which he
flatly denied.
Amid unverified confes-
sions and claims; integrity,
political and personal reputa-
tions of Congress MLAs —
other than its four ministers,
Singh and Kongari — has
come under question and
Central and State leadership
are silent on the matter.
Leadership has not woken-
up to smash narratives and
apparently not realised that the
damage of the party is beyond
surfeits of memes and jokes, as
the Congress in Jharkhand is
being dubbed as a disorderly
house, untrustworthy bedfel-
low where MLAs are ready for
auction.
0CC4?CCC??;49´:70=36EC
?^[XRTcTPb
[TPeTU^a
3T[WXdQPX
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7)
Recommended
Recommended
More Related Content
What's hot
What's hot (20)
Similar to Pioneer dehradun-english-edition-2021-07-27
Similar to Pioneer dehradun-english-edition-2021-07-27 (20)
More from DunEditorial
More from DunEditorial (20)
Recently uploaded
Recently uploaded (20)
Pioneer dehradun-english-edition-2021-07-27
- 1. ?=B?C8Q 6DF070C808I0F; In a major flare-up at the Mizoram-Assam border, at least six Assam Police officials were killed and 50 others, including an SP, were injured in a sudden escalation of the sim- mering border dispute between the two States. The two Chief Ministers blamed each other’s police for the violence and sought the Centre’s intervention. Union Home Minister Amit Shah spoke to the Chief Ministers of Assam and Mizoram, Himanta Biswa Sarma and Zoramthanga respectively, and urged them to ensure peace along the disput- ed border and find an amica- ble settlement. Assam’s Barak Valley dis- tricts of Cachar, Karimganj and Hailakandi share a 164 km long border with Mizoram’s three districts of Aizawl, Kolasib and Mamit. This is third time in less than two years that violence has erupted following the territor- ial dispute. There inter-State border dispute saw violence in August 2020 and February this year also. The Assam Chief Minister announced on Twitter that six personnel of the Assam Police were killed in firing by “miscreants” from Mizoram along the inter-State border in the Cachar district. “I am deeply pained to inform that six brave jawans of @assampolice have sacrificed their lives while defending the constitutional boundary of our State at the Assam-Mizoram border. My heartfelt condo- lences to the bereaved families,” Sarma tweeted. While the Assam CM put the blame on miscreants, Mizoram Home Minister Lalchamliana, in a statement, said Mizoram Police respond- ed “spontaneously by firing back” at Assam Police after its 200 personnel forcibly crossed a duty post manned by the CRPF personnel and indulged in arson, assault on unarmed persons and firing. A senior Assam Police offi- cer, who is still inside the for- est amid continuous firing from across the State border, told PTI that at least 50 per- sonnel, including Cachar Superintendent of Police Nimbalkar Vaibhav Chandrakant, were injured in firing and stone-pelting. The senior police officer said miscreants from across the State border suddenly started firing when civil officials of both sides were trying to sort out the differences. “I immediately cannot say how many people have been injured, but my guess is at least 50 personnel. Our SP was also injured in the firing and a bul- let hit his leg,” he said over phone. ?=BQ =4F34;78 Parliament could not func- tion once again on Monday amid noisy protests by Opposition members who raised slogans and showed placards on the Pegasus snoop- ing row and farmers’ issue. The Rajya Sabha witnessed several adjournments and car- ried no business where as the Lok Sabha was adjourned for the day after passage of two bills without discussion. The pre-lunch session in the Rajya Sabha saw two adjournments and it was the same in the after- noon session also. The Upper House assem- bled at 2 pm and adjourned within minutes to reassemble at 3 pm which too got adjourned to meet again at 4 pm after which a Bill on Indecent Representation of Women by Union Minister Smriti Irani was taken and discussed amid the din. The agitated Opposition was in no mood to relent and the upper house was finally adjourned for the day within 15 minutes of function. The protesting members did not pay heed to repeated appeals made by Chairman M Venkaiah Naidu and some members stormed in the Well of the House displaying plac- ards and yet others raised slo- gans forcing two adjournments in the post-lunch session. The unruly scenes saw Naidu saying it was a “helpless” situation and members were unable to flag issues of public concern. When Naidu called for the members to raise their issues in the Zero Hour, the Opposition created a ruckus. The Chairman lamented that several important issues could not be raised. New Delhi: Evidence is mount- ing that the Delta variant of coronavirus is capable of infect- ing fully vaccinated people at a greater rate than previous ver- sions, and concerns have been raised that they may even spread the virus, experts said, according a Reuters report. “The biggest risk to the world at the moment is simply Delta,” said microbiologist Sharon Peacock, who runs Britain’s efforts to sequence the genomes of coronavirus variants, calling it the “fittest and fastest variant yet”. The major worry about the Delta variant is not that it makes people sicker, but that it spreads far more easily from person to person, increasing infections and hospitalisations among the unvaccinated. 344?0::D?A4C8Q =4F34;78 It’s the end of the road for four-time Karnataka Chief Minister BS Yediyurappa. BSY, as he is popularly known, resigned on Monday after “negotiating” his exit with the BJP central leadership. The party is yet to take a deci- sion on naming a successor to the 78-year-old “Lingayat” strongman. BSY, who submitted his resignation to Governor Thaawarchand Gehlot at Raj Bhavan, will continue as care- taker Chief Minister. Karnataka BJP Legislative Party will meet soon to “elect” a new leader. The BJP is pushing younger leadership across other States, but the choice for the successor in Karnataka would also be influ- enced by the consideration of 2023 State Assembly polls, sources said. Union Home Minister Amit Shah, BJP president JP Nadda and Union Minister Pralhad Joshi engaged in dis- cussion in the Parliament house soon after Yediyurappa sub- mitted his letter of resignation to the Governor. BJP General Secretary and Karnataka-in-charge Arun Singh and Union HRD Minister Dharmendra Pradhan are expected to reach the State Capital as central observers to oversee the elec- tion of a new leader. Ending days of speculation over his departure, Yediyurappa announced his resignation after holding days of negotiations with beseech- ing right political slots for his sons BY Vijayendra, already a State BJP vice-president, and B Y Raghvendra, MP, and also a “safe passage” for himself against several pending court cases. His lobbying with “Lingayat” seers did not find favour with the top BJP lead- ers who asked him to make an “honourable exit”. “Not out of grief, but with happiness. I thank Prime Minister Narendra Modi and home minister Amit Shah for allowing me to continue even after 75 years of age. I will be involved in party building activities in future,” said an emotional Yediyurappa after submitting his letter of resig- nation in ‘Raj Bhawan’. “Nobody pressured me to resigna. I did it on my own so that someone else can take over as CM after the completion of two years of Government. I’ll work to bring BJP back in power in the next election. I’ve not suggested the name of my successor,” he said. Karnataka Health and Education Minister K Sudhakar, who had moved to the BJP from the Congress in 2019 at the behest of Yediyurappa, termed his step- ping out as “surprising”, stating that the latter had told him that he may receive a favourable decision from the high com- mand by July 26. ?C8Q C:H Veteran paddler A Sharath Kamal turned back the clock to make the next round and fencer CA Bhavani Devi showed some spark in her debut but India’s Olympic cam- paign on day 3 of the compe- titions was littered with disap- pointments in archery, shoot- ing, boxing and tennis. The 39-year-old Sharath defeated world bronze-medal- list Tiago Polonia of Portugal, prevailing 2-11 11-8 11-5 9-11 11-6 11-9 in 49 minutes to set up a clash with Olympic and world champion Ma Long from China who is arguably the greatest table tennis player of all time. But the women’s singles campaign in the same sport came to an end with Manika Batra and Sutirtha Mukherjee losing their respective prelim- inary round matches. Loss awaited India’s first ever fencer in the Olympics, CA Bhavani Devi, too. 0ah2WXTU6T]TaP[=PaPeP]T0Xa5^aRT2WXTU0Xa2WXTUPabWP[A:B1WPSPdaXP=PehEXRT2WXTUEXRT0SXaP[60bW^Z :dPaP]S28B2EXRT0SXaP[0cd[9PX]_PhcaXQdcTc^cWTPachab^U:PaVX[FPa^]cWT^RRPbX^]^U:PaVX[EXYPh3XfPbPc =PcX^]P[FPaT^aXP[X]=Tf3T[WX^]^]SPh ?C8 2ddR^Zk`S`cUVchRc VdTR]ReVd'T`adZ]]VU %6PDNHVµKRQRXUDEOH¶ H[LWKRSHVIRUVRQV¶ULVH 3URFHHGLQJV ZDVKHGRXWDV 2SSPHPEHUV FUHDWHEHGODP ?=BQ =4F34;78 The phone numbers of then BSF chief KK Sharma, Joint Director of the Enforcement Directorate Rajeshwar Singh and his family members, Delhi Chief Minister Arvind Kejriwal’s former chief consul- tant VK Jain, two Army Colonels and one RAW officer, and one under secretary from PMO too were targets of snooping done through the use of Pegasus spyware. Bihar Cricket Association Secretary and BJP leader Rakesh Tiwary too has found a place in the snoop- ing list, said a report by The Wire portal. The leaked database also shows that a BSF Inspector General of Police, Jagdish Maithani, was selected as a potential target for surveil- lance around the same time along with then BSF chief KK Sharma. ED officer Rajeshwar Singh, who investigated many key cases like 2G Scam and Aircel-Maxis, had troubles with then Finance Secretary Hasmukh Adhia. Rajeshwar Singh was considered in the camp of CBI Director Alok Verma during his tussle with Special Director Rakesh Asthana during 2017-2018. The phones of Singh’s wife and two sisters also figured in the tapped list. Kejriwal’s former chief con- sultant Jain was handling key files and was a witness in the case of assault on then Delhi Chief Secretary Anshu Prakash by AAP MLAs. ! NQRRS ?TVPbdba^fUPaTab´ XbbdTa^RZ?Pa[XPT]c B0D60AB4=6D?C0Q :;:0C0 The Trinamool Congress Government on Monday formed a two-member judicial panel to enquire into the Pegasus phone hacking case, Bengal Chief Minister Mamata Banerjee said on Monday. The judicial commission will com- prise retired Supreme Court Judge MB Lokur and former Calcutta High Court Chief Justice Jyotirmoy Bhattacharya. “We are the first Government to set up a judicial commission to enquire into the phone hacking issue,” the Chief Minister said hours before she flew off to Delhi where she will meet Prime Minister Narendra Modi on Tuesday evening. “The situation is such that everyone is Nazarband (under surveillance) today,” the CM said on the Pegasus spyware row. “We thought that after the Opposition raised its voice, the Centre will order a court- headed enquiry into it.” R^ReRW`c^d [fUZTZR]aR_V] e`Z_gVdeZXReV AVXRdfdTRdV :_UZR¶d[`S]Vdd_Vddd`Rcde`(% ?=BQ =4F34;78 India’s unemployment rate stood at 7.14 per cent in the week ending July 25, a rise of 1.16 per cent from the previous week ending July 18, as job- lessness increased both in urban areas and the hinterland. Fresh data from the Centre for Monitoring Indian Economy (CMIE) on Monday showed the national joblessness rate climbed to 7.14 per cent in the past one week. The nation- al joblessness rate last week stood at 5.98 per cent. Since the beginning of July, the unem- ployment rate in urban India stayed below 9 per cent while at the national level, it remained under 8 per cent. However, a 7 per cent to 8 per cent unemployment rate in an Indian labour market is high and shows the struggle in the job market. The CMIE, which tracks the labour market with pro- prietary tools, shows that urban unemployment continues to be higher than that in the rural at 8.03 per cent, up from 7.94 per cent in the previous week. The rural joblessness rate stood at 6.50 per cent, a sharp- er rise from 5.1 per cent in the previous week. 77YHWHUDQ6KDUDWKDGYDQFHVIHQFHU%KDYDQLPDNHVPDUN 5V]eRgRcZR_e Z_WVTeZ_XWf]]j gRTTZ_ReVU`_Vd @=JA:4D+52J%652=E2==J A0=: 2D=CAH 6;3 B8;E4A 1A=I4 CC0; 9P_P] ' ! ! DB0 # # 2WX]P % $ ' # A2 # $ ! $ 6aTPc1aXcPX] % :^aTP # 0dbcaP[XP ! % ' :^b^e^ ! ! ( 8cP[h # # ( 5aP]RT ! ! $ 8]SXP 5ZdRaa`Z_e^V_edZ_RcTYVcjdY``eZ_XS`iZ_XR_UeV__Zd ;A?aPeX]9PSWPe0cP]d3PbP]SCPad]STT_APXSdaX]VcWTXaBdTa[h_XRb !!`dPacTaUX]P[PcRWPVPX]bcAT_dQ[XR^U:^aTPX]C^Zh^^]^]SPh ?C8 :Pa]PcPZP21BHTSXhdaP__PSdaX]VP_a^VaPTR^T^aPcX]Vcf^hTPab^U cWT19?6^eTa]T]cX]:Pa]PcPZPPcEXSWP]Pb^dSWPX]1T]VP[dad^]^]SPh ?C8 ;^RP[bSdaX]VPR[PbWfXcW_^[XRT_Tab^]]T[Pc0bbPXi^aPQ^aSTaPc;PX[P_daX]2PRWPaSXbcaXRc^]^]SPh ?C8 3D7ViTYZVW65;e5Zc V[cZhR]¶dW`c^VcRZUV #T`]`_V]dd_``aVU ?=BQ 347A03D= The State Government has once again extended the Covid-curfew in the State by seven days. The curfew which was to end on July 27 has been extend- ed till 6 am on August 4. All social, political, educa- tional, entertainment and other large gatherings will remain prohibited but will be allowed with permission from the authorised official. Government offices will start functioning with cent per cent attendance. As earlier, the market will remain open from 8 am to 9 pm. Further, all saloons and spas in the State will be allowed to open and operate at 50 per cent capacity. The night curfew will be observed as before from 10 pm to 6 am. No other major changes have been made in the restrictions and relax- ations in the previous phase of the Covid-curfew. 4`gZUTfcWVhVieV_UVU Sj`_V^`cVhVV 20?BD;4 58ABCD=2A4F438BB8= =C?BB81;48=342)8BA 1T]VP[dad)CWT[Pd]RW^UcWT UXabcD]RaTfTSXbbX^]_[P]]TS X]3TRTQTaPb_Pac^UcWT WdP]b_PRTU[XVWc_a^VaPT ²6PVP]hPP]³fX[[QTST[PhTSSdT c^cWT2^eXS (X]SdRTS SXbad_cX^]X]ST[XeTah^U WPaSfPaTT[TT]cbU^acWT PQXcX^dbeT]cdaT8BA R^]UXaTS^]^]SPh 24=CA454G24;;4=24 C24D?8==4 =Tf3T[WX)CWTX]Xbcah^U BRXT]RTP]SCTRW]^[^VhXb bTccX]Vd_PUXabc^UXcbZX]S 2T]caT^U4gRT[[T]RT X]cWT=^acWTPbcPRR^aSX]Vc^ P]^UUXRXP[bcPcTT]c^] ^]SPh 94403E0=243C14 2=3D2C43=2C =Tf3T[WX)CWT9^X]c4]caP]RT 4gPX]PcX^]9440SeP]RTS fX[[QTR^]SdRcTS^]Rc^QTa D]X^]4SdRPcX^]X]XbcTa 3WPaT]SaP?aPSWP] P]]^d]RTS^]^]SPh /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $ 8bbdT !# 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D=CD4B30H9D;H !!! *?064B !C! DA@CE# =060;704A43 DC1H43E434E m m H@C=5) CD=8B80=43640B?A4I BDB?4=3B?0A;58A4B? I1=9µC;BC 7?5C? 6??BC !!F9F139DI @A:?:@?' C74A45AB5! $ 0A45AD2C85H8=6=F
- 2. 347A03D=kCD4B30H k9D;H !!! ]PcX^]! $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV ?=BQ 347A03D= The Dehradun district administration is all set to commence the second phase of the Padho Doon Badho Doon campaign from next month after receiving a positive report from the third-party audit. On January 25, the district administration had claimed of educating about 32,000 illiter- ate residents under this cam- paign and declared Dehradun as the first district to achieve a 100 per cent literacy rate in Uttarakhand. Those illiterates who remained outside the dis- trict, seriously ill or who died during the campaign were not included in this figure. However, the administra- tion decided to conduct the audit under the District Institute of Education and Training (DIET) and a non- profit organisation Room to Read, to determine the litera- cy level of locals taught under this campaign. Since the administration received a pos- itive response from the third- party audit, it has decided to commence the second phase of the campaign in August. Chief development officer (CDO) Nitika Khandelwal said the overall result of all the peo- ple who studied under the campaign was satisfying. According to her, all the blocks scored over 92 per cent in learning outcomes except Doiwala and Chakrata which have learning outcomes of 80 per cent. She informed that in the second phase of the campaign, the administration will focus on revision of the previous stu- dents besides educating those locals who came back to their homes in the district in the last six months. “Education is a continuous process that needs regular class- es. Though many organisations associated with the administra- tion in this campaign continued to teach them, it is possible that many did not continue their studies by reading and writing during the Covid curfew. In the third party audit, we found some students who could read but could not write properly or could write but failed to recite and read properly. We aim to focus on this issue during the second phase,” asserted Khandelwal. ARUY`5``_3RUY` 5``_e`cVdf^VZ_2fX ?=BQ =4FC47A8 Within about 24 hours of a young girl being killed by a leopard in Silla-Brahmingaon area of Agastyamuni block in Rudraprayag district, the big cat was shot dead by hunter Joy Hukil authorised by the department to kill the leopard declared a man-eater. The girl, aged about two years was sitting in the courtyard of her home on Saturday night when she was picked up by a leopard and killed. Local resident and Panchayat member Sawan Negi informed the forest department about the incident. Action was taken at the depart- mental level to declare the leopard as a man-eater. The villagers traced the girl and recovered her body at some distance. After that the forest department called three hunters on the demand of the people to kill the leopard. The leopard revisited the village on Sunday night and was shot by Hukil. The injured leopard then also tried to attack the forest department employees after which the leopard was shot again resulting in its death. /HRSDUGNLOOHG DIWHUJLUO¶V GHDWKLQYLOODJH ?=BQ 70A83F0A The Haridwar Roorkee Development Authority (HRDA) has recently undertaken an initiative to not only improve the environment but also boost public health. HRDA Secretary Lalit Narayan Mishra said an oxygen strip has been developed on a 2.5 kilometre stretch from Sinh Dwar to Jatwada on which about 250 trees have been planted. These include trees of medicinal and environmental importance like Peepal, banyan, Amla and Neem among others. These trees will not only provide fresh air to the peo- ple but also improve the environment in the city. All the saplings have been protected with tree guards. Mishra said authority aims to connect progressive youths and volunteers to this initiative. Peepal trees have been given more space on this stretch as this tree lives longer and pro- vides fresh oxygen. He further informed that inspired by this initiative, some voluntary organisations are developing a patch near Daksh Prajapati temple in Kankhal where they have planted saplings of various species. The authority will also attempt to encourage plantation of at least one tree of medicinal value in each home in the city, added Mishra. 9C52af^adfa T]VR_RZchZeY#! ecVVd`_`ijXV_decZa ?=BQ 17D10=4BF0A While funds of over Rs 861.96 crore would be available under an Emergency Covid Response Package (ECRP) for Odisha, the State Government has chalked out an action plan to implement the package in a time-bound manner. The Government of India has announced the ECRP of Rs 23,123 crore for the country. This is a Central programme funded at the ratio of 60:40 per cent between and the Centre and the States. So, out of the Rs 861.96 crore for Odisha, the Central share will be Rs 517.18 crore and the State share Rs 344.78 crore. ACS Health FW, PK Mohapatra has chalked out the action plan for ECRP implementation, which involves infrastructure devel- opment and Covid manage- ment provisions. Infrastructure develop- ment includes one RTPCR lab- oratory at a public health facil- ity in each district. At all District Headquarters Hospital (DHHs), liquid medical oxygen (LMO) facility with a medical gas pipeline system will be in place. Each DHH will be provid- ed with two Advanced Life Support (ALS) ambulances while one each for a Sub- Division Hospital and for a block will be made available. Covid Care Centres will be set up at selected Primary Health Centres (PHCs) and Community Health Centres (CHCs). Steps will be taken for strengthening the telemedi- cine hubs at the DHHs. There will be Paediatric Intensive Care Units (ICUs) at selected DHHs looking at the requirement. C)'#Tc`cVW`c@UZdYR¶d 4`gZUcVda`_dVaRTRXV 1SdY_^`Q^ SXQ[UT_ed ?=BQ 909?DA Rakesh, a young painter from Jajpur, recently created half-centimeter-tall idols of Lord Jagannath, Lord Balabhadra and Devi Subhadra out of lemon wood. Earlier, he had made a 2-inch-tall Shiva statue and currently is building a 3.5-cm-tall Buddha statue. He expects to earn a world record for his mineature art. Rakesh is son of Chakradhar Patra of Nathsahi village under Nathsahi panchayat in Jajpur block. He was interested in painting since childhood. He wanted to make all sorts of tiny images afterwards. ;R[afc]RUVjVdh`c]U cVT`cUW`ceZ_jZU`]d ?=BQ 270=3860A7 Haryana Chief Minister Manohar Lal Khattar on Saturday directed the officers concerned to increase the num- ber of procurement centres for Kharif season so as to ensure hassle-free procure- ment. Presiding over a review meeting regarding planning for Kharif season 2021-22 held here in which Deputy Chief Minister Dushyant Chautala was also present, the Chief Minister while directing the officers concerned regarding making procurement schedul- ing plans for farmers said that along with strengthening the Mandi system and increasing the number of Centres if required, timely arrangements for the availabil- ity of labourers, ensure an ade- quate number of weighing scales, gunny bags, sewing machines, etc. in the Mandis should also be ensured. Khattar was apprised that for the Kharif season 2020-21 as many as 198 Mandis for Paddy, 23 for Moong, 19 for Maize and 7 for groundnut have been established. He was informed that dur- ing Kharif procurement 2020- 21 around 56.54 LMT Paddy has been procured, while 1099.65 MT Moong has been procured, 4016.55 MT Maize has been procured and 650.36 MT groundnut has been pro- cured. 9RcjR_R4TYRZcdcVgZVh^VVeW`cYRcZWdVRd`_ ?=BQ 270=3860A7 Haryana Governor Bandaru Dattatreya and Chief Minister Manohar Lal Khattar on Monday paid homage to the soldiers who made the supreme sacrifice in the 1999 Kargil war. They said the nation will always be indebted to the soldiers who sacrificed their lives for the country. Dattatreya and Khattar paid tributes to the valiant sol- diers who gave a befitting reply to the Pakistani armed forces that had intruded in Kargil, Drass and Batalik areas in July 1999. The governor said during the Kargil war, more than 100 sons of Haryana had attained martyrdom. Noting that more than 10 per cent soldiers in the Indian Army are from Haryana, Dattatreya, the former governor of Himachal Pradesh, said ear- lier he had got a chance to serve “Dev Bhoomi” (HP) before his appointment as governor of the “VeerBhoomi”(Haryana).“This shows the spirit of patriotism which is filled in every youth of Haryana,” he said. Khattar,whileremembering the Kargil martyrs, said the sac- rifice made by the brave sons of the soil will always inspire the future generations. “The sacri- fice, courage and dedication of oursoldiersintheKargilwarcan never be forgotten,” he said. PUNJAB CM PAYS HOMAGE, EXHORTS YOUTH TO JOIN ARMED FORCES With a call to youth to join the Armed Forces to serve the nation, Punjab Chief Minister Capt Amarinder Singh on Monday paid homage to the martyrs of the Kargil war. On the 22nd anniversary of Kargil War, the Chief Minister laid a wreath at the War Memorial at the Bougainvillea GardeninChandigarh.Hesalut- ed the 54 brave sons of Punjab who laid their lives during the Kargil Operations. Remembering their sacri- fices on the Kargil Vijay Divas, CaptAmarinderpaidtributesto the valiant Indian soldiers who braved the harsh weather to give a befitting reply to the Pakistani armed forces that had intruded in Kargil, Drass, and Batalik areas in July 1999. During a brief interaction with the young NCC Cadets and Lady Cadets of Mai Bhago Armed Forces Preparatory Institute, Capt Amarinder exhorted them to join the armed forces to uphold the country’s sovereignty and integrity. .DUJLO9LMD'LZDV+DUDQD*RYHUQRU 0SDWULEXWHVWRZDUKHURHV ?=BQ 270=3860A7 With only 5.35 percent pop- ulation fully vaccinated so far, Punjab Government on Monday once again urged the Centre to ramp up the vaccine supply. To stem the rise in the number of coronavirus infec- tions in the near future, vacci- nation drive in the State needs more push although figure of people with both doses of vac- cine in Punjab stands at just 5.35 percent, said the state Health and Family Welfare Minister Balbir Singh Sidhu on Monday. He said that Punjab has been able to vaccinate 94,79,351 persons, out of which 77,16,433 have received the first dose and 17,62,918 have completed their vaccination with two doses. Sidhu pointed out that Punjab has been receiving less supply of vaccines. “I have urged the Central Government many times to expedite the vaccine supply so that the State Government can safeguard its population by vac- cinating them with both doses of vaccine,” he said. The Minister said that presently, the figure of people with both doses of vaccine in Punjab stands at just 5.35 percent. ?^i%#% _V@e^ZQRVei fQSSY^QdUT ?=BQ B78;0 Himachal Chief Minister Jai Ram Thakur on Monday presided over the Kargil Vijay Diwas function at Gaiety Theatre, Shimla and paid trib- ute to the martyrs of Kargil War. He said that the Kargil war was a symbol of valour and bravery of the Indian soldiers and on this day of Kargil Vijay Diwas we salute the brave soldiers of our armed forces. He said this victory saga was written 22 years ago at the peaks of Kargil and would be motivating the generation to come. He said that in 1999 after the Pakistani intruders infiltrated the Indian peaks, the Indian soldiers initi- ated Operation Vijay against them on 8th May, which went on till 26th July, 1999. Thakur said that out of 527 soldiers martyred during Kargil War, 52 martyrs were from Himachal Pradesh and out of four Param Vir Chakra winners two were from the State. Captain Vikram Batra was one such braveheart from Himachal Pradesh’s Palampur, who sacrificed his life for the country. He said that Hawaldar Sanjay Kumar of District Bilaspur was also honoured with Param Vir Chakar, for his gallantry during Kargil War. He said that it was a mat- ter of great pride for Himachal Pradesh that till date the state has received 1096 gallantry awards and 1246 soldiers of the state have made supreme sac- rifice for the country. He also honoured the fam- ily members of Kargil war martyrs. Artists of Information and Public Relations Department sang patriotic songs and documentary was also showcased on this occa- sion. MP Shimla Parliamentary Constituency Suresh Kashyap, Mayor Municipal Corporation Shimla Satya Kaundal, Deputy Mayor Shailender Chauhan, Former MP Vimla Kashyap, Chairman HIMFED Ganesh Dutt, Chairperson Saksham Gudiya Board Roopa Sharma, Chairman APMC Naresh Sharma, Chief Secretary Anil Khachi, Deputy Commissioner Aaditya Negi, Superintendent of Police Mohit Chawala, Brigadier R. Sihag, Brigadier A.K. Sharma, Colonel Yudhvir Singh, Colonel Vikram Jeet Singh were also present on the occasion. 9Z^RTYR]4aRjd ecZSfeVe`^Rcejcd `WRcXZ]HRc E890H34970Q A0=278 Ranchi police have consti- tuted four special teams headed by Ranchi DSP (Sadar) to investigate sensational case of alleged attempt to topple the Hemant Soren led Government and one team is set to visit Delhi and another to Mumbai to conduct inves- tigation. Police arrested three sus- pects namely Amit Singh, Nivaran Prasad Mahto and Abhishek Kumar Dubey on Friday night from Hotel Le Lac Sarovar in Ranchi. But, given their non- descript back- ground the BJP came quick to outright- ly reject that accused can act even as pimps in the power portal. They are accused of col- laborating with two of the Maharashtra based BJP politi- cians Chandrashekhar Rao Babankule and Charan Singh and some financers to bribe Congress MLAs to destabilize the Hemant Soren led JMM- Congress-RJD government. The Congress has 16 MLAs in Jharkhand and four of them are ministers in the alliance government. Police claim that the accused had gone to Delhi along with two of the Congress MLAs Irfan Ansari and Umashankar Akela and inde- pendent MLA Amit Yadav. Police said that meetings of these MLAs with some of the top BJP leaders were arranged. Police claimed that there is a high level conspiracy to pull down the government by defecting as many as 11 Congress MLAs and if police is believed eight Congress MLAs are in the regular touch. It may or may not be a coincidence that police arrest- ed them on a written com- plaint of one of the C o n g r e s s M L A Jai m ang a l Singh, who claimed that a conspiracy is going on to break MLAs of ruling alliance. Another Congress MLA Naman Bixal Kongari too revealed that once he was also contact- ed with a big offer which he flatly denied. Amid unverified confes- sions and claims; integrity, political and personal reputa- tions of Congress MLAs — other than its four ministers, Singh and Kongari — has come under question and Central and State leadership are silent on the matter. Leadership has not woken- up to smash narratives and apparently not realised that the damage of the party is beyond surfeits of memes and jokes, as the Congress in Jharkhand is being dubbed as a disorderly house, untrustworthy bedfel- low where MLAs are ready for auction. 0CC4?CCC??;49´:70=36EC ?^[XRTcTPb [TPeTU^a 3T[WXdQPX 3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO $UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83 3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
- 3. 347A03D=kCD4B30H k9D;H !!! dccPaPZWP]S ?=BQ 347A03D= To tackle Covid-19 pan- demic, Chief Minister Pushkar Singh Dhami announced an incentive pack- age of about Rs 205 crore for the State’s health sector and the personnel employed in it. This package will benefit about 3.73 lakh people of the State. The Chief Minister made this announcement after felic- itating about 50 Covid warriors in a programme organised by the Health department here on Monday. Dhami commended the health workers for their dedi- cated service for more than a year since the Covid-19 pan- demic struck. He said though such dedicated service cannot be compensated monetarily, the State Government has decided to incentivise the per- sonnel financially. According to the package, Asha facilitators and Anganwadi workers will receive Rs 2,000 per month each for the next five months. Similarly, group C and D personnel of the health department will receive Rs 3,000 each and Rs 10,000 each will be provided to the doctors. This will benefit about 61,000 personnel. Additionally, 1,120 Asha facilitators and Anganwadi workers will also receive one tablet each. Homoeopathic and Ayurvedic kits will also be dis- tributed to these personnel to boost their immunity and pro- tect them from ill-effects of Covid. About 3,73,568 per- sons will benefit from these decisions. Regarding the expansion of health services in the State, Dhami said Government medical colleges will be established in Haridwar and Pithoragarh districts for which Rs 70 crore each will be released in the current financial year. Stating that the State Government is committed to ensure convenient access of the publictomedicalhealthservices, he said this is the reason why a target of spending about Rs 205 crore has been set for these schemes in the health sector. Health Minister Dhan Singh Rawat extolled the Covid warriors for the hard work they had put in amid difficult circumstances. Programmes to felicitate Covid warriors in all 70 Assembly constituencies will be held in one month. By December 30 this year the State will achieve cent per cent vaccination, he said, adding currently the State is ranked fifth in the nation when it comes to vaccination and aims to come first by November. Rawat informed that Atal Ayushman cards had been made for more than 42 lakh people so far with more than 2.93 lakh people having bene- fitted from it so far in the State. The Minister added the State Government will organ- ise health fairs in each Assembly constituency and that employment will be pro- vided to about 7,000 people in the Health department. 4R__`f_TVdC#!Tc`cVaRTRXVW`c9VR]eYdVTe`c 022A38=6CC74?02:064 0bWPUPRX[XcPc^abP]S0]VP]fPSXf^aZTabfX[[aTRTXeTAb!_Ta ^]cWTPRWU^acWT]TgcUXeT^]cWb BXX[Pa[hVa^d_2P]S3_Tab^]]T[^UcWTWTP[cWST_PacT]cfX[[ aTRTXeTAbTPRWP]SAb TPRWfX[[QT_a^eXSTSc^cWT S^Rc^abCWXbfX[[QT]TUXcPQ^dc% _Tab^]]T[ 0SSXcX^]P[[h !0bWPUPRX[XcPc^abP]S0]VP]fPSXf^aZTabfX[[P[b^ aTRTXeT^]TcPQ[TcTPRW 0Q^dc$%'_Tab^]bfX[[QT]TUXcUa^cWTbTSTRXbX^]b CWTX]XbcTaPSSTScWTBcPcT6^eTa]T]cfX[[^aVP]XbTWTP[cWUPXabX] TPRW0bbTQ[hR^]bcXcdT]RhP]ScWPcT_[^hT]cfX[[QT_a^eXSTSc^ PQ^dc_T^_[TX]cWT7TP[cWST_PacT]c ?C8Q A8B78:4B7 Afinancial assistance of Rs 5 lakh was given on behalf of Chief Minister Pushkar Singh Dhami to a 25-year-old cancer patient admitted at the All India Institute of Medical Sciences (AIIMS) here on Monday for her further treatment. The amount was given out of Chief Minister’s discre- tionary fund by Dehradun district magistrate R Rajesh Kumar. Anu Dhami, who is the mother of a six-month-old child has been undergoing treatment for blood cancer at AIIMS, Rishikesh, Medical Superintendent of the institute BK Bastiya said. She had exhausted her free treatment limit of Rs 5 lakh under the Ayushman Yojana. The woman has to under- go a bone marrow transplant as part of her treatment, he said. Her husband Madan Dhami had requested the chief minister for help. The family hails from Pithoragarh. 'KDPLFRPHVWRDLGRIFDQFHUSDWLHQW ?=BQ 347A03D= Congress leader Pritam Singh took charge as the leader of Congress Legislature Party (CLP) in a ceremony attended by a large number of party workers and leaders on Monday. Addressing media persons shortly after assuming the office, Singh said the people of Uttarakhand have made up their minds to change the Government and the Congress party would form the government in the State in the year 2022. He said that the BJP is now promising free electric- ity to the people in Uttarakhand. “They are making the promise without having any knowledge about the power produced in the State and its consumption. If they really wanted to give free electricity they should have done it in the last four years but they are making promises now when the elections are near. The Congress party will form the next Government and we will give a transparent and corrup- tion-free Government,” he said. Launching an attack on the Union Government, Singh said the BJP came to power by giving slogan “Bahut hui Mehangai ki Maar abki bar BJP Sarkar” but instead of giving relief the prices of everything have skyrocketed. He said the price of Petrol has crossed Rs 100 while the gas cylinder is now costing about Rs 1,000. Singh said that Prime Minister Modi should listen to the Maan ki Baat of the people of the country. He said under the regime of the BJP the mining, liquor and land mafia are ruling the roost in Uttarakhand. On the land laws the CLP leader said the BJP Government has weakened the laws to favour the land mafia. Singh added though very less time is left for the term of present Assembly he as the leader of CLP would try his best to corner and expose the Government on the floor of the house. “The BJP has made Uttarakhand as a laboratory and has made three chief min- isters. The decisions of one CM are being changed by others. We will take the BJP both in the Assembly and out- side it,” he said. The newly appointed work- ing presidents of the party, Ranjit Rawat, Jeet Ram and Bhuwan Kapdi, deputy leader of CLP Karan Mahra, MLA and secretary of All India Congress Committee (AICC) Qazi Nizamuddin, MLAs Manoj Rawat, Mamta Rakesh and Adesh Singh Chauhan were also present on the occasion. Large number of party workers and leaders congratulated Singh for his new assignment. 3ULWDP6LQJKWDNHVFKDUJHDV/3OHDGHU BPhbX]X]V[X`d^aP]S[P]SPUXPPaTad[X]VcWTa^^bcd]STa19?aTVXTX]DccPaPZWP]S ?=BQ 347A03D= The new CLP leader Pritam Singh was at his candid best as he eloquently expressed himself on the performance of the BJP Government and the internal politics of the Congress party while inter- acting with media persons. On the question of the face the party would project in the upcoming elections he questioned, “What is wrong with my face?” He then added that the party has made it clear on many occasions that the Congress would fight the election under collective leadership. Singh could not hide his displeasure at being removed from the post of Pradesh Congress Committee (PCC) president as he quipped that it would have been better had Karan Mahra been made the CLP leader. 2^]Vc^R^]cTbcT[TRcX^]bd]STa R^[[TRcXeT[TPSTabWX_)2;?[TPSTa ?=BQ 347A03D= All Government offices in Uttarakhand would now function with 100 per cent employee strength. In view of the prevailing pandemic of Covid-19 and to prevent the employees from the infection the State Government offices were functioning with 50 per cent employee strength from April this year. In an order the secretary (in-charge) Vinod Kumar Suman said on Monday the contagion of the Covid-19 has reduced to a great extent in the State and in view of the improvement in the situation, all the office heads should ensure 100 per cent attendance in their offices. The order, however, added that Covid-19 appropri- ate behaviour should be prac- ticed and necessary measures to prevent the spread of infection should be taken. ?=BQ 347A03D= Various employee associa- tions of the power corpo- rations of the State would go on an indefinite strike from Monday midnight. Under the banner of Vidyut Adhikari-Karmchari Sanyukt Morcha more than 3,500 employees belonging to ten associations of the three corporations engaged in pro- duction, transmission and dis- tribution of power in the State have joined hands for the strike. The Morcha want that 14 points demand should be accepted by the State Government. On Monday, the secretary level talks with the Morcha failed and the employees resolved to go ahead with their strike plan. The employees of the power corporations want that the old system of Assured Career Progression (ACP) should be restored and all the contractual workers of Uttarakhand Purva Sainik Kalyan Nigam Limited (UPNL) should be regularised. The old ACP model of assured promotion at the end of nine, five and five years of service was taken back when the seventh pay commission recommendations were imple- mented in the power corpora- tions. The convener of the Morcha Insarul Haq said the employees would not take back their strike call till their demands are accepted. He said an understanding was reached between the employee associations and gov- ernment on December 22, 2017, but no action has been taken yet to implement the written understanding reached. On Monday, the General OBC employees association, the umbrella organisation of general and OBC employees of the State extended its support to the Morcha of power cor- porations. The leaders of the associ- ation went to the UJVNL head- quarters on the day and assured their full support to the cause of the employees of power cor- porations. Meanwhile, the newly appointed Managing Director (MD) of Uttarakhand Power Corporation Limited (UPCL) and Power Transmission Corporation Limited (PTCUL) Deepak Rawat took charge of the office on Monday. A`hVcT`ca`cReZ`_ V^a]`jVVd¶ RUR^R_e`_decZV GYW__^cdbY[UVb_]]YT^YWXd_V=_^TQi Y^ce``_bd_VdXUYb!$`_Y^dTU]Q^Tc *RYWRIILFHVWR ZRUNZLWK DWWHQGDQFHQRZ ?=BQ 347A03D= The State health department reported 54 new cases of the novel coronavirus and 50 recoveries from the disease in Uttarakhand on Monday. Death of no patient was report- ed by the department from the disease on the day. The cumulative count of Covid-19 patients in the State is now at 3,41,778 out of which a total of 3,27,766 patients have recovered from the dis- ease so far. In the State, 7,359 people have lost their lives to Covid-19 till date. The recovery percentage from the disease is now at 95.90 and the sample positivity rate on Sunday was at 0.21 per cent in the State. The authorities col- lected 28,123 samples in dif- ferent parts of the State on Monday. The State health depart- ment reported ten new patients of Covid-19 from Nainital, eight each from Dehradun and Haridwar, six each from Almora, Udham Singh Nagar and Rudraprayag, three each from Bageshwar and Pithoragarh, two from Chamoli and one each from Tehri and Uttarkashi on Monday. No new case was reported from Champawat and Pauri districts on the day. TheStatenowhas638active patientsofthedisease.Dehradun districtisattopofthetableinthe list of active cases with 255 patientswhileHaridwarisinthe second position with 64 active cases. Pithoragarh has 62, Nainital57,UdhamSinghNagar 53, Chamoli 35, Champawat 27, Rudraprayag 24, Uttarkashi 19, Tehri 13, Bageshwar and Pauri 11 each and Almora 10 active cases of the disease. The State reported no new case of Mucormycosis (Black fungus) and death of one patient from the disease on Monday. A total of 561 patients of Black Fungus have been reported till date in the state and out of them 124 have died. In the ongoing vaccination drive 31,930 people were vac- cinated in 574 sessions held on Monday in different parts of the State. 2 E 8 3 ( %$^UgSQcUc% bUS_fUbYUcY^CdQdU CWTBcPcT]^fWPb%'PRcXeT _PcXT]cb^UcWTSXbTPbT 3TWaPSd]SXbcaXRcXbPcc^_^U cWTcPQ[TX]cWT[Xbc^UPRcXeT RPbTbfXcW!$$_PcXT]cbfWX[T 7PaXSfPaXbX]cWTbTR^]S _^bXcX^]fXcW%#PRcXeTRPbTb CWTBcPcTaT_^acTS]^]Tf RPbT^UdR^ahR^bXb1[PRZ Ud]VdbP]SSTPcW^U^]T _PcXT]cUa^cWTSXbTPbT^] ^]SPh0c^cP[^U$% _PcXT]cb^U1[PRZ5d]VdbWPeT QTT]aT_^acTScX[[SPcTX]cWT bcPcTP]S^dc^UcWT !# WPeTSXTS 8]cWT^]V^X]VePRRX]PcX^] SaXeT (_T^_[TfTaT ePRRX]PcTSX]$#bTbbX^]b WT[S^]^]SPhX]SXUUTaT]c _Pacb^UcWTBcPcT DccPaPZWP]S2WXTUX]XbcTa?dbWZPaBX]VW3WPXSdaX]V!!]SP]]XeTabPah^U:PaVX[EXYPh3XfPbX]3TWaPSd]^]^]SPh ?C8 ?=BQ 347A03D= Ignoring the risk dilapidated buildings pose to human lives and property during the monsoon due to the vulnera- bility of weak structures, the Dehradun district administra- tion and the Municipal Corporation of Dehradun (MCD) continue to pass the buck on the matter. Since last year, district administration and MCD have claimed to be working towards vacating and demolishing con- demned buildings in the city but nothing is actually notice- able at ground-level. Last month, Disaster Management Minister Dhan Singh Rawat had directed the district administration to mark all the dilapidated buildings in Dehradun and shift the people to safer locations in view of the monsoon season. The city magistrate’s office sent multiple letters to the cor- poration to take action on condemned structures but nothing has been done so far. Authorities are not taking any concrete decision to evacuate the vulnerable dilapidated buildings in view of any possi- ble accidents as usual despite the State meteorological centre’s forecast of heavy to very heavy rainfall with intense spells at isolated places in the district till July 30. Accordingtocitymagistrate Kusum Chauhan, demolition of these structures occurs under themunicipalcorporationasper the laws and the administration has directed the corporation to take action. On the other hand, municipal commissioner Vinay Shankar Pandey has stated repeatedly that they are not planning to demolish any dilap- idated structure in the city as most of the buildings are stuck in court cases due to owner-ten- ant disputes. On the question of who will be responsible for the damage of lives and property if any of these structures collapse during heavy rain, the munic- ipal officials informed they have asked the people residing there to evacuate the building but the demolition of these structures is not on the cards yet. Responding to the same query, the city magistrate said that the administration has directed the MCD to take action and the municipal offi- cials have assured that they are working on it. The additional municipal commissioner, MS Barnia stat- ed on this that they have marked the condemned build- ings again after administration’s letter but he is not aware of any plan to demolish them. One senior official even said that if the district administration wishes, it can take MCD’s resources and team to demol- ish the condemned buildings but the corporation is not plan- ning to do any such thing any- time soon. It appears that both the authorities are waiting for a big accident to happen in the city as a wakeup call which might happen soon if the authorities continue to pass the buck rather than taking concrete actions. 0dcW^aXcXTbfPXcX]VU^aQdX[SX]VR^[[P_bTX] 3^^]c^ePRPcTR^]ST]TSQdX[SX]Vb. ?=BQ 347A03D= Ending days of speculation, senior officers of Indian Administrative Services (IAS) Radhika Jha, Nitesh Jha and Deepak Rawat took over their new assignments on Monday. Radhika Jha took over the charge of the secretary of school education department on the day. Similarly, Nitesh Jha assumed charge as secretary and director of Panchayati Raj on Monday. The newly appointed man- aging director of Uttarakhand Power Corporation Limited (UPCL) and Power Transmission Corporation Limited (PTCUL) Deepak Rawat also took charge of the office on Monday. Speculation were rife that these high pro- file officers were not happy at the recent reshuffle in bureaucracy. However, these specula- tion were laid to rest on Monday when they took over the new responsibilities. B_TRd[PcX^]bTcc^aTbc 7KH-KDV 'HHSDN5DZDWWDNH FKDUJHRIQHZGHSWV
- 4. ]PcX^]# 347A03D=kCD4B30H k9D;H !!! :^ac`gZ_XS`cUVcZ_WcR YZXYVdeacZ`cZej+8`ge ?=BQ =4F34;78 In view of China ramping up its infrastructure including roads and rail network near the Line of Actual Control(LAC), the Government on Monday assured the Rajya Sabha that required measures were under- taken to improve border infra- structure. Making this assertion, Minister of State for Defence Ajay Bhatt said 73 critical roads have been designated as Indo- China Border Roads of 4,203 kilometers length and are being accorded highest priority with dedicated funding. Further, to ensure all weather connectivity to far flung areas, construction of tunnels has also been under- taken across passes. Currently, construction of four tunnels is underway, he said in a written reply. Infrastructure develop- ment in Uttarakhand is being holistically executed with bud- getary support from the Ministry of Defence, Home Ministry, State Public Works Department(PWD) and Central projects like Bharatmala and Chardham. As on date, 21 roads with a length of approximately 800 kilometers are being con- structed and upgraded by the Border Roads Organisation(BRO)over and above certain roads being con- structed by State PWD. He said the Government is fully seized of the security needs of the country and reviews the same from time to time. Required measures including development of infrastructure like construc- tion of roads, tunnels and strategic railway lines are taken to safeguard the sovereignty, territorial integrity and secu- rity of India. As per the operational requirement of Armed Forces and the need for development along border areas, road con- struction is taken up by Border Roads Organisation (BRO). His assurance comes in the backdrop of the ongoing stand-offs at three friction points between Indian and Chinese troops in Eastern Ladakh for the last more than one year. China has vastly improved its road and rail network in the Tibetan plateau all along the 4,000 km long LAC from Ladakh to Arunachal Pradesh. It has a high speed rail net- work to ensure all-weather logistical back-up for its troops guarding the LAC. Similarly, it has developed a network of road and rail of more than 10,000 km in the Tibet region. NewDelhi:TheSupremeCourt on Monday gave a free hand to theCBItoprobetheallegedcon- spiracy to frame ISRO scientist Nambi Narayanan in an espi- onagecasein1994astheagency, in a status report, informed the topcourtthatithasregisteredan FIR against former Kerala DGP Siby Mathews and others in the matter. A bench headed by Justice AM Khanwilkar said: “It is mentioned in the report after examining relevant aspect, the FIR has been registered. Now the law has to take its course.” Advocate Amit Sharma, counsel for Mathews, and advocate Kaleeswaram Raj, counsel for another accused, submitted that the Justice DK Jain Committee report has not been shared with the accused, and argued that the CBI’s refusal to do so is causing prejudice to the accused in availing their statutory reme- dies. They also contended that the central probe agency is rely- ing on the report in the FIR. The bench, also compris- ing Justice Sanjiv Khanna, noted that the CBI cannot pro- ceed on the basis of the report of a panel headed by former top court judge Jain, formed in September 2018, to examine the matter, and the agency will have to collect material in the case independently. “The report by itself cannot be the basis to proceed against the respondents or persons named as accused in the FIR registered by the CBI,” said the bench. “The CBI has decided to proceed in the matter and fur- ther steps should follow as per law.” It further added: “We make it clear that our earlier order only required that Justice D.K. Jain report shall not be made public and not the FIR.” Solicitor General Tushar Mehta, representing the Centre, then informed the top court that the FIR will be uploaded during the course of the day. The apex court said the panel’s report has been acted upon, therefore the Jain com- mittee may cease to function. On April 15, the top court had ordered the CBI to probe the role of Kerala Police officers in framing of Narayanan in the 1994 espionage case. Accepting the report submitted by panel headed by Justice Jain (retd), the top court said the matter is very serious and it requires CBI probe. The bench had asked the then acting CBI Director to take charge of the case and treat the inquiry report given by Justice Jain panel as a prelimi- nary inquiry report to conduct further investigation into the matter. The CBI was asked to file status report on its investi- gation in three months. IANS ?=BQ =4F34;78 The CBI has booked an Andhra Pradesh-based pri- vate company for alleged loan fraud to the tune of C20 crore. The agency conducted search- es at three locations on Monday at the premises of the accused entity and individuals in Andhra Pradesh and Telangana. The agency has named Ind Tob International Pvt. Ltd., Guntur (Andhra Pradesh), its Managing Director, Promoter and Guarantor Tadisetty Venkata Rao, Director and Promoter Tadisetty Murali Mohan besides unknown pub- lic servants. It was alleged that the pri- vate company was engaged in trading of tobacco. It was fur- ther alleged that the said private company availed credit facilities aggregating to C45 crore from SBI, Specialised Commercial Branch, Guntur, the CBI said in a statement. These credit facilities were inter alia secured against hypothecation of movable assets, mortgage of immovable properties and personal guar- antees. The account became non- performing asset (NPA) on February 27, 2019 due to lower sales coupled with lower mar- gins and cash losses in addition to submission of inflated /manipulated stock statements and transfer of funds to the per- sonal accounts of Directors. An alleged loss to the tune of C19.28 crore(approx) was caused to lending bank SBI, it added. ?=BQ =4F34;78 The Enforcement Directorate (ED) on Monday said it has attached assets worth over C7 crore of a company in connection with a case of money laundering through alleged diversion of duty-free imported gold. The agency said a provi- sional order for attachment of seized cash, gold jewellery and silver worth C7.47 crore has been issued under the Prevention of Money Laundering Act (PMLA) against the firm — Shri Lal Mahal, it said. The ED case against the accused company and its pro- moters followed an earlier complaint filed by the Directorate of Revenue Intelligence (DRI) in Noida near here, under sections of the Customs Act for “diversion of 586 kg of duty-free import- ed gold in the domestic mar- ket and evading of Customs duty.” The ED probe revealed that Shri Lal Mahal Ltd. and its related entity Bindra Sales Pvt Ltd, its beneficial owners Prem Chand Garg, Anita Garg and others were involved in crim- inal offences and had acquired proceeds of crime by diverting the duty-free imported gold in the domestic market and evad- ing Customs duty to the tune of C17.54 crore, the agency said in a statement. 43PccPRWTbCRa PbbTcbX]^]Th [Pd]STaX]VRPbT ?=BQ =4F34;78 In a bid to boost domestic supply and check rising prices, the Government on Monday reduced the import duty on masoor dal to zero and also halved the Agriculture Infrastructure Development Cess on the lentil to 10 per cent. Retail price of masoor dal has increased by 30 per cent to C100 per kg now from C70 per kg on April 1, this year, as per the data maintained by the consumer affairs ministry. A notification in this regard was tabled in the Rajya Sabha by Finance Minister Nirmala Sitharaman. The Minister said that the basic customs duty has been reduced from 10 per cent to nil on lentils (masoor dal) originated in or exported from countries other than the US. Also, the basic customs duty has been reduced from 30 per cent to 20 per cent on lentils (masoor dal) originat- ing in or exported from the US, she said. Further, the Agriculture Infrastructure Development Cess on lentils (masoor dal) has been reduced from the present rate of 20 per cent to 10 per cent, she added. India Grains and Pulses Association (IGPA) Vice Chairman Bimal Kothari had early this month said,”India annually needs 25 million tonne of pulses. But this year, we are expecting a shortage.” The government had introduced the Agriculture Infrastructure and Development Cess (AIDC) on certain items, including petrol, diesel, gold and some imported agricultural prod- ucts, this fiscal in a bid to boost agriculture infrastruc- ture. Farmers leader Binod Pandey said that farmers of Madhya Pradesh, Uttar Pradesh, West Bengal and Bihar will hugely affected as these four States produces almost 85percent of Lentil(Masur). 6^ecRdcbX_^acSdch^] Pb^^aSP[c^iTa^c^ Q^^bcS^TbcXRbd__[h ?=BQ =4F34;78 Extending support to farm- ers protesting against the Centre’s three farm laws, Congress leader Rahul Gandhi on Monday drove a tractor to Parliament along with other party MPs and demanded that the agricultural laws be repealed. Rahul, along with party MPs Pratap Singh Bajwa, Ravneet Singh Bittu, Deepinder Singh Hooda, Gurjit Singh Aujla, Jasbir Singh Gill and other leaders like Randeep Surjewala, also carried banners and raised slogans. Rahul said he has brought the message of farmers to Parliament. “We have brought the message of farmers to Parliament. Their issue is not being allowed to be discussed in Parliament and farmers all over the country are being suppressed and that is why we are here. These black laws should be withdrawn,” Rahul said, talking to the media. He claimed that these farm laws are aimed to help only two- three industrialists. “The entire country knows for whom these laws have been brought. These laws are not for the benefit of farmers and that is why they have to be withdrawn,” he added. Congress’ chief spokesper- son Randeep Surjewala and Youth Congress chief BV Srinivas, along with a number of party leaders, were detained by the Delhi Police outside Parliament and taken to Mandir marg police station. The police said 10 people have been detained. The tractor driven by Rahul has also been impound- ed by the Delhi Police. The detained Congress leaders raised slogans demanding the withdrawal of farm laws. 6KRZLQJVROLGDULWZLWKIDUPHUV 5DKXOGULYHVWUDFWRUWR3DUOLDPHQW B2VXeTb218UaTTWP]Sc^_a^QTX]c^ =PaPhP]P]´bUaPX]VX]Tb_X^]PVTRPbT ?=BQ =4F34;78 Former Union Minister and Congress leader Shashi Tharoor on Monday demand- ed a Supreme Court judge- monitored probe into the Pegasus snooping allegations and indicated that Opposition parties would continue to disrupt Parliament’s proceed- ings until the Government agrees to a debate on it. Tharoor’s party colleague and Home Minister in UPA Government, P Chidambaram too attacked the Centre, saying the only Government that is “uncon- cerned” over the issue is that of India. He referred to the reports that French President Emmanuel Macron spoke with Israeli Prime Minister Naftali Bennett on the Pegasus snooping allegations. Chidambaram alleged Indian government was fully aware of the snooping and does not need any more information from Israel or the NSO Group. Tharoor, who is also the Chairman of Parliamentary Panel on IT, alleged that it appears that the government used public money for snoop- ing for its “selfish political interests”. Speaking to reporters in the Parliament complex Tharoor said, “We want the government to agree toa debate on the issue, but it is not ready. What we are say- ing is that if you (govern- ment) do not agree to this and answer our questions, then why should we allow you to transact your business.” He said other issues like price rise and contentious farm laws are also important for the opposition but the Pegasus row is a priority. Tharoor also made light of IT Minister Ashwini Vaishnaw’s statement on the issue in both Houses, saying he just shared his “Mann Ki Baat” without listening to the oppo- sition. Vaishnaw had termed the snooping stories a bid to malign India,claiming that there is “no substance” to this sensationalism. The parliamentary panel, led by Tharoor, is likely to question top government offi- cials, including from the home ministry, later this week on Pegasus snooping allega- tions, according to sources. The 32-member Parliamentary Standing Committee on Information and Technology is scheduled to meet on July 28. The agen- da of the meeting is “Citizens data security and privacy”, according to a notification issued by Lok Sabha Secretariat. 7^dbT?P]T[bTTZbX]RT]cXeTbU^a _ec^f]Tab^UWXbc^aXRQdX[SX]Vb New Delhi: Defence Minister Rajnath Singh and senior Indian military officers paid homage to the fallen heroes on the 22nd anniversary of Kargil Vijay Diwas at the National War Memorial in New Delhi. Singh laid a wreath in the honour of the bravehearts who made the supreme sacrifice in the service of the nation dur- ing India’s victory in ‘Operation Vijay’ in 1999, also known as Kargil conflict. Singh recalled the valour of the bravehearts of the Kargil conflict, saying that nation will never forget the sacrifice made by the gallant heroes of Indian Armed Forces. He added that the grateful nation will always be indebted to their courage and continue to follow their ideals. In a tweet, Singh said the supreme sacrifice of the brave soldiers will inspire the gener- ations to come. Minister of State (Defence) Ajay Bhatt, Chief of the Air Staff Air Chief Marshal R.K.S. Bhadauria, Chief of the Army Staff General M.M. Naravane, Defence Secretary Dr Ajay Kumar and Chief of Integrated Defence Staff to the Chairman Chiefs of Staff Committee (CISC) Vice Admiral Atul Kumar Jain also paid homage to the fallen heroes at the National War Memorial. ANI CWPa^^abTTZbB2^]Xc^aTS_a^QT X]c^?TVPbdbb]^^_X]VRPbT CR[_ReYaRjd ecZSfeVe` RcXZ]^Rcejcd 218Q^^Zb 0?QPbTSUXaU^a RWTPcX]VQP]Z _ecR^_P]XTbX]c^STUT]RT _a^SdRcX^]X]8]SXPbPhb2T]caT New Delhi: A total 333 private com- panies have been issued 539 industri- al licences for defence production in India and out of these, 110 companies have started production. In a written reply to Vijay Pal Singh Tomar in the Rajya Sabha on Monday, Minister of State for Defence Ajay Bhatt said that the defence indus- try sector, which was hitherto reserved for the public sector, was opened up to 100 per cent for Indian private sec- tor participation in May, 2001. Thereafter, many measures have been taken by the government to promote private sector participation. Out of the total capital acquisition budget for the year 2021-22, 64.09 per cent has been earmarked for domes- tic capital procurement, while the defence capital outlay has been increased by 18.75 per cent in the Budget for FY 2021-22, the minister informed. The Defence Procurement Procedure-2016 has been revised as Defence Acquisition Procedure (DAP)-2020, which is driven by the tenets of the defence reforms announced as part of the ‘Aatmanirbhar Bharat Abhiyan’ (self- reliant India campaign), Bhatt said. In order to promote indigenous design and development of defence equipment, the ‘Buy’ (Indian-IDDM or Indigenously Designed, Developed and Manufactured) category has been accorded top most priority for pro- curement of capital equipment, he said. The ministry has notified a ‘Positive indigenisation list’ of 209 items for which there would be an embargo on the import beyond the timeline indicated against them. This would offer a great oppor- tunity to the Indian defence industry to manufacture these items using their own design and development capabilities to meet the requirements of the armed forces in the coming years, Bhatt said. IANS ?=BQ =4F34;78 AParliamentary standing committee on transport, tourism and culture in its report on “Development and Conservations of Museums and Archaeological sites-Challenges and Opportunies” has recommended that private owners of list- ed historic buildings should be given certain compensations or incentives to encour- age them in conservation and protection of the historical sites. The Committee has asked the Ministry to set up a mechanism to collect feed- back from domestic as well as foreign tourists visiting museums or archaeolog- ical sites. “Private owners of listed historic buildings as well as people having residential property properties within prohibited/ regulated/ buffer areas should be provided with certain compensation/ incentives to encourage their participation in the con- servation and protection of the historical sites,” the committee, headed by MP TG Venkatesh, said in its report, tabled in the Parliament on Monday. The Committee, therefore, recommended that wherever feasible, the Ministry may act on the suggestions made by INTACH in this regard. “Technology may be utilized to permit the tourists to easily leave their feed- back from domestic as well as foreign tourists who visit a Museum or archaeo- logical site/monument regarding the experience they had in their visit to a Museum/ archaeological monument. Working on first hand feedback from the visitors will lead the Ministry into improving tourist experience in the future, while also leav- ing a positive imprint about Indian culture and heritage among those who visit,” it said. The Committee found that the development and preservation of archaeo- logical sites and Museums often does not run high in the priorities of State Governments. “This often leads to neglect, and thus irreparable damage is caused to the State protected archaeological monuments as well as Museum artefacts,” it said. The Committee recommended that the Ministry should have a mechanism in place to identify instances of gross neglect of maintenance and preservation of important archaeological sites and Museums and prod the State Government Department concerned to take action to rectify the same. In cases of exigent needs, ASI may proactively provide technical assistance to such monuments and Museums. The Committee suggested that the Ministry may, from time to time, consider the inclusion of the State protected archaeo- logical monuments and Museums which are more than 100 years old, in the list of Centrally protected monuments and National Museums. The Committee further recommended that the Ministry may lend assistance to State Governments to enable introduction of online ticketing to archaeolog- ical sites and Museums under their purview.
- 5. ]PcX^]$ 347A03D=kCD4B30H k9D;H !!! :D0A274;;0??0=Q :278 The ruling CPI(M) on Monday cracked the whip on per- sons associated with the financial embezzlement reported from Karuvannur Cooperative Bank in Thrisuur district. Crime Branch wing of Kerala Police on Sunday had arrested Biju Kareem, a CPI(M) local leader who is also the former manager of the Bank, T R Sunil Kumar, former secretary of the Bank, A K Bijoy and C K Jills (former accountant) in connection with the irregularities in the Bank that led to the last week suicide of a customer T M Mukundan who was a Congress leader. A Vijayaraghavan , state secretary of the CPI(M) told reporters that strict action would be taken against persons who were associated with the misappropriation of Bank funds. The Thrissur District Secretariat as well as the District Committee of the party would meet on Monday and Tuesday to take stock of the situation and recommend to the party leadership the decisions to be taken against those involved in the scandal,” said Vijayaraghavan. According to Crime Branch officials probing the Karuvannur Bank scandal, some of the Bank staff mem- bers misused the documents pawned in the Bank by those who availed loans. “These documents were used by the Staff as security to avail loan from other sources when they could not mobilise enough funds for their business deals. We suspect many Banks of committing such irregularities,” said an investigating officer. Meanwhile, officials of the Enforcement Directorate based in Kochi have started collecting details from primary cooperative banks in the State which have accepted deposits and issued loans. “To begin with, details of per- sons who have deposited C10 lakh and above with these primary cooperative Banks are being collected,” said an offi- cial involved in the probe. The Primary Cooperative Societies are exempted from collecting details about the customers and the ED officials suspect that this clause could have been misused for money laundering operations. The Kerala Government on its part had appointed a nine-member committee of officials to go into the details of the irregularities associated with the Karuvannur Cooperative Bank. One of the officials told The Pioneer that too much politics in the management of the cooper- ative banks was killing the system. “Though there is a recruitment board to appoint employees to these banks, it is usually the party in power that decides who should be appointed to the Banks. So, capabilities and professionalism take back seat while party writs run all over,” said the official. :D0A274;;0??0=Q :278 The three-day long total lockdown in Kerala that concluded on Sunday late night has helped in bringing down the number of new instances of Covid-19 and the Test Positivity Rate. Health Minister Veena George who addressed the media on Monday evening said that 11,586 new cases were logged on Monday while the TPR came down to 10.59. The death toll in the State reached 16, 170 as the pandemic claimed 135 deaths on Monday. The Minister blamed the Union government for not heed- ing to the requests from the State for more vaccines. “Kerala is facing severe shortage of vaccine despite the Chief Minister and me making number of appeals to the Prime Minister and the Union Health Minister,” said George. The Health Department tested 1.09 lakh sam- ples on Monday compared to 1.42 lakh samples test- ed on Sunday. On Sunday, the State had recorded 17,466 new cases of Covid-19 and a TPR of 12.3 per- cent. A senior physician working in Government Hospital in the State said the reduction in the num- ber of new Covid-19 cases does not bring any relief. “The number of samples tested, the number of anti- gen and RT-PCR tests should be analysed to figure out whether there has been any reduction in the transmission of the pandemic. The antigen tests are not fool-proof while the final results of RT-PCR tests would be known only after two to three days,” said the physician. There are 271 regions in the State where TPR showed more than 17 percent. The new policy of the Government is the slapping of total lock down and isolation of areas showing high TPR rates. Noida/Aligarh: Uttar Pradesh police has busted a child trafficking racket with the arrest of 16 persons, officials said on Monday, adding six kidnapped kids were rescued in the operation. The children were rescued during an overnight operation conducted in Aligarh and surrounding areas as part of the spe- cial anti-human trafficking 'Operation Khushi', they said. Acting on a tip-off, police nabbed three persons near a crossing at village Borna under Mahuakheda police station area on Sunday evening, Senior Superintendent of Police (SSP) Kalanidhi Naithani said. They told police that four kidnapped children were being held in a house in Ganga Nagar colony under Gandhi park police station area, he said. Police immediately raided the premis- es and rescued them, the SSP said, adding two more kidnapped children were freed from the clutches of other members of the gang at another house in an area that falls under the Delhi gate police station area. Two of these children had gone miss- ing from Ghaziabad and four from Aligarh, Naithani said, dubbing the overnight action as “unprecedented”. “Sixteen people who mediated the sale and purchase of infants and toddlers have been arrested. These include nine women,” he said. The male members of the gang with a nexus across the state would kidnap chil- dren and hand them over to the women, who would then sell them off to childless couples for Rs 50,000 each and sometimes even in lakhs of rupees, Naithani said. The police teams that carried out the rescue operation under the supervision of Superintendent of Police (SP) Kuldeep Singh Gunawat have been rewarded, he said. The children have been handed over to their families and further legal pro- ceedings against the gang members are underway, he added. PTI :TaP[P)3X_X]2^eXS ( RPbTb_^bcSPh[^RZS^f] C=A067D=0C70Q D108 Maharashtra achieved a record of sorts on the Covid-19 vaccination front on Monday, as it became the first State in the coun- try where more than one crore people have been administered the two doses of the vac- cine. Till 4 pm on Monday, as many as 4.75 lakh people were administered vaccines in various parts of the state. Of the total people vaccinated so far, 1,00,64,308 people have received both the doses of vaccine. Maharashtra stands first in terms of vac- cination across the country. “We have so far given the first dose of vaccine to as many as 3,16,9,227 people in the State. After today’s vac- cination, the number of people getting both the jabs has crossed more than one crore people,” Maharashtra’s Additional Chief Secretary (health) Dr Pradeep Vyas said. There are 4,100 vaccination centres in the state. “Till 4 pm, as many as 4.75,974 were vac- cinated in various vaccinated on Monday. Since the vaccination will continue late in the evening, the number of vaccinations that took place on Monday will go up further,” Vyas said. Meanwhile, Chief Minister Uddhav Thackeray and Tope complimented the Public Health Department of achieving the milestone of administering two doses to more than one crore people. Till Sunday evening, as many as 1,04,16,614 people in the age group of 18 to 44 years have been vaccinated, while 4, 59,927 in the same age group have been given the second of vac- cine. Similarly, 1,76,09, 232 people in the age group of 45 years and above have been given the first dose of vaccine, while 74,28,097 peo- ple have been administered second dose of the Covid-19 vaccine. In all, 4,13,19,131 doses have been to peo- ple across the State so far. There are at least ten districts in the state where authorities have vaccinated more 10 lakh people. While Mumbai accounts for a maxi- mum of 69,66,066 were vaccinated till the evening of Sunday, Pune comes close second with 59,12,418 vaccinations, followed by Thane (32,31,731), Nagpur (12,52,489), Nashik (17,55,420), Latur (17,10,074), Satara (11,81,304), Ahmednagar ( 11,75,030) Aurangabad (11,15,549) and Kolhapur (17,10,074). RYRWZcdeDeReVe`XZgVS`eY 4`gZUU`dVde``gVcTcaV`a]V Karimganj (Assam): A 43-year-old man has been arrested in Assam's Karimganj district for allegedly raping a mentally challenged minor girl, police said on Monday. The man had allegedly raped his 17-year-old neighbour on Saturday, officer-in-charge of Badarpur Police Station Dipak Saikia said. The girl was alone in the house and was strolling in the backyard when the accused dragged her into a room and allegedly raped her. “We have arrested the man and a case under the Protection of Children from Sexual Offences (POCSO) Act has been registered against him. PTI KLOGWUDIILFNLQJUDFNHW EXVWHGLQ$OLJDUKNLGV UHVFXHGLQRYHUQLJKWRS C=A067D=0C70Q D108 The rain-flood toll in Maharashtra climbed to 192 on Monday, even as 25 more persons were not traceable till the evening and the authorities pegged the total number of people evacuated to safer places at 3,75,178. A day after the authorities said that 149 people were killed, the rescue and relief teams working in the various affected areas recovered 43 more bodies, taking the total n number of people killed in the rain-flood ravaged areas in the State. Raigad, where the district authorities called off the rescue operation and landslide- rocked Taliye, accounted for a maximum of 95 deaths, while there were 45 deaths in Satara district of western Maharashtra. The death tally in other places comprised: Ratnagiri-21, Thane-12, Kolhapur-7, Mumbai-4, Sindhdurg, Pune, Wardha and Akola-2 each. The authorities pegged the number of injured persons at 48, while 25 persons were reported missing from various rain-flood affected areas of the State. Calling off the rescue operation at Taliye where more than 50 persons were killed in a massive landslide on July 23, the Raigad district administration said: “Rescue Operation officially ended. We have with- drawn our rescue teams from Taliye.31 miss- ing to be declared dead following due process. All relatives of missing people demanded for close of operations since yes- terday” “After seeking opinion of NDRF/SDRF/TDRF in respect of senti- ments of survivors and relatives of missing people, rescue operation of missing 31 peo- ple called off officially,” a senior Raigad dis- trict official said.. Apart from 131 boats that have been pressed into service, as many as 33 NDRF teams and 3 Indian Army columns are still undertaking rescue and relief operations in various parts of the state. Meanwhile, seven flood rescue teams from the the Indian Navy to continued with their efforts to provide assistance to the flood affected local population in Ratnagiri and Raigarh districts, “More than 200 families have been pro- vided with packaged 'ready to eat' meals in the last two days. Emergency first aid and basic medicines were also provided to the people in need. The teams also assisted cit- izens in clearing up the debris left by the receding flood waters in the areas,”a senior Navy official said. Maharashtra Governor Bhagat Singh Koshyari will go on a tour of the Raigad- Ratnagiri districts for a spot-assessment of the situation on Tuesday. State Energy Minister Dr. Nitin Raut bnegan his tour of Raigad and announced that efforts were underway to restore power supply in the affected districts. A day after Union Minister for MSME Narayan Rane said that the Centre would extend flood relief to Maharashtra, Leader of Opposition in the State Assembly Devendra Fadnavis of the BJP asked the MVA government to extend assisrtance to all the flood-hit and also come out with a special package for the Konkan region. With a majority of the big and small rivers, reservoirs, lakes over flowing, villages, many towns and cities remained inundat- ed, while scores of roads in the regions are still closed for inter-district and inter-state vehicular movement, especially hitting fuel and food supplies. RYRcRdYecRcRZ_W]``Ue`]]^`f_ede`*# E8A4=3A0=0C7170CCQ ;D2:=F Desperate attempts to woo Brahmin voters by Samajwadi Party and Bahujan Samaj Party in the run-up to the 2022 UP Assembly elections has bewil- dered respective caste-based vote banks of the two parties. Political pundits are also at their wits’ end to decipher as to what galvanised the two parties to not only desert their core agenda but also their respective core vote banks. Analysts found it intriguing that the two parties, instead of for- mulating a comprehensive poll strategy to further consolidate their vote banks and bring to their fold new voters, were engaged in chasing the mirage of ‘Parshuram’ and one of the two promising to build a grand Ram temple in Ayodhya. The SP and BSP had forged an electoral alliance ahead of 1993 UP Assembly elections and their pop- ular slogan was ‘Mile Mulayam Kanshiram, Hawa ho gaye Jai Sri Ram’. Political analysts rubbished the narrative built by the detrac- tors of the Yogi Adityanath Government in Uttar Pradesh that the Brahmin community, particu- larly in Central UP, was sore with the Bharatiya Janata Party Government over the killing of Kanpur gangster Vikas Dubey in a police encounter in July last year. “Resentment against certain policies of the government and its transformation into vote against the ruling party are two entirely different issues. It is a flawed assumption and over simplification of the political process obtaining at the ground level that Brahmins of Kanpur will vote against the BJP. Vikas Dubey was a dreaded mafia and a terror in the district and most of his victims were none other than Brahmins,” said Kanpur-based political analyst Dr AK Verma. “The SP and BSP treated the political model of exclusive poli- tics based on caste-based identity as final politics and never con- templated expanding their vote base and making it more inclusive. Their failure to expand created the opportunity for the BJP and it was quick to grab it, which has been proved by the three successive elec- tions results in 2014, 2017 and 2019 and is likely to be repeated in 2022. In fact, it was the BJP which sincerely implemented the slogan of BSP founder Kanshiram demanding relative share in power structure as per population of the caste and communities,” Dr Verma said. Another analyst opined: “Identity politics is not a bad thing as this politics has immensely con- tributed in social, political, eco- nomic empowerment of the Dalits and OBCs in UP. During the four decades of dominance of the Congress in UP and national poli- tics, there was no place for identi- ty politics at all levels including power,institutionalandsocialstruc- ture. Identity politics of SP and BSP was a game changer as voters of these parties became a substantive participant in the democratic pol- itics process rather than a formal participant during the Congress era,” the analyst said. ?=BQ ;D2:=F Uttar Pradesh has emerged as the largest ethanol producing state in the country by producing a total of 58 crore litres of ethanol in 54 distilleries established across the State. A Government spokesman said that the State manufactured 58 crore litres of ethanol, a solvent that is essentially mixed with petrol for envi- ronmental purposes, in 2020-21. He said in a major relief to farmers, an additional payment of Rs 864 crore was credited to the accounts of sugarcane farmers from the sale of ethanol. By mixing ethanol in petrol, the Uttar Pradesh government has been able to contribute to saving a total of 75.58 million dollars of India's foreign exchange reserve, thereby boosting the economy in these testing times. Ethanol is a type of alcohol that is mixed with petrol and is used as fuel in vehicles. According to environmental experts, ethanol mixed with petrol may reduce carbon monoxide pollution by 35 per cent. It may be recalled that the distilleries of sugar mills and other units produced a record 1.77 crore litres of sanitiser which was not only supplied within the State but also exported to other States. ?=BQ ;D2:=F All India Shia Personal Law Board urged the Yogi Adityanath Government to reconsider the proposed law on population control after a meet- ing in Lucknow on Monday, maintaining that a campaign had been launched to malign Muslims on the issue of religious conversion by vested interests. Presiding over the meet- ing, Maulana Saayam Mehdi said that the aim of these cases of religious conversion by Muslims was purely to malign the Muslims as it was not pos- sible to forcibly convert any person to Islam. The Shia Personal Law Board meeting also demanded action against UP Shia Waqf Board chairperson Wasim Rizvi, for his attempts to malign Islam and Quran. The Shia cleric asked the government to pay attention on the maintenance of the dilapidated building of Hussainabad Trust and other monuments of the Nawabi era. ?=BQ ;D2:=F Uttar Pradesh witnessed the steepest decline in the num- ber of fresh coronavirus positive cases with only 33 people testing positive across the state during the last 24 hours, making it the low- est daily case count since the sec- ond wave struck in March- April this year. In a sharp contrast to other states significantly lesser in terms of population such as Kerala, Maharashtra, Andhra Pradesh and Tamil Nadu, Uttar Pradesh has been successfully taming the raging disease. Where other states have been witnessing a greater surge of fresh Covid-19 cases (daily cases in the range of 17,000- 2,000), the daily case count in UP has been below 50 for three con- secutive days. In another significant achievement, Uttar Pradesh, con- tinuing the downward trend, dropped the daily Covid Test Positivity Rate (TPR) -- the num- ber of positive cases against the total tests done – and it stood at 0.01 per cent, the lowest in the country. This rate was at its high- est at 16.84 per cent on April 24 and now remains even lower than the lowest post-first wave of Covid-19. With eleven districts — Aligarh, Budaun, Basti, Bahraich, Etah, Fatehpur, Hamirpur, Hathras, Kasganj, Mahoba and Shravasti — becoming free of the deadly coronavirus and reporting no cases, the State’s success story in combating Covid-19 has been strengthened further. Emerging as a leader in con- ducting maximum Covid tests, Uttar Pradesh has tested as many as 6.42 crore samples for the coronavirus infection so far. The number of active cases in the country’s most populous state has also reduced to just 857, which is now equal to the tally which the state had in April 2020. Active Covid cases have been brought down by over 99 per cent from its peak capped at 3.10 lakh on April 30, while the percentage of active cases as against the total confirmed cases is 0 01 points. :TaP[PQP]ZbRP)2aXT1aP]RWPaaTbcb# APYPbcWP]D]T_[^hTSD]XcTS5TSTaPcX^]PRcXeXbcbbcPVTPST^]bcaPcX^]PVPX]bccWTBcPcT6^eTa]T]cPcBWPWXSBPaPZX]9PX_da^]^]SPh ?C8 P]WT[SU^aaP_X]V T]cP[[hRWP[[T]VTS X]^aX]0bbP 83HPHUJHVDV ODUJHVWHWKDQRO SURGXFLQJ6WDWH 6WHHSHVWGHFOLQHLQ IUHVKRYLGFDVHV LQ83WHVWYH C=A067D=0C70Q D108 In a joint operation carried out off the Mumbai coast, the Oil and Natural Gas Commission Limited and Indian Coast Guard (ICG) averted a possible disaster after an empty gas tanker of Dubai started drifting dangerously towards the sensitive Mumbai High Fields following an engine failure. After 36-hour-long operation, ‘MV Gas Yodla’, which was on a voyage from Bangladesh to UAE, was towed away to safety on Monday. The ONGC and ICG undertook the operation when ‘MV Gas Yodla’, owned by Sheild Marine, Dubai, devel- oped a major snag in its engine on Saturday evening and it started drift- ing in the high seas, 37 kilometers from the ONGC’s D1 field. At that time, there was crew of 17 men -- comprising 8 Indians and 9 Ukrainians – when its engine failed. It sent out a distress call to Offshore Defence Advisory Group (ODAG) in Mumbai. Acting on the call, the ONGC immediately rushed its offshore supply vessel ‘Sagar Pride’, divtered a multi- supply vessel ‘Seamec-3’ and tugboat ‘Saroja Blessing’, while the ODAG Mumbai mobilized its vessel ‘P.R. Nayak’. Another tugboat ‘Water Lily’ also joined the operation launched to help out ‘MV Gas Yodla’. The path of the vessel was closely monitored and by 10 pm on Saturday night, it was found that drifting ‘MV Gas Yodla’ was located around 28 kms from the D1 field. The vessel was drifting at around 3.4 km/hour as all the agencies made attempts to ensure it remained at a safe distance from the Mumbai High Fields. =62826_aTeT]ccP]ZTaUa^ RaPbWX]VX]c^dQPX7XVW5XT[Sb =3A5cTPSdaX]VPaTbRdT^_TaPcX^]X]PU[^^STSPaTP PUcTaaPX]PcBWXa^[XeX[[PVTX]:^[WP_da ?C8 08B?;1PbZbD?6^ec c^aTR^]bXSTa_a^_^bTS _^_d[PcX^]R^]ca^[[Pf 63%63¶VDWWHPSWVWRZRR%UDKPLQV FRQIXVHWKHLUFDVWHEDVHGYRWHEDQNV