This document describes the nucleotide sequence of the exon 3 and partial coding sequence of the myostatin (MSTN) gene from Bakerwal goats (Capra hircus). The 381 base pair sequence was submitted to GenBank and includes annotations for the source organism, gene, mRNA, coding sequence, exon, and translated protein sequence. It aims to characterize the coding regions of the MSTN gene in Bakerwal goats and compare it to the sequence in sheep.

1. 4/13/2017 Capra hircus breed Bakerwal myostatin (MSTN) gene, exon 3 and partial ­ Nucleotide ­ NCBI
https://www.ncbi.nlm.nih.gov/nuccore/KX171679.1 1/1
Capra hircus breed Bakerwal myostatin (MSTN) gene, exon 3 and partial cds
GenBank: KX171679.1
FASTA Graphics
Go to:
LOCUS KX171679 381 bp DNA linear MAM 22‐JUN‐2016
DEFINITION Capra hircus breed Bakerwal myostatin (MSTN) gene, exon 3 and
partial cds.
ACCESSION KX171679
VERSION KX171679.1
KEYWORDS .
SOURCE Capra hircus (goat)
ORGANISM Capra hircus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;
Pecora; Bovidae; Caprinae; Capra.
REFERENCE 1 (bases 1 to 381)
AUTHORS Ahad,W.A., Beigh,S.A., Mehraj,M., Hussain,M., Bhat,H.F., Shah,R.A.,
Mudasir,A.S., Raashid,A. and Rumais,A.
TITLE Sequence Characterization of Coding Regions of the Myostatin Gene
(GDF8) from Bakerwal Goats (Capra hircus) and Comparison with the
Sheep (Ovis aries) Sequence
JOURNAL Open J Anim Sci 6, 157‐162 (2016)
REFERENCE 2 (bases 1 to 381)
AUTHORS Ahad,W.A., Andrabi,M.S., Shah,R.A., Bhat,H.F., Shakeel,B.,
Abrar,M., Raashid,A. and Rumais,A.
TITLE Direct Submission
JOURNAL Submitted (29‐APR‐2016) Animal Biotechnology, SKUAST‐K, Shuhama,
Ganderbal, Jammu & Kashmir 190006, India
COMMENT ##Assembly‐Data‐START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly‐Data‐END##
FEATURES Location/Qualifiers
source 1..381
/organism="Capra hircus"
/mol_type="genomic DNA"
/db_xref="taxon:9925"
/note="breed: Bakerwal"
gene <1..>381
/gene="MSTN"
mRNA <1..>381
/gene="MSTN"
/product="myostatin"
CDS <1..381
/gene="MSTN"
/codon_start=1
/product="myostatin"
/protein_id="ANJ77845.1"
/translation="NPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAF
GWDWIIAPKRYKANYCSGECEFLFLQKYPHTHLVHQANPKGSAGPCCTPTKMSPINML
YFNGKEQIIYGKIPGMVVDRCGCS"
exon <1..>381
/gene="MSTN"
/number=3
ORIGIN
1 aatccttttt tagaagtcaa ggtaacagac acaccaaaaa gatctaggag agattttggg
61 cttgattgtg atgagcactc cacagaatct cgatgctgtc gttaccctct aactgtggat
121 tttgaagctt ttggatggga ttggattatt gcacccaaaa gatataaggc caattactgc
181 tccggagaat gtgaattttt atttttgcaa aagtatcctc atacccatct tgtgcaccaa
241 gcaaacccca aaggttcagc cggcccttgc tgtactccta caaagatgtc tccaattaat
301 atgctatatt ttaatggcaa agaacaaata atatatggga agattccagg catggtagta
361 gatcgctgtg ggtgctcatg a
//
GenBank
Nucleotide Capra hircus breed Bakerwal myostatin (MSTN) gene, exon 3 and partial cds