General English Essays.pdfGeneral English Essays

General English Essays
Crafting an essay on the subject of "General English Essays" can be both challenging and
rewarding. The difficulty arises from the broad scope of the topic, requiring a comprehensive
understanding of various aspects of the English language. The writer must navigate through
grammar rules, vocabulary nuances, and the intricacies of effective communication.
One of the challenges lies in striking the right balance between creativity and adherence to
formal structures. The essay demands a fluid expression of thoughts while adhering to the
conventions of academic writing. It requires a delicate interplay between personal insight and
established norms, making it a task that demands a nuanced approach.
Furthermore, the writer must grapple with the vastness of the subject. English, as a language, is
rich and diverse, encompassing literature, linguistics, and communication studies. To cover this
wide array of topics comprehensively, one must invest time in research, reading, and critical
analysis.
Despite its difficulties, the process of writing an essay on "General English Essays" offers an
opportunity for self-reflection and intellectual growth. It encourages the writer to refine their
language skills, develop a coherent argument, and present ideas in a clear and compelling manner.
The challenge, in essence, becomes a learning experience, shaping not only the essay but also the
writer's own understanding of the subject.
In conclusion, tackling an essay on "General English Essays" demands a careful balance between
creativity and formalism, as well as a thorough exploration of the vast realms of the English
language. The writer must navigate linguistic intricacies, engage with diverse topics, and present
a well-structured, insightful piece of writing. It is a task that, while challenging, holds the
promise of personal and intellectual development.
If you find yourself struggling with such tasks, it's worth noting that there are resources available
to assist you. Similar essays and much more can be ordered on platforms like HelpWriting.net,
providing a valuable support system for those seeking assistance in their academic endeavors.
General English EssaysGeneral English Essays

Zora Neale Hurston Quotes
Sumer Muqbil
June 1, 2018
Chapters 3 5
Text Evidence
Analysis
Effect
Janie pulled back a long time because he did not represent sun up and pollen and
blooming trees, but he spoke for far horizon. He spoke for change and chance (Zora
Neale Hurston 29).
The characters involved in this are Janie and Joe Starks. Janie believes that sun up
and pollen and blooming trees are familiar and what she knows about love as well as
her ideal love. They also represent sexuality, and Joe Starks represents change and
possibly love, but Janie doesn t want to give him her love too fast. This quote is a
metaphor.
What s being represented here is Janie s version of love that is the pear tree and sun,
and that s being compared to the love that she could find in Joe Starks, where he
represents a change and something different than what Janie knows. It reveals ...
Show more content on Helpwriting.net ...
Man attempting to climb to painless heights from his dunghill pg.76
Janie can t see her worth because Jody keeps telling her that she means nothing, and
he continually hurts her while trying to climb to painless heights he s hurting
everyone, including himself. The heavens are Janie, so it s a metaphor.
This provides a bigger effect later in the chapters, when Jody dies so Janie is then
able to live as she wnatw without Jody tearing her down, so she can finally figure out
that she IS the heavens. This represents a new beginning. Nature is represented in this
because it talks about man attempting to climb to painless heights, and in this case the
painless heights are success and fame.
Some people could look at a mud puddle and see an ocean with ships. But Nanny
belonged to that other kind that loved to deal in scraps. Here Nanny had taken the
biggest thing God ever made, the horizon... and pinched it in to such a little bit of a
thing that she could tie it about her granddaughters neck tight enough to choke her

Education Acts and Reports
EDUCATION ACTS AND REPORTS
INTRODUCTION
Integration of the various racial and ethnic groups, the central aim of the 1 Malaysia
concept, had always been the primary concern of the governments education policy
since Independence in 1957. In fact the Razak education report of 1956 and the
Rahman Talib report of 1960 had delineated clear guidelines and emphasise national
integration.
Compare and contrast out the aims and provision of Barnes Report (1950), Fenn Wu
Report (1951), the Razak Report (1956) and the Rahman Talib Report (1960).
After World War Two, the educationsystem in Malaya was pretty much in shambles,
and until Malaya achieved her independence in 1957, much had to be done to map
out a new education system for the nation. ... Show more content on Helpwriting.net
...
The main issues in the National Education were: i) The desire to form one National
Education System for all races; ii) To make the Malay language the main medium of
instruction; iii) To establish a curriculum orientated towards the local environment
through the formulation of a common education syllabus with similar contents; and
iv) Strengthen the National Education System for all students in it.
The development of the formation of the Education Act was continued in order to
resolve several requests voiced by the different races in Malaysia and to improve on
suggestions recommended in the Razak Report. This was known as the Rahman Talib
Report (1960) and it became the basis for the formation of the 1961 Education Act.
Amongst the changes and amendments made to the Razak Report were: primary
education was free; primary schools became national schools and national type
schools; advanced education was extended to 15 years of age; students advanced to
the next standard automatically; Islamic studies for students when there were not less
than 15 students; and Moral education was given due attention.
After the 1960 Abdul Rahman Talib Report, there come more reports for example
the Hussien Onn Report (1971) and 1979 Mahathir Report. Both these Reports were
done to re examine the Country s Education Policy which was based on the Razak
and Rahman Talib Reports.
The 1996 Education

Monetary policy of Kazakhstan
Paper Work
Economic Theory
Monetary Policy of Kazakhstan
Monetary policy is the process by which the monetary authority of a country controls
the supply of money, often targeting a rate of interest for the purpose of promoting
economic growth and stability. The official goals usually include relatively stable
prices and low unemployment. Monetary theory provides insight into how to craft
optimal monetary policy. It is referred to as either being expansionary or
contractionary, where an expansionary policy increases the total supply of money in
the economy more rapidly than usual, and contractionary policy expands the money
supply more slowly than usual or even shrinks it. Expansionary policy is traditionally
used to try to combat ... Show more content on Helpwriting.net ...
The primary goal of Kazakhstan National Bank is to ensure the stability of prices in
Kazakhstan.
Tasks:
development and implementation of the state s monetary policy; support of payment
system functioning; implementation of foreign exchange regulation and foreign
exchange control; assistance for maintenance of financial system s stability.
Functions:
realization of the state monetary policy in Kazakhstan; issuance of banknotes and
coins on the territory of Kazakhstan; the function of a bank of banks; the financial
advisor and financial agent of the Kazakhstan Government; organization and
supervision of functioning of payment system; realization of currency control and
currency regulation in Kazakhstan; management of the gold currency assets of the
National Bank of Kazakhstan; control and supervision over the activities of the
financial organizations and regulation of their activities within the competence of the
National Bank of Kazakhstan; management of assets of the National fund of
Kazakhstan.
Trends in Central Banking: The central bank influences interest rates by expanding or
contracting the monetary base, which consists of currency in circulation and banks
reserves on deposit at the central bank. The primary way that the central bank can
affect the monetary base is by open market operations or sales and purchases of
second hand government debt,

The Legend Of The Magician
Merlin the Magician in an important fictional character throughout legends and
history. He is known as a powerful sorcerer and a mentor for the future King Arthur.
His magical abilities include shapeshifting, spells, and foresight.
According to legend, Merlin was born during the rule of King Vortigern, a 5th
century warlord, in Carmarthen, Wales. He was given the name Myrddin Emrys, or
Ambrosius, by his mother, the princess of Dyfed, whose father was a sub king (King
s second in command). Merlin isn t just a character from the Arthurian Legends,
Writer Geoffrey of Monmouth is credited with creating Merlin in his 1136 A.D.
work, Historia Regum Britanniae The History of Kings of Britain. While a large
portion of Historia Regum Britanniae is a historical account of former kings of
Britain, Merlin was included as a fictional character (although it is likely that
Geoffrey intended for readers to believe he was a figure extracted from long lost
ancient texts). (Ancient Origins, The legendary Origins of Merlin the Magician) This
places his first appearance in the early 10th century, since then Merlin has been in
several different stories other than the Legend of King Arthur.
Merlin was derived from several different people scattered through history and
legend. These include the Myrddin Wyllt, a madman, Romano, a British war leader,
and trickster Ambrosius Aurelianus, for who Merlin was named. There are three
people who share the exact same story. They were the welsh Myrddin,

Ethical Issues In The Movie The Best Man
Good Morning Guys,
I viewed the clip last night but had some time this morning to give my input on it. I
will be focusing on Care ethics involving
In this movie The Best Man Holiday the scene between husband and wife, Lance
and Mia, forgiveness is a strong dynamic. Mia wants her Lance to forgive, Harper a
longtime friend for secretly writing a book on their family. Lance refuses and states
that he hates Harper and will never forgive him. The dynamic of Harper, Mia and
Lance goes further back to the first movie The Best Man when Mia had sexual
relationship with Harper to hurt Lance. Lance harbored this anger and resentment
towards Harper for years and their relationship was never the same. Care Ethics is
about focusing on the moral aspect

`` The Hive `` By Marshall Poe And Small Change By
Malcolm...
The way that people now communicate with each other has changed drastically in
the last 20 years. Technological devices like cell phones or computers that used to
be just accessories now became a must in our daily lives. A person cannot leave the
house without a phone since now the person might feel disconnected and
sometimes even lost. We now have the ability to communicate with people
thousands of miles away by just a few clicks. The quarrel is that this power made it
easier to connect us with people we love even if we never get to see them in real
life. In The Hive by Marshall Poe and Small Change by Malcolm Gladwell, both
authors talk about the advancement of communicationthrough social media. Poe
believes that social media revolutionize us as a community, yet Gladwell criticizes
it for being fake and not creating strong ties. Communication through social media
does not create strong ties between the people we are connected with, it creates a
deceitful sense of strength and interaction between people. It also alters an
individual s perception and makes it easy for people to show an image of
themselves that isn t who they really are. That is why people now a days even
though they may seem like they are more connected through social media outlets,
they really don t realize how week of a connection social media brings.
Sharing information before the advancement of the technology for communication
was a lot more difficult at one time. In the 18th century, a French

Termites Research Papers
Termite detection, prevention and treatment are something every homeowner in
North Texas must think about because termites are an ever present threat to any
kind of structure that contains wood or cellulose. In fact, termites are a problem in
every state of the United States with the exception of Alaska. So, even if you don t
suspect you have a termite problem that needs treatment, you likely will at some
point in the life of your home. That s why it s important to know a little bit about
this voracious enemy. Termites Really Are A Big Problem The many species of
termites, including Eastern subterranean termites, arid land subterranean termites,
Formosan subterranean termites, western drywood termites and desert dampwood
termites, are all ready, willing and able to eat your house or your business out from
under you. In fact, termites eat 24 hours a day, 7 days a week, so there is a very
good chance that termites are eating your home or your neighbor s home as you read
this. According to the National Pest Management Association, termites do $5 billion
dollars worth of property damage each year, which is why preventing or mitigating
an infestation is so important. Termites Aren t Good At Hiding Their Activity If you
re looking for the signs of termite activity,... Show more content on Helpwriting.net ...
Termites seek moisture so stop all drips and leaks inside and outside of your home.
Install rain gutters and downspouts to direct rainwater away from your home. Keep
firewood, brush, roots and debris away from the foundation of your home and make
sure there is a metal barrier between wooden structures, like decks and pergolas, and
the outside of your home. Removing this first course of their meal coupled with
keeping 18 inches of space between the soil and the foundation of your home will go
a long way toward making termites think twice before invading your

Allusions In Buffy The Vampire Slayer
Buffy the Vampire Slayer is a very popular show to teens and adults alike. The
show s screenwriter, Joss Whedon, studied literature in college, and therefore, the
show has layered episodes with literary elements like symbolism, metaphors, and
allusions. The show is easily very relatable to teenagers . Buffy expresses teenage
drama in a supernatural way that is interesting to watch. Buffy is also known for
its dialogue ,but this popular opinion is the reason why Whedon wrote the episode
Hush . He was tired of hearing that a critical part of the series was the dialogue so
he wrote an episode that had silence fourteen minutes into the episode.. The
original airing of Hush received 6.6 million views and the episode was nominated
for an Emmy. In the episode Hush , there are multiple instances where the
characters show that words are not as important as actions. Buffy is the main
character of the series and in this season she has a love interest named Riley. While
it is clear they both have feelings for each other, they are terrible at communicating.
For one, Buffy and Riley both lie about their true identities to each other. Buffy is
the slayer, which means she protects mankind from monsters like vampires and
werewolves. After a class discussion, the couple begin to talk. During the
conversation, Buffy accidentally tells Riley she will be patrolling later that day,
which she quickly covers up. While Buffy is the Slayer, Riley works for the
government, protecting people as

The Monarch Butterfly Annual Migration
Introduction
The monarch butterfly annual migration is a visually spectacular feat, in terms of the
number of butterflies flying to their overwintering sites and as well as the masses that
congregates at the overwintering sites in Mexico. The idea that monarch butterflies
exhibited migratory behavior was once controversial, it was not until Fred Urquhart
and his colleagues pioneered a tagging work with the eastern North American
population for decades that revealed the long distance of the monarch migration. The
tagging efforts that began in 1937 lead to the discovery of their overwintering sites in
Mexico in 1975. With its long distance traveled and the nature of the predictable and
the repetitive nature of its annual migration. The ... Show more content on
Helpwriting.net ...
Environmental factors such as the decrease in day length, cooler temperature and
aging milkweed trigger the monarch to begin its migration, although the precise
environmental trigger that initiates migration is not well understood. When spring
arrives, they become reproductively active, mate and leave Mexico to re migrate
north. During the remigration northward the females lay fertilized eggs on newly
emerged milkweeds in the southern parts of the United States (Reppert and others
2010). Their offspring s will also continue the migration up northward to repopulate
the northern section of the monarch habitat range. Even though the monarch
migration is repetitive and cyclic in nature, their migration cycle is multigenerational.
It takes about two generations of spring and summer butterflies that are following the
progressive northward emergence of milkweeds to repopulate the entire range and
therefore completing the migration cycle (Reppert and others 2010).
Time Compensated Sun Compass (The Navigational process)
The Monarch butterfly uses a map and a compass like other long distance migrants.
The map sense is needed to determine which direction they are to fly and to stop. The
compass sense is utilized so that the migrants can orient in the southern direction
throughout the course of their migration. It has been shown that the monarch may
not have a true map sense, although the monarch

Varsity Team Scenarios
Get ready to cheer on your Chino Hills High Baseball team this year Huskies!
Varsity coaches, Coach Kevin Chavez and Coach Sean Casey are looking to lead
this year s team to another winning season to capture first place in League. This
year s Varsity team has a deep pitching rotation that is essential for the team s
success. This rotation includes: Dakota Fine, Carson Conradt, Chris Chavez,
Jacob Hobson, Ricky Walczak, Michael Rogers, Noah Calderon, Preston Kelly, and
Mikey Rosales. The team s offense will be capped by Cal State Fullerton commit
Brett Borgogno and Chris Chavez s power bat. The team s biggest asset when it
comes to winning will be playing small ball. Small ball is the element of the game
that is seen as small, but effective,

Essay On Bangladesh Genocide
The Bangladesh genocide started with Operation Searchlight, a planned military
pacification carried out by the west Pakistan Army against east Pakistan that began on
25 March, 1971. The goal was to curb the Bengali nationalist movement by taking
control of the major cities and then eliminating all opposition, political or military.
The people of Pakistan wanted to systematically deprive the Bihari community
culturally, economically and politically. Pakistan was known as West Pakistan and
what is now Bangladesh was known as East Pakistan. West Pakistan wanted to
culturally assimilate Bengalis culturally. During the nine month long Bangladesh war
for independence, members of the Pakistani military and supporting Islamist militias
from Jamaat e Islami... Show more content on Helpwriting.net ...
Pakistan could not gather international support, it fought a lone battle with few
countries supporting it. The United Nations condemned the human rights violations
made by Pakistan but they failed to restrain the situation politically before the start
of the war. Following the declaration of independence in March 1971, a campaign
was launched by the Provisional Government of Bangladesh to gather political
support for the independence of East Pakistan as well as humanitarian support for
the Bengali people. India provided major diplomatic and political support to the
Bangladesh movement. Pakistan wanted India to agree to a ceasefire and asked the
UN to intervene but by the time their proposal was finished, Pakistan s forces had
surrendered and the war was over. Pakistan was sought for war crimes but the
Bangladeshi government was not interested in gathering evidence because of fear
that Pakistan and other Muslim states wouldn t Bangladesh official recognition. This
genocide could not have been prevented. West and East Pakistan were once one
country, but they were a divided one. Eventually East Pakistan was going to want
independence from the West which would have resulted in a civil war just like the
Bangladesh Liberation war. Relations between Bangladesh and Pakistan improved in
the years following the genocide. To this day, Pakistan refuses to acknowledge

The Symbiotic Relationship Between Myth And Reality
Abstract: The symbiotic relationship between powers of mythical stories to assist
transformational change in human lives. The purpose of this research paper is to
explore the power of myth in transforming human lives, it establishes patterns in the
human psyche affects the way of thinking as myths unveil various subjects, ideas, and
challenges.
Each one of us bears countless stories inside ourselves of our own lives and all its
happenings. Therefore, each being is a natural narrator. Everybody tells stories about
their lives; hence, one tends to know oneself as well as seeks understanding of others
through them. When one remembers their stories they speak in narratives. As stated
by Jung, these narratives grow into a personal mythology one ... Show more content
on Helpwriting.net ...
Therefore, love becomes the catalyst for our progression toward becoming a better
human being. The lovers in the beginning of the myth are not quite the same as
they end up; their shared struggle for existence transforms them. Hence, we see
love exists on a mythical level and transforms the love operating on real level. The
story of Nala and Damayanti in Indian mythology speaks of true love which is put
to a test before the lovers unite. A beautiful depiction of two people in love is
shown when Damayanti had to choose Nala as her husband but the Gods tricked
her by assuming Nala s shape and form. Yet she is able to detect her beloved by his
perspiration beaded on his forehead and his shaking hands as only humans run
through this nervousness. There was a lesson in all that, she loved Nala so much
that she was even ready to reject Gods. Therefore, it s wonderful to experience that
deep love in couples. The mythical story of Nala has its ups and downs as he loses
his kingdom due to a dice game. He transforms himself and frees himself from this
addiction. Henceforth, he truly becomes a worthy king and is reunited with his
beloved, Damayanti. The myth generates a lesson that love spurs a new power, the
power of transformation lies in love, just as it did for Nala and Damayanti. (Bierlein,

divine roles matrix Essay
University of Phoenix Material
Divine Roles Across Cultures
Part I
Select one common divine role that recurs in world mythology.
Possible options of divine roles include the following: father or mother divinities,
divinities of war, home or hearth divinities, divinities of love, divinities of wisdom,
divinities of medicine or health, divinities of the wind, divinities of agriculture,
divinities of the sky, ruler of all the gods, and so on.
Identify the role in the title of your table.
Select two myths, each from a different culture, in which the divine role appears.
Identify the divinity names and cultures in columns A and B.
Complete the table by answering each of the five questions for both selected
divinities.
Title: ... Show more content on Helpwriting.net ...
Ymir was such a cruel god, Odin and the other gods could not tolerate it any longer
and plotted against and killed him. Then Odin and his brothers made all things from
the parts of Ymir s body. Odin had positive interaction with his brothers and they all
agreed he was the most powerful. His aunts, Ymir s sisters were very upset over the
death of their brother and constantly caused trouble for everyone.
5. Identify one character from contemporary culture that shares characteristics of
each divinity and explain why you chose each character. What real life ideals does
this divine role represent? How attainable are these ideals?
Zeus can be compared to Superman in the sense that he is powerful, he protects the
weak, and punishes the wicked. He is a human like god in a sense he commits
adultery, and is often to his wife Hera. The real life ideals represented by Zeus s role,
is one of a just and powerful character that gets justice against those that are bad
and by protecting the good and weak. For Zeus being the god over all the Olympian
gods it is quite easy to be powerful and just. In real life instance the justice system is
the one to execute injustice through the law, the police and court system. This
enables the victims that a sense of justice has been served.
There is a wicked side to Odin. He can be erratic and at times abuse his power by
causing or initiating wars. This has surfaced with many rulers throughout history. If
Odin were to be compared to a

Mccarthyism In Dracula
Alongside society, art, and literature, the character of the vampire, too, has evolved.
While the old, cliched character of a vampire has usually been depicted as a cold
blooded, nefarious villain, contemporary vampires, however, possess qualities which
illustrate them to be more affectionate and compassionate. A noteworthy example of
this is Edward Cullen from Stephenie Meyers Twilight. The origins of the idea of
how a vampirecan coexist with humans in society and be capable of sympathy can
be traced back to The Interview with the Vampire, written by Anne Rice, in 1976.
While Twilight is a modern phenomenon, it was Bram Stoker s Draculathat defined
the vampire back in the late 18th century.
Dracula is described as, a tall old man, clean shaven save for a long white
moustache, and clad in black from head to foot, without a single speck of colour
about him anywhere. (Stoker 15). Dracula s description proves how he was abnormal
and different to humans. He is ... Show more content on Helpwriting.net ...
What enabled Dracula to become a chilling villain is perhaps where he comes from,
Transylvania, an eerie, obscure area with *strange* individuals and norms. Perhaps,
during that time , the masses of Stoker s nation, England, were not open to
individuals of foreign cultures and ethnicities. The xenophobic aura of England
during the Victorian era facilitated Stoker to create a character the ordinary reader
would despise, yet fear.
Out of the many characteristics that transformed along with vampires in literature, the
most profound of those changes were towards normalcy. Edward Cullen from
Twilight can be part of a functioning society without individuals suspecting a vampire
amongst them. Despite his vampiric roots, he was rather different to Dracula. Edward
understood he was condemned

The Works of Magritte Essay
Rene Magritte was an enigmatic and strange man who painted surrealism paintings.
Little is known about his childhood except that his mother, Regine Magritte took
her own life by drowning herself in the Sambre river. Young Magritte is thought to
have discovered her body floating with her night garment covering her face. There
is speculation that this trauma was an influence on many of Magritte s works.
When Rene Magritte took up his brushes, he created beautiful visual riddles that
delight and bewilder the viewer. His clean lines and highly detailed finishes made
his brush strokes nearly invisible; his paintings look as if they came from a printing
press. Magritte referred to his paintings as his labors. He did labor over the paintings
... Show more content on Helpwriting.net ...
The exploration of the mind and the way our conscious mind perceives the
symbols of our subconscious minds was new ground and it gave art a new voice
with which to sing. The surrealist artists believed the dream state and subconscious
mind to be an untapped and very fertile creative fount of inspiration. The
symbolism of dreams and the expressive images generated by the subconscious
were far more thought provoking than the representational, logical images of the
conscious mind. The surrealist artists were creating art out of what others thought
to be garbled and unintelligible. They were in effect taking a concept created to
heal and using it to create art instead. They were on to something with this. No
matter what the medium or the style used, a bit of the self becomes visible and
evident in the result. Art therapy is one of the modern descendants of this
movement. The movement spread and soon there were surrealist groups cropping
up in the metro areas of the world. It was around this same time that Rene Magritte
was shown a painting by Giorgio de Chirico and soon became member of the
surrealist group. Today, the name Magritte has come to be synonymous with
Surrealism. It may have been that Magritte felt attraction to the surrealist movement
because of its ability to convey an idea with great eloquence as well as its focus on
the deeply meaningful rather than the superficial. His statement about the works of
Giorgio de Chirico supports this

Grounding Meditation
Today I decided to do the meditation called Grounding Meditation it is the 3rd
meditation for my assignment Your Journal Activity . I am hoping it helps me
with grounding. I had to try this one a few times before I could turn my brain off
some to meditate. I did go to a quiet place and sat comfortable in a chair. I also lit a
couple of candles and a sage incense which both help to relax me. Once I was all set I
closed my eyes and took several deep breaths and started to meditate. Before
meditationit had been a rough morning and my anxiety was up very high. As I
started to meditate I slowly felt myself relax and then visualize the roots leaving my
feet and entering the earth going deeper and deeper. By the timethe roots reached the
core

Christology
Christology is important for me to understand my own form of Christianity. But
there is a danger here, too. According my study of this topic, the Christology can be
very disturbing for me as divinity major who come to study more about faith
background. I find hard because some authors they have always taken the topic to far
too represent the faith. The study of Christology opens up questions over what one
believes and how that belief impacts one s life. I think it not only me struggling about
this top but I hope most people find themselves stumbling into areas or questions that
they had never before considered. Furthermore, how much more we might say about
this axiom apply to the Pauline epistles. Paul had ability to make a relatively clear
point to us. Therefore, I affirm that Christianityhas always been a faith in the
Incarnation in one form or another. We can be sure as... Show more content on
Helpwriting.net ...
Rather than an image of the descending preexistent redeemer, Dunn argues that this
is a case rather of Paul s Second Adam Christology (Dunn258f). The author says
Incarnation became steadily more central as the decisive act of redemption a
tendency already evident in Irenaeus who can speak of Christ attaching man to God
by his own incarnation (Adv. Haer. V.1.1) so that later theology had to look for
meaning in Christ s death more as the paying of a ransom to the devil than as the
ending of the first Adam that last Adam might come to be ( Dunn 128). I think
Dunn was argued about the Romans 3.23 All have sinned and fallen short of the
glory of God, Dunn translates hysterountai not as fallen short but as fail to reach as
in All have sinned and failed to reach the glory of God. In other words Dunn is
attempting to say they lack the glory of God in the sense that they fail to reach the
eschatological glory in which only the righteous will share...there is a growing
consensus among recent commentators that the primary allusion is to the glory once
enjoyed by Adam

Starbucks Total Reward Management Case Study
Total Reward Management Starbucks is one of the most recognized brands in the
country. It specializes in coffee brewing, although it has diversified its products to
include tea and milk based beverages. The company s total reward management
system includes both the traditional and the custom made benefits. The company s
total rewarding system is called Your Special Blend . It includes several perks,
assistance, and benefits. The company checks whether the partners are eligible twice
every year. In order for partners to qualify, they must have worked a minimum of 520
hours. The system utilized by the company offers professional growth opportunities
through the educational assistance program (Starbucks, 2012). The recognition
offered acts as... Show more content on Helpwriting.net ...
The students receive tuition discounts at the City University of Seattle and at
Strayer University. Partners also get tuition reimbursement for partners who are
already qualified to receive benefits and who have offered their services for one
continuous year. The company offers vacation benefits, which are dependent on a
partner s position, place of work, and length of service. Partners who choose to
work during holidays are paid one and a half times their base hourly rate. All the
partners who have worked in the company for at least ninety days are eligible for a
401(k) program. The company matches the workers contribution by adding 100% of
what the partners pay on the first 4% of the eligible pay. In addition, the company
has an equity reward program and a discounted stock purchase plan. Partners get
tuition assistance, education benefits, and paid vacations. Starbucks has a
recognition program. The company recognizes the contributions made by workers at
all levels of achievement. It offers discounts for in store merchandise. Partners do
not have to pay for the beverages they take while on their work breaks (Starbucks,

Cross- Cultural Communication
We didn t all come over on the same ship, but we re all in the same boat. Bernard
Baruch
Cross cultural communication is the process of exchanging meaningful and
unambiguous information across cultural boundaries, in a way that preserves mutual
respect and minimizes antagonism, that is, it looks at how people from differing
cultural backgrounds endeavour to communicate. The study of cross cultural
communication was originally found within businesses and the government both
seeking to expand globally. Communication is interactive, so an important influence
on its effectiveness is our relationship with others. All communication is cultural it
draws on ways we have learned to speak and give nonverbal messages. We do not
always ... Show more content on Helpwriting.net ...
good/bad, right/wrong) which can only be nurtured through both cross cultural
knowledge and awareness. Cross Cultural Competence is and should be the aim of all
those dealing with multicultural clients, customers or colleagues. Competence is the
final stage of cross cultural understanding and signifies the actor s ability to work
effectively across cultures. Cross cultural competency is beyond knowledge,
awareness and sensitivity in that it is the digestion, integration and transformation of
all the skills and information acquired through them, applied to create cultural
synergy within the workplace.
Following are the five cross cultural communication needs that will allow for
improved lines of communication, better cross cultural awareness and more
successful cross cultural relationships
Cross Cultural Communication needs .Listening Skills
Although emphasis usually lies on being a competent speaker, listening is a key skill
that many business personnel do not exercise enough. For cross cultural
communication, attentive listening is critical to be able to understand meanings, read
between the lines and enable to empathize with the speaker.
Cross Cultural Communication needs. Speaking Skills
Listening and speaking must work in tandem for effective cross cultural
communication. Speaking well is not about accent, use of grammar and vocabulary
or having the gift

Axum, Aksum In Northern Ethiopia
Askum, Axum Just like Axum, Aksum was found in Northern Ethiopia. It was the
core of Arabia, Africa, and Greco Roman. Due to this, it was a great place for routes
to trade. The ancient Aksumite Civilization ruins concealed a large area in the Tigray
Plateau. The royal tombs, monolithic obelisks, and the palace were the most
impressive monuments. They originated from the 6th and 7th centuries AD. Close to
Ethiopias northern border you can find the ruins of the ancient city of Aksum. They
point out where the heart of ancient Ethiopia was located during the time that Aksum
was the leading state between the Roman Empire and Persia. The magnitude of
importance for this event in history should maintain significant perpetually. Great
Zimbabwe National

Stanislavsky Framework
Konstantin Sergeyevich Stanislavsky was a Russian performing artist and theater
chief. The Stanislavsky framework has had a pervasive impact, particularly in the
period after World War II. Stanislavsky regarded theater production as a genuine
attempt obliging devotion, order and respectability. For the duration of his life, he
subjected his own particular acting to a procedure of thorough masterful self
examination and reflection. His improvement of an estimated praxis in which
practice is utilized as a method of request and hypothesis as an impetus for
imaginative advancement recognizes him as one of the colossal cutting edge theater
professionals. Stanislavsky s work was as vital to the advancement of communist
authenticity in the Soviet... Show more content on Helpwriting.net ...
He made a proposition to Fyodor Sollogub and Alexander Fedotov to build up a
general public that would unite novice and expert performing artists and
specialists. The benefits from his family s processing plant were especially high in
1887 1888; Stanislavsky chose to utilize the surplus 25,000 30,000 roubles to frame
the General public of Workmanship and Writing, for which he had the Ginzburg
House on Tverskaya Road changed over into an extravagant clubhouse with its own
particular substantial stage and show rooms. Fedotov got to be leader of the
emotional area, Komissarzhevsky was the leader of the operatic and musical
segment, while Sollogub was designated leader of the realistic expressions segment;
the dramatization and musical drama areas each had a school. To inquire about the
educational module of the general public s dramatization school, Stanislavsky spent
the late spring of 1888 considering the classes and exhibitions of the ComГ©die
FranГ§aise in

Cradle Vs PET Bottles
According journalist Eric Goldschein, the United States drank 9 billion gallons of
water in 2008 (Business Insider). Therefore, in order to prevent access waste and
build up of plastic from the water bottles, many different varieties of reusable water
bottles on the market today advertise the message of an eco friendly product. This
message, however, can be easily adulterated and twisted in the manufacturer s favor
for simply business purposes, thus promoting bottles that have only the perk of
being used many times before they are eventually discarded, ultimately falsifying the
term reusable . When compared to the message of perpetual reusability, as well as
the five steps to eco effectiveness, put forth in the book Cradle to Cradle... Show
more content on Helpwriting.net ...
Although reusable plastics are more resistant to the factors that cause this
limitation, it does not mean plastic products fall prey to off gassing. Factors such
as sun exposure, microwave radiation, and the heat from being washed in a
dishwasher all help contribute to plastic off gassing. Some BPA free reusable
bottles have even been found to contain and release estrogen like synthetics that are
even more harmful than the ever feared BPA. Reusable bottles also have a
mechanical flaw: structure. Despite their impact resistant guarantee, if they hit a
surface hard enough they can, and will crack. Obviously if the bottle gains a major
structural flaw such as a crack it is going to be thrown away by the owner and find
itself in a landfill amongst its PET cousins, free to leak its chemicals into the
surrounding environment.
Bottle manufacturers should stop using plastic in general. Plastic bottles, especially
PET plastic bottles, have a nasty tendency to off gas, thus releasing dangerous
chemicals into the users drink. These chemicals rage from antimony to phthalates, as
well as other endocrine disrupters and synthetic estrogens. This leaching of harmful
chemicals is the cause of the plastic bottles popularity decline. Nonetheless, there are
many other styles of drink bottle to choose from, ranging from glass to stainless

The Mobile Food Bank Delivery Service
The Mobile Food Bank delivery service serves as an 8 month pilot project and may
possibly satisfy the needs of people with mobility issues. As stated earlier, this
project also aims to deliver to approximately 50 households bi weekly in Halifax.
Ultimately, this project hopes to improve food security in Halifax. However, there are
a few evident and visible barriers that exist, amongst these are finding the financial
support for this project, and most importantly, the effectiveness of the project.
Since this 8 month project is a non profit project that does not aim to sell food, but
rather to give food to those who are in need instead, there is no need to apply for a
Food Establishment Permit (Nova Scotia, 2015). However, if the project committees
wish to organize any fundraisers prior to the start of the project, which includes food
booths or mobile canteens that involves selling food at temporary events, it is then
necessary that the project committee applies for a Temporary Event Permit (Nova
Scotia, 2015).
In addition to fundraising events, there are also several grants that are available.
However, grants do not provide a guaranteed source of income. Applying for grants
is an arduous task, which would fall under the responsibilities of the project
employee, and the start of the project would be dependent on the employee s ability
to secure the finances.
Barrier 2: Annual Increase in Food Prices and Accessibility
Figure #. Price of a fixed basket of goods from 2010 to

Analysis Of Kelly Clarkson s Piece
Learning to Trust: Kelly Clarkson Piece by Piece
A recent performance that captured not only the audience but also the judges on
American Idol by Kelly Clarkson called Piece By Piece not only had everybody in
tears but also in complete awe. This performance became huge in the world of
Facebook, so many people watching the video, sharing the video, and telling their
stories about their feelings related to the lyrics. Throughout this essay I will be
discussing Kelly Clarkson s journey throughout her life, how single family parenting
is impacting the society, how the outlook on single family homes have changed
throughout generations because it is becoming more of a norm and finally the
emotional connection to the songs that she has written in regards to her father and
the struggles she has faced throughout her life. To me Kelly has a way of capturing
her audience and pulling them into the songs and really making the lyrics make
sense, and helping people in similar situations realize that they are not alone in their
struggles. Watching the judges including Keith Urban sit and cry at her performance,
showed how much this song really spoke to so many people, and got me crying even
harder then I was just listening to the song. Kelly has been a huge success since
winning the first season of American Idol. She came back to perform this powerful
piece on their final show. Even watching Jennifer Lopez reaction was hard to see.
Everybody was just pulled into this song and you

Nuclear Power Of A Nuclear Plant
A nuclear plant is a power station that generates electricity using nuclear energy by
heat. Fukushima Daiichi Nuclear Power Plant is a disable nuclear power plant in
Japan. It was first committed in 1971. An accident happened on the 11th March 2011
and high radioactive releases within a week has made huge damages and impact on
the environment the population. Only two events like this have happened in the
history. The other one was Chernobyl accident in April 1986.
Nuclear plants work the same way as plants that burn oil or gas, which then boils
water to produce steam that turns turbines and produce electricity. But the difference
is that nuclear power plant do not burn anything like others do, instead, they use
uranium 235. All these processes will be happening in a sealed environment, which in
Japan was the Fukushima Daishi Nuclear Plant Station.
All the disasters were started by an earthquake. The huge earthquakes then caused a
15 metre tsunami disabled the power supply and cooling of three Fukushima Daiichi
reactors. As the tsunami wave keep on hitting all the pools, reactors and where the
generating of heat takes place, all parts of the station have had huge losses and
damages. All 4 units had lost power at 3.42 pm, almost an hour after the quake, when
the entire site was flooded by the 15 metre tsunami. Eleven reactors at four nuclear
power plants in the region were operating at the time and all shut down automatically
when the quake hit. When the diesel generators

Case Study Of Bon Secours Hospital
Bon Secours Hospital in Galway is one of five facilities of a Catholic, private system
that provides compassionate and excellent quality healthcare to those in need. Bon
Secours means good help in French.
After the French Revolution twelve women living in Paris began nursing the sick.
Josephine Potel became their leader, and in January 1824, formed first profession
as Bon Secours Sisters. News about their care escalated very fast and other women
joined the group providing healing to rich and poor. Sisters of Bon Secours spread
their work around France and soon after abroad as well.
First foreign foundation was formed in Ireland in 1861, followed by establishing a
convent in London in 1870. In 1948, Sisters also started working in Scotland. ... Show
The board is read in conjunction with the fire alarm panel that contain zone
description, zone number, device number. This information is transferred to the fire
information board to and the matrix is used to determine if staff should evacuate or
standby for each department.
Q Pulse is an online programme which contains data about corrective and preventing
actions taken by anyone at any given time within the hospital. A lot of data used in
the placement was found in this system. Q Pulse Systems and Framework include:
Document Control The module contains the complete document management
lifecycle. All actions and notifications associated with change requests, change
history, drafting, approvals, and distribution. Module also provides the access to a
single document material providing quick entry in the context of whatever is being
worked

A Short Summary Of Chapter 2 Self-Realization On Page
117...
In chapter 2 self realization on page 117 Krishna states, You were never born; you
will never die. You have never changed. Our soul is a constant energy. Energy can
neither be created nor destroyed. Krishna is saying that your soul will not die when
your body that is in dies. Often when someone passes you still have this notion that
their soulis looking over you.
Our bodies give us our human looks but our souls are what gives us personality
gives us what makes us who we are. Krishna goes onto say in chapter 2 on page
117, As one abandons worn out clothes and acquires new ones, so when the body is
worn out a new one is acquired by the Self, who lives within. I think Krishna is
touching on the idea that when one body that a soul is in

How Is Abigail Presented In The Crucible
Abigail Williams a strikingly beautiful girl, an orphan, with an endless capacity for
dissembling (Crucible, Act 1, 8 9). She is also one of the main characters in Arthur
Miller s The Crucible. The play is set during the Salem Witch Trials in the 17th
century where innocent people had been accused of witchcraft and where punished
for it. Abigail is the character that starts the accusations and threatens other girls
into joining her. She can be considered villainous for the reasons that: she chooses
to drink a charm to kill a person, she manipulates girls to lie, and she provides false
evidence to punish people she has grudges against. One of the first villainous things
Abigail does in the play is drinking a charm to murder someone. She does this since
she is jealous of John Proctors wife, Elizabeth, seeing as she and John previously
had an affair. Abigail rudely describes her as a cold, sniveling woman (Act 1, 24)
who is blackening my name in the... Show more content on Helpwriting.net ...
On account of her loathing of Elizabeth Proctor, she decides to accuse her of
witchcraft so she can eliminate her. Her plan is staging a scene where a needle
stabs her two inches in the flesh of her belly (Act 2, 74). And so, she would claim
Elizabeth s familiar spirt that had pushed it in (Act 2, 74). According to her plan, a
court clerk would come to the Proctors house to arrest Elizabeth on account of
finding a poppet with a needle stuck in it. Although, Danforth would confront
Abigail saying, Mary Warren claims that you sat beside her in the court when she
made it, and that you saw her make it and witnessed how she herself stuck her
needle in it for safekeeping (Act 3, 103). Insistent on getting her way through lying
even if it meant condemning her friend, she contests Mary by expressing, It s a lie,
sir (Act 3, 103). Through falsely accusing people, Abigail continues to prove she has
a corrupt

Bulimia Nervosa Essay
Eating disorders such as Anorexia Nervosa and Bulimia Nervosa has a major
impact on the oral cavity. These eating disorders are psychiatric illnesses that are
associated with a person s perception of their self, they have a disturbed self
perception of body image, weight and shape.
Anorexia Nervosa is defined by the American Psychiatric Associations Diagnostic and
Statistical
Manuel on Mental Disorders, 4th edition (DSM IV) as a refusal to maintain body
weight at or above 85% of the normal weight for an age and height, along with a fear
of gaining weight.
People with anorexia go into semi starvation state, which the body is unable to absorb
the nutrients it needs from food. Bulimia Nervosa is defined in DSM IV as episodes
of binge ... Show more content on Helpwriting.net ...
The anorexic individual has oral hygiene that is worse than an individual with
bulimia. The poor hygiene causes increased plaque development and gingivitis. The
effects of bulimia nervosa can be more severe than anorexia due to the frequent
binging and purging. Tooth decay, soft palate damage and salivary gland enlargement
are three complications of bulimia nervosa that affects the teeth and oral cavity. The
frequent purging wears away tooth enamel from the acidic gastric contents from the
stomach. As the enamel wears away, then the dentin of the tooth starts to erode. If
the erosion becomes severe enough, the pulp of the teeth is exposed which can lead
of infection and pulp death. Teeth may become brittle and weak. The tips of the teeth
becomes thin and breaks off easily. Erosion can change the appearance of the teeth,
they can be yellow, translucent or have a glassy appearance. The frequent purging an
also change the alignment, shape and length of the teeth. The erosion of the tooth
enamel can cause the teeth to be sensitive to hot and cold temperatures. Soft palate
injury are the result due to the use of objects, such as pens, combs, fingers and other
objects to

Norway and Its Economic Policies
Analytical essay on the Norwegian economic policies
Written by: JГіzsef GazsГі Module leader: PГ©ter BГЎrczy Module: Economic
Policies Wordcount: 3200
Introduction
The purpose of this essay is to examine Norway from the perspective of its
economic policies. I am trying to pay special attention to its recession resolution
technique in order to understand better why this country could preserve itself
against the most severe financial crisis of the last few decades. The reason why I
picked Norway as a topic is because I lived half a year there as an exchange student.
Apparently, I was there when the crisis was the most threatening to all the European
countries (in the autumn semester of 2008). However, I did not notice huge changes
in the ... Show more content on Helpwriting.net ...
The largest controversy regarding monetary policy in 2009 was probably the rate cut
in June, and to a lesser extent in May. By then, the economy had begun showing signs
of improvement, the government s expansionary fiscal policy was just starting to
have an impact, and the financial markets had improved rapidly on the back of lower
interest rates, government guarantees and ample liquidity. Along with the strong
signs that the economy was improving, there were growing concerns that the
extraordinarily low interest rates could initiate a housing market bubble. House
prices started to increase in January 2009, and have continued to climb gradually
back to their pre crisis levels. Some leading indicators and the strong recovery in the
financial and asset markets suggested an earlier recovery than what Norges Bank
emphasized at that time.
After the August meeting, Norges Bank communicated clearly its intention to start
its exit strategy. Norges Bank wanted to withdraw the extraordinary measures first
and then hike rates. On October 28, Norges Bank hiked rates by 25 basis points to
1.5 per cent and signalled that rates would be hiked by a further 25 basis points
either in December 2009 or February 2010 as for the monetary policy reports is the
following: Due to strong economic data, recovering financial markets, rising house
prices and a lack of pass through from the previous policy rate hikes to mortgage and
corporate rates, Norges Bank hiked

Modeling Uncertainty for Economic Effects in Tunisia and...
Modeling uncertainty for economic effects of echinococcosis were used initially in
studies in Tunisia and Jordan (Majorowski et al., 2005; Torgerson et al., 2001). This
has many advantages, most notably surveillance data from which the costs of the
disease can be calculated are not deterministic and depend, interalia upon sampling
error, errors due to diagnosis and problems with bias and underreporting. For financial
costs there will be uncertainty in the mean costof treatment due to large variations in
the treatment costs of individual patients. In developing the DALY there is also
uncertainty in terms of morbidity and mortality. In the Tibetan study (Budke et al.,
2004), the DALY for AE was developed, with disability outcomes divided
... Show
A significant challenge in estimating the burden of echinococcosis is that of
missing data. In wealthy countries there are often good data sets from public
health statistics or from hospital records. Thus relatively accurate estimates of the
incidence of disease can be made. However, most of the burden of echinococcosis
is in developing nations with 40% being in China alone (Budke et al., 2006). In
many areas even if treatment is available reporting systems are inaccurate and hence
there is likely to be significant underestimates of the true numbers affected by the
disease. This is illustrated by the estimated 75% underreporting in Chile and
Uzbekistan of cystic echinococcosis (Nazirov et al., 2002; Serra et al., 1999). For
communities where treatment is largely unavailable such as remote herdsmen
communities on the Tibetan plateau most of the data must come from carefully
planned surveys which will give an indication of point prevalences based on, for
example, cross sectional ultrasound surveillance studies. Such data can be used to
model the likely number of cases in society and the disease burden. A further problem
is that even utilizing such data, ultrasound will not diagnose pulmonary
echinococcosis and therefore this must be accounted for as this could be an
additional 10% or more cases. Estimates of the prevalence of undiagnosed cases need
to be undertaken as there is

Most Important Qualities Of An Outstanding Educator
The Most Important Qualities of an Outstanding Educator. By Mark Brest The most
important qualities of an outstanding educator can be evaluated using many
measures. One such measure is the educator s personality. The educator has the
opportunity to stimulate, inspire, and encourage a student by having an
approachable, affable, and genuine personality. An outstanding educator knows that
their presence, in a student s life, should be an inspiration to the student. On a daily
basis, an educator personality needs to set the mood in the classroom to be uplifting
and stimulating. Another important measure, that is important to consider, is an
educator s ability to be flexible. Students are not exact copies of each other and lesson
plans need to be designed to fit the students learning ability. An outstanding instructor
will use a variety of resources and teaching tools to reach all students in a meaningful
way. When a student is having difficulty, it is the responsibility of the educator to
change his or her approach to better teach the student because every student matters.
The wrong words can be destructive and humiliate a student while the right words
can inspire and encourage. In addition to choosing the right words, an educator s
body language can be a nonverbal form of communication that is a direct indicator
of their character. Facial expressions, eye movement, and gestures can say a lot
without a word even being spoken. The words and body language that an educator
chooses to express themselves with are driven by the educator s core values and
beliefs. Simply stated, an educator s core values and beliefs can be seen in the body
language and the words they choose to express themselves

Stock Car Racing
Racing has been a beloved sport for many years, by many people in America.
People are able to release their stress and focus on a hobby with friends and family
by racing many different forms of vehicles. Overtime, racing safety standards have
changed and become stricter in order to prevent fatalities. Unfortunately, there are
many dangers involved in racing. As time progresses, so does the modern technology
of many different forms of racing. Many different types of racecars are getting faster,
and in turn making them much more unsafe. Although, some may argue that as the
motorsports industry gets faster, the safety technology also gets more effective. The
National Association for Stock Car Racing (NASCAR) is one of the most popular
forms of... Show more content on Helpwriting.net ...
With over 75 million viewers, they must stay on top of safety to ensure no one is
hurt on live television or at the racetrack with families out having a great time. The
sport is not about people getting hurt, and it is time that drivers and families are
able to enjoy all types of racing, including NASCAR without the worry of fatality.
Although there is not a quick and cheap fix to preventing fatalities in racing, it is
important that technology is being put to its best use to lessen the chances.
NASCAR has came a long way in safety since the death of Dale Earnhardt.
Earnhardt s death was a huge and unfortunate wake up call to track owners,
families, and drivers. If they are going to race these cars, they need to utilize the
safety technology available to them. New and improved safety technology for
racing comes at a steep cost, but it is hard to put a price on life. The Peltzman
effect is a very interesting theory, which views new safety rules and regulations and
how they increase dangers in other forms. It was found after NASCAR made the
HANS device a requirement after Earnhardt s death, that cautions while racing were
more common. This Peltzman effect makes people rebel and become more
dangerous because they are implementing a new safety mechanism. This could be
because they feel more safe in their racecars, or that they believe it is unfair they
have to use the new

Protein Based Ligands For Tumor Targeting
In addition to peptides, protein based ligands such as Affibody proteins have been
utilized for tumor targeting. Anti epidermal growth factor receptor (EGFR)
Affibody protein (e.g., Ac Cys ZEGFR:1907, amino acid sequence: Ac
CVDNKFNKEMWAAWEEIRNLPNLNGWQMTAFIASLVDDPSQSANLLAEAKKLNDAQ
NH2) is used to target EGFR that is overexpressed in a wide variety of human
tumors. Cheng and co workers used anti EGFR Affibody proteinas tumortargeting
ligand on 64Cu Au IO nanoparticles (PET component: 64Cu, MRI component: iron
oxide, specific for EGFR) surface.[63] In their work, A431 tumor cells were
subcutaneously implanted in the right shoulders of nude mice; and 64Cu NOTA Au
IONP Affibody nanoparticles were administered via tail vain injection. Rather low
resolution PET image showed that these nanoparticles were taken by EGFR positive
A431 (human epithelial carcinoma cell line) cells reaching 4.6% ID/g at 24 h after
injection, significantly higher than that obtained from the blocking experiment
(1.9% ID/g) indicating the specificity of the probe. This difference in % ID/g values
corroborated with 44% drop in MRI signal intensity that was observed for the tumor.
In this study, the use of an Affibody protein as ligand for EGFR expressing tumor in
small animals was demonstrated to be successful; however, the benefit of
multimodality was not demonstrated. The unique chemistry of this dumbbell shaped
Au IO nanoprobe could pave the way for targeted drug delivery into EGFR
expressing tumors

Similarities Between The Ultimate Gift, And Grace...
Unconditional is the remarkably true story about the power of faith, love and hope.
Directed by Brent McCorkle, the story explores the lives of two best friends
Samantha Crawford and Joe Bradford who grow up together in a farm town in
Nashville Tennessee but later grow apart. The film portrays Samantha s characteras a
happily married woman living on the ranch with her beloved horse telling and
illustrating the stories she had told since childhood. However, when her world falls
apart following the death of her husband, she loses her faith and will to live and
decides taking matters into her own hands, but encounters a death defying encounter
with two children that changes her life. Within a moment of time she develops a new
friendship with the children that later leads to the unexpected reunion with Joe, her
oldest childhood friend.
Every film belongs to a film genre and it s this genre that leads the viewer to having
certain expectations of what he or she will see. Unconditional belongs to the film
genre of drama which is greatly dependent on the development of the characters, their
interactions and heightened emotions. Often when the film is directed well, the
viewer is able to experience what the characters are feeling and therefore ... Show
Unconditional presented many similar features and ideas to the films, The Ultimate
Gift, Grace Unplugged and Kings Faith. All three films explored the journey of the
characters and allowed the audience to relate and empathize with them. The films
had a lot of focus on the normal everyday characters who were dealing with
problems (Joe and Samantha) and suggested that when we don t underestimate the
power of friendship we find that in difficult times we realize the impact that our
friends have on our lives and the lives of many. This causes us to begin opening our
heart to the possibilities of regaining and rebuilding our broken

Building Finance And Operate For Procuring A Major
Public...
The basis of Design Build Finance and Operate for procuring a major public sector
project
For the past twenty years, as stated by Gil (2013) , the new way by which the rapid
demand of the public in terms of social vertical and horizontal infrastructures are
manage is generally referred to as the Public Private Partnership (PPP). As also
mentioned by HM Treasury (2008), all services under the public which are to be
executed by means of the Public Private Partner system are of the guarantee to be
implemented to the satisfaction of the client with the idea that all risks related issues
are passed over by the client to sector who organizes and effectively controls them
(HM Treasury, 2008). Consequently, PPIAF (2011) explains that over one hundred
nations around the globe have utilized the PPP scheme to implement public service
projects. Alshawi (2009) confirmed Private Finance Initiative (PFI) or Design,
Build, Finance and Operate (DBFO) as another category of PPP which the public
sector uses to transfer services of the public to a private sector for a substantial time
period. He also emphasises that the rationale for the Design, Build, Finance, and
Operate procurement method used worldwide by the public sector was due to the fact
that the private entity uses its finances and expertises and as well as the innovation
used in designing and managing facilities and infrastructure projects owned by the
state. He further classified the limited budgetary allocations for those nations

The Experimental Results And Test Parameters
The experimental results depend on a combination of test parameters, structural
parameters and materials parameters. For the complete stress strain curve, the test
parameters are difficult to be separated from the material and structural parameters.
The softening behavior of concrete, as found in laboratory tests, depends strongly on
structural aspects such as specimen dimensions, boundary conditions and feed back
signal. And it also depends on test parameters such as testing machine characteristics,
friction restraint between loading plates, allowable rotations of loading plates before
and during the test and loading rates as well as on the concretecomposition. Uniaxial
compression tests on cubes and cylinders, with different heights, have shown that a
stress strain curve of concrete is not a material property but a mix of structural and
material behavior.
4.2.5. Tensile splitting strength and modulus of rupture:
The test is carried out for three foam balls lightweight concrete cubes specimens of
size 150 x150 x 150 mm for tensile splitting strength. The Universal testing machine is
used for the test. This test refers to the split cube test, indirectly measures the
concrete tensile strength. It is done by applied a compression the cube through a line
load along its length. Tensile strength is considered one of the important basic
properties of the concrete. Concrete is not usually expected to desinged resisting the
direct tension. That is because of its brittle nature and

Excessive Drinking In College
Secondly, excessive drinking can result if alcohol use becomes an integral part of
peer interactions. A recent study, which followed students throughout their college
years and then reassessed them 4 and 7 years after graduation, revealed the social
environment to be a highly significant predictor for drinking in college[19]. In the
context of the SLT construct of social reinforcement, both socialisation and selection
contribute to this process. Socialisation is evident when alcohol use becomes
prevalent, accepted and encouraged in peer interactions that were previously alcohol
free. Thus, college friendships may initially develop in class or while socialising in
contexts that do not involve alcohol. The initiation and development of these... Show
In the context of SLT, this pathway can be viewed as the opposite of what occurs
when peers support heavy alcohol use. Specifically, peers encourage abstinence or
light drinking through social reinforcement (providing an environment that
approves of this style of alcohol use), modelling (peers abstain or drink lightly
themselves) and cognitive processes (strong drink refusal self efficacy, low
expectancies that alcohol is needed to be social or popular). The little research
conducted on light drinkers and abstainers indicates that college students whose
peers disapprove of drinking or abstain report very little personal alcohol use [7,26].
In addition, freshmen whose social networks consist mainly or entirely of abstainers
are less likely to initiate alcohol use or drink heavily (five or more drinks per
occasion) than students whose social networks consist mainly of drinkers [8,95].
Longitudinal research indicates that the alcohol related attitudes and behaviours of
peers are significantly correlated with personal attitudes and behaviours at both low
and high levels of alcohol consumption, a relationship that is most probably the result
of both selection and socialisation [13,19]. In sum, associating with light drinkers or
abstainers can prevent drinking from becoming a prominent part of

Animal Hunting Research Paper
Hunting through the use of spears and other tools used to be the ancient man s
primary way of sourcing food. Today, hunting is still very much alive in the modern
society, although it is being for various reasons.
One of the top hunting targets for men is the wild boar, a known ancestor of
domestic pigs although they look different. Boars are classified as feral hogs,
Russian wild boar or hybrids, a mixture of the first two kinds. Boars are called full
bloods if they are pure wild boars and standard if they are a result of breeding
domestic pigs and pure wild boars.
Feral hogs are hogs that have escaped domestication and became wild. The free
roam farming, or the practice of branding hogs and releasing them into the open to
roam free and breed, is said to be responsible for the existence of feral hogs today. ...
Show more content on Helpwriting.net ...
Texas and other States consider hogs as nuisance animals so hunting rules are very
lenient. In fact, hunters are allowed to hunt feral hogs using any kind of weapon or
bait, at any time of the day. True Russian boars are said to exist only in Texas and
New

Chemical Reactions Lab Report
I was hired to be a new chemistry teacher at the Forest Grove High School. When I
got there, there was chemicals on a shelf but some chemicals did not have labels.
The important concept in this lab was to help teach you how to identify chemicals
based on other chemical reactions. There were six chemicals that did not have
labels so we had to make a hypothesis and then test the chemicals. After testing the
chemicals we had to write down the reactions on a data table saying if they were
soluble or not and what color the reaction is. Safety methods were to wear goggles
and to wash your hands often. Our hypothesis was A Hg(NO3)2, B NH4OH,C
K2CrO4, D AgNO3, E FeCl3, and F HgCl2. The chemicals that were the most soluble
We made our predictions on which ones are which. We knew that one of the
chemicals had a terrible smell that resembled that of NH4OH, so that one was easy
to predict. Then we tested the chemicals to the ones on our data chart. We tested
the chemical reactions that had unique colors. We tested mystery element B with
potassium chromate which made a neon yellow color, and that was the same as
Mercury(II) Chloride. That left us with the last possible chemical which was
Hg(NO3)2 and element F. In conclusion we ended up solving the mysteries of the
mystery elements. The results were that mystery element A was Ammonium
Hydroxide, B was Mercury(II) Chloride, C was Potassium Chromate, D was Silver
Nitrate, E was Iron (III) Chloride, and F was Mercury(II) Nitrate. Possible errors in
the lab could have been chemical mixtures, data collection, cleanliness of hands
and clear chart, and possible data crossing. Our hypothesis was mostly correct but
some parts were incorrect. The parts of a hypothesis that were incorrect or the
predictions of all the clear liquids. What I had learned from this lab is how to
predict and find out what chemicals are based upon data and testing. This could be
used in other parts of science because you are using your data to predict other things.
I would enjoy trying this experiment again with more mystery chemicals to try and

Examples Of Good Vs Evil In Beowulf
Throughout the story of Beowulf the main idea in the story is the constant battle
between good and evil. Beowulf, the main character in the story is the so called hero
in the people s eyes because of his bravery and skill to go and fight the evil forces
ruining people s lives and defeat those forces in order to make things better for those
that are being harmed.The battles of good vs. evil in Beowulfcan be compared to
many different things we have going on in modern day all around us. The first thing
that comes to mind when I think of the battle of good vs. evil in modern day would
be the constant battle of the good people as in the Armed Forces fighting the evil, that
being terrorism. The United States Military would be the Beowulf of modern... Show
Beowulf won several battles against the evil forces but also died in the last battle
against the dragon, this is the same as having several successful battles in history
for our country but also having not such successful battles. Everyone has battles
within themselves that we often do not see or know about but know each and
everyone one of us encounter. Some people have to live daily fighting the
problems of depression which often can cause people to not seem happy or in the
worst case even cause them to take their own lives because they cannot deal with it
anymore. The good in modern times would be the help of therapy which can make
people better handle their problems or even take medicine to solve them as well.
People who help those victims who struggle daily would be the Beowulf in their
lives coming to help them defeat the evil Grendel, that being whatever their problem
may be. In Beowulf he says They have seen my strength for themselves,/ Have
watched me rise from the darkness of war this quote describes and fits perfectly with
those who kept fighting to overcome their everyday

Essay on Jordan Is a Land Loaded with History
Thesis: Jordan is a country with great complexity that includes location and
geography, demography, communication, morale, laws and any other capabilities and
habits as acquired by man and woman in the Jordanian society. The land is commonly
known for its desert land but the history and the consideration therein when it comes
to its people, society, culture, language and power and authority rests on its ancient
and preserved sayings from Mohammed.
I.Jordan is a land loaded with history. It has been home to some of man s earliest
settlements, villages and ruins of the world s greatest culture that can still be seen
today. A. Jordan is about 35,475 square miles (91,900 square kilometers).
1. It lies in the center of the Middle ... Show more content on Helpwriting.net ...
The Emirate of Transjordan was the name given to this small state when it was
recognized in 1921. 3. 1946 Transjordan became a completely sovereign state. In
1950, Transjordan merged with part of Palestine to form the Hashemite Kingdom of
Jordan. Amman is the capital and the largest city.
IV.The separation between Jordanians, Bedouins, and Palestinians is clear in this
society. Jordanians are defined as residents who have lived east of the Jordan River
since before 1948. Palestinians are defined as residents whose birthright extends
back to areas west of the Jordan River. People of Bedouin descent are considered to
be of the purest Arab stock. (The Existing Question By Remi Kanazi)
A.Jordan is the only Arab country where Palestinians can become citizens.
1.The flag has black, white, and green horizontal stripes with a red triangle on the
hoist side bearing a white seven pointed star.
2.The flag of the Palestinian people is identical but does not have the white star.
V.Ethnic Relations include deserts with little vegetation and water, Bedouin families
have lived in the traditional way for thousands of years. They roam freely and pay
little attention to borders.
A. Bedouins form the core of the army, occupying key positions, even though their
political influence is diminishing.
1.Palestinians are typically referred to as educated, hard working people, and their
influence in Jordan has resulted in a

Shifting Of A Parliamentary System
Shifting To a Parliamentary SystemThe Philippines has always been known to have
a Presidential system of government, but I believe that this type of governing isn t
really fit for our country considering that our nation/the people cannot really make a
responsible decision for themselves, considering that this is a democracy which it
should be run by the people. There are many reasons why the Presidential systemisn t
very reliable and is very unfair. One of these is how the the leaders are elected, for
the Presidential system, they have the plurality votingsystem which means, the
candidate who has the most votes wins the election, therefore neglecting the votes
of all the other candidates who lost which they then get nothing from it. This is
very unfair considering that each candidate has different programs and focuses
which they specialize on, for example, Duterte and his plan to eliminate all drug
related activities in the Philippines, and Miriam Santiago, who s goal was to
strengthen the country s affairs in an international level. These two candidates had
very different goals for the Philippines, but since this is a third world country, many
people considered Santiago s goal to be unreachable which they then reasoned that
the drug problem in the Philippines rising rapidly which they then stressed the
importance to elect a leader who will do it for them. My point is, most people in the
country really don t know the benefits of being involved in international

Recognition In Australia
Verbal Report
By Mark Lushchayev
Many people across Australia regardless of being indigenous or not, have been
asking for recognition for decades now. The formal process examining of how to
achieve recognition has been ongoing since 2011. There have been two expert
committees that have reported on the next steps working towards a meaningful and
successful referendum for constitutional recognition and amendment of sections 26
and 51 for example. There are many ways in which a law or system of laws or
values potentially may be recognised . At a grounded level, to say that Australian law
should recognise Aboriginal customary laws is to say that it should acknowledge
them and their existence. This sense of recognition , though not a specifically ... Show
At the point when the Australian Constitution was being drafted Aboriginal and
Torres Strait Islander people groups were rejected from the talks concerning the
production of another country to be arranged on their inherited grounds and regions.
The Australian Constitution additionally explicitly victimized Aboriginal and Torres
Strait Islander people groups. The Australian Constitution did not and still does not
make satisfactory arrangement for Australia s first people groups. The Australian
Constitution has neglected to secure Aboriginal and Torres Strait Islander rights as
the principal people groups of this country. For instance, the Racial Discrimination
Act 1975, has been traded off on three events: every time it has included Aboriginal
and Torres Strait Islander issues. As of late, the Constitution did not keep the
suspension of the RDA for the Northern Territory Emergency Response. Hence, it was
incapable in shielding people groups from the most major of all flexibilities, the
opportunity from segregation and discrimination. Recognition of laws custom to the
Indigenous through common law rules for the recognition of local custom or
communal native title is very brief and underwhelming, and is incompetent to face the
questions raised by the Commission s Terms of Reference. Arguments in

A Summary On Intel
Known as Intel Corporation (Intel) is an American multinational technology company
headquartered in Santa Clara, California. Intel s revenue base is one of the world s
largest and most valuable semiconductor chip makers. Intel chipsets also the
motherboard, network interface controllers and integrated circuits, flash memory,
graphic chips, embedded processors and other devices related to communications and
computing it. Semiconductor pioneers Robert Noyce and Gordon Moore established
it on July 18, 1968, and widely associated with the executive leadership and vision of
Andrew Grove, Intel s advanced chip design capability with a leading edge
manufacturing combines capacity.
Intel, in 1981, While the majority of this business represents Intel s ... Show more
content on Helpwriting.net ...
Apple has become public knowledge CEO Steve Jobs announced that the company
provided by Free scale in its Macintosh computers (formerly: Motorola) and IBM
would make a transition from PowerPC to Intel microprocessors use, designed and
developed by a chief supplier of processors for most of Apple s competitors.
пѓ SWOT ANALYSIS
1.Strengths
Intel, globally recognized brand name and strong brand loyalty.
Dominant Intel microprocessors for PCs and the pioneer supplier.
It is still dominated by various memory devices.
Intel based AMD has about 17% of the time revenue.
Intel microprocessor market share is 80%.
Intel is a global technology company and the world s largest semiconductor chip
producers.
Of world s 100 most influential brands published by MBO, Intel is listed at number
48 in 2010 standing.
In the 1990s, one of the largest and most successful companies in the world was
Intel. For PC business, Intel was a significant and beneficial hardware provider.
2.Weaknesses
Intel s strategy sometimes used to divide defend its market position against its

The Characteristics Of White Collar Crime, Crimes, And...
Alyssa Vieira
CRM 100
06/17/2017
Assignment 4
Crime can be viewed as a manner of adopting techniques and ideas that have the
effect of breaking governmental as well as ethical laws. This paper has the intention
of offering an exploration and elaboration of the various aspects of crime, their
characteristics, and the manner in which they impact on the social order of a given
community.
In criminology, white collar crime refers to a nonviolent crime that is motivated
financially among the government and business professionals. The definition of
white collar crime was first fronted in 1939 by Sutherland who outlined that it is a
crime carried out by an individual of high social status and respectability during his
or her occupation. Some of the regular activities related to white collar crimes include
bribery, forgery, fraud, money laundering, embezzlement, identity theft, Ponzi
schemes, copyright infringement, insider training, and cybercrime. On the other
hand, political crime is a kind of an offense that involves omissions or acts of overt
which have the resultant effect of prejudicing the interests of a country, the political
system as well as the government.
Main features of White collar crime
Non violent
Just like in the above definition of white collar crime, such crimes are always
associated with non violent offenses. This is a fundamental feature of white collar
crime that distinguishes it from other types of crime. In the Spill movie, no instance
of violence took

Theories Of Self Efficacy And Self Esteem Essay
Psychologist Albert Bandura has defined self efficacy as one s belief in one s ability
to succeed in specific situations or accomplish a task. One s sense of self efficacy can
play a major role in how one approaches goals, tasks, and challenges (Bandura, Albert
1995). Self Efficacy and Self esteem are a lot alike in regards to an individual s belief
in their ability to succeed at a task. Self esteem plays a big role in determining how
an individual performs in the classroom. Individuals with high self esteem do better
in school as opposed to their peers with low self esteem who do not perform as well.
Individuals with high self esteem have a high locus of controland utilize healthy
coping strategies. In contrast, individuals with low self esteem have a low locus of
control depend on unhealthy coping strategies, such as self handicapping. Students
with an internal locus of control obtain higher test scores and credit their academic
success to internal factors as oppose to those with an external locus of control who
more often blame or credit the concept of luck or fate. Students with an external locus
of control believe that no matter how much they study, if they are meant to pass a test
they will. Self handicapping refers to a performance debilitating characteristic, which
has been consistently associated with negative outcomes which in student
populations such as academic under achievement and poor psychological adjustment.
Research suggests that locus of control is

General English Essays.pdfGeneral English Essays

Recommended

Recommended

More Related Content

Similar to General English Essays.pdfGeneral English Essays

Similar to General English Essays.pdfGeneral English Essays (20)

More from Germaine Newman

More from Germaine Newman (20)

Recently uploaded

Recently uploaded (20)

General English Essays.pdfGeneral English Essays