SlideShare a Scribd company logo
1 of 85
Download to read offline
Cloning, Expression, Puriļ¬cation and
 Enzymological Characterization of
 NS2B/NS3 Protease / RNA Helicase
             protein of
    Japanese Encephalitis Virus.



                 Chakard Chalayut
  Advisor: Asst. Prof. Gerd Katzenmeier, Ph.D.
         Laboratory of Molecular Virology
    Institute of Molecular Biology & Genetics
Japanese Encephalitis Virus
              (JEV)

-Flaviviridae family
-Mosquito-borne neurotropic ļ¬‚avivirus


          ā€¢causes severe central
          nerve system diseases
Japanese Encephalitis Virus
          (JEV)



  Culex tritaeniorhynchus.




                             Source: fehd.gov.hk
Japanese Encephalitis Virus
          (JEV)
Japanese Encephalitis Virus
          (JEV)




  Source : vietnammedicalpractice.com
Japanese Encephalitis Virus
          (JEV)
Japanese Encephalitis Virus
                  (JEV)
JEV causes severe
central nerve system
diseases such as
p o l i o mye l i t i s - l i ke
acute ļ¬‚accid paralysis,
aseptic meningitis and
encephalitis

                                   Source:wonder.cdc.gov
Japanese Encephalitis Virus
          (JEV)
Japanese Encephalitis Virus
          (JEV)
Japanese Encephalitis Virus
          (JEV)



50,000 Cases
Japanese Encephalitis Virus
          (JEV)



30% fatality rate
Japanese Encephalitis Virus
          (JEV)



10,000 Cases
Prevention and
treatment of JEV disease
Prevention and
treatment of JEV disease

   Drug          No drug exist
Prevention and
 treatment of JEV disease

       Drug            No drug exist


Vaccine development   Available vaccine
Prevention and
 treatment of JEV disease

       Drug                No drug exist


Vaccine development       Available vaccine


                      Elimination of mosquitoes
 Mosquitoes control        breeding places
Molecular biology of Japanese
     Encephalitis Virus
The NS2B
ā€¢ 130 aa
ā€¢ activating domain
    central hydrophilic region
    (Falgout et al, 1993)
ā€¢ 3 membrane spanning parts
The NS2B
ā€¢ 130 aa
ā€¢ activating domain
    central hydrophilic region
    (Falgout et al, 1993)
ā€¢ 3 membrane spanning parts

   hydrophobicity plot
The NS2B
  ā€¢ 130 aa
  ā€¢ activating domain
      central hydrophilic region
      (Falgout et al, 1993)
  ā€¢ 3 membrane spanning parts

     hydrophobicity plot




51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
The NS2B
  ā€¢ 130 aa                         Hypothetical model
  ā€¢ activating domain              NS2B-NS3 complex
      central hydrophilic region
      (Falgout et al, 1993)
  ā€¢ 3 membrane spanning parts

     hydrophobicity plot



                                        ąøŗBrinkworth et al, 1999




51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
The NS3




Theoretical model from PDB
            2I84
The NS3

                             Protease




Theoretical model from PDB
            2I84
The NS3

                             Protease

                             NTPase



                             RNA Helicase

Theoretical model from PDB
            2I84
The NS3




                             ā€¢Chymotrypsin-like fold
                             2-Ī² barrel domains
                             ā€¢Inactive alone
Theoretical model from PDB
                             ā€¢Enzymeā€™s pocket is small
            2I84
The NS3 protease
The NS3 protease


       ā€¢NS3 serine protease
       domain 20 kDa
       ā€¢catalytic residues His51,
       Asp75, Ser135
Background




      ā€¢ Lin. C W et al,2007
Background
ā€¢ Ser  to Ile60 were essential region required for NS3
        46
  protease activity.
ā€¢ Ala substition of Trp
                      50, Glu55, and Arg56
                                       in NS2B
  shown signiļ¬cantly reduced NS3 protease activity.




                               ā€¢ Lin. C W et al,2007
Objective
Objective
ā€¢   to perform cloning of the NS2B-NS3 portion of the JEV
    polyprotein, express in E.coli and biochemically purify
    to determinants of clevage activity and cofactor
    requirement will be analyzed and compared to dengue
    virus.

ā€¢   The second objective is to study differences in
    substrate speciļ¬city and inhibitors by using peptide
    substrates incorporated with ļ¬‚uorogenic or
    chromogenic reported groups.
Method & Result
pLS with NS2B-NS3 JEV
Method & Result
pLS with NS2B-NS3 JEV

NS2B(H)      NS3p
Method & Result
pLS with NS2B-NS3 JEV

NS2B(H)      NS3p


      SOE-PCR
Method & Result
pLS with NS2B-NS3 JEV

NS2B(H)      NS3p


      SOE-PCR

    NS2B(H)-NS3p
NS2B(H)

                                        NS2B(H)
                    Control




                                                                                          NS3 protease


                                                                                                         NS3 protease

                                                                                                                        NS3 protease
                                                                                Control
                                                                1500


       1500                                                      1000
                                                                 900
                                                                 800
       1000                                                      700
        900
        800                                                      600
        700                                                      500
       600
                                                                 400
       500
       400                                                       300

       300

                                                                 200

       200




Figure 1 : The PCR product NS2B(H) JEV ampliļ¬ed from NS2B-NS3   Figure 2 : The PCR product NS3protease JEV ampliļ¬ed from NS2B-
        JEV (Lane 3 and 4). The size of NS2B(H) was 187 bp.         NS3 JEV (Lane 3 to 5 ). The size of NS3 protease was 594 bp.
Control
               NS2B(H)-NS3p




                                                                                                             NS2B(H)-NS3p
                                                                                                   Control
                                                                               1500


                                                                                1000
                                                                                900
1500                                                                            800
                                                                                700
                                                                                600
1000
900                                                                             500
800
                                                                                400
700
600
                                                                                300
500
400                                                                             200
300



                                                                                100




                                                                 Figure 4 : The NS2B(H)-NS3protease JEV (Lane 3 ) after digested with
                                                                    BamHI and KpnI. The size of NS2B(H)-NS3 protease was 765 bp.
Figure 3 : The SOE-PCR product NS2B(H)-NS3protease JEV (Lane 2
        to 5 ). The size of NS2B(H)-NS3 protease was 765 bp.
Method & Result
Method & Result
NS2B(H)-NS3p JEV             pTrcHis A




         Ligation & Transformation


 Site Screening & Digest with Restriction Enzyme
23.13 kb




2.03 kb
2.32 kb
           4.56 kb
           6.56 kb
           9.42 kb
                     pTrc plasmid
                     Control
                                    Size Screening




                     Clone 1
                     Clone 2
                     Clone 3
                     Clone 4
                     Clone 5
                     Clone 6
                     Clone 7
                     Clone 8
                     Clone 9
                     Clone 10
                     Clone 11
                     Clone 12
                     Clone 13
                     Clone 14
                     Clone 15
                     Clone 16
                     Clone 17
Digest with Restriction Enzyme




                                                             clone 1 undigested
              clone 1 with BamHI,KpnI

                                        clone 1 with BamHI
                                                                                  ā€¢ Lane 1 : Ī»/BstII marker
                                                                                  ā€¢Lane 2 : Clone 1 with BamHI and KpnI digerstion
   8.454 kb
   7.242 kb                                                                       ā€¢Lane 3 : Clone 1 with BamHI digestion
   6.369 kb
   5.686 kb
   4.822 kb
   4.324 kb                                                                       ā€¢Lane 4 : Clone 1 without digestion
   3.645 kb


   2.323 kb
   1.929 kb


   1.371 kb
   1.264 kb



    702 bp
Sequencing of candidate
clone.
Deduced amino acid sequences of
Japanese encephalitis virus

             NS2B(H)
                              NS2B(H) C-terminal




                       NS3p
Expression of Japanese encephalitis virus
NS2B(H)/NS3 protease at different time.

                                          0 Hr

               1%                         2 Hr

                                          4 Hr

                                          6 Hr
 incubate overnight
                      O.D.= 0.4-0.6       8 Hr
                      induction by IPTG
SDS-PAGE Analysis of Japanese encephalitis
virus NS2B(H)/NS3 protease at different time.
             marker


                      ptrc 0- 8 Hr.   NS2B(H)/NS3p 0- 8 Hr.

   210 kD
   125 kD
   101 kD
   56.2 kD

   35.8 kD                                                    NS2B(H)/NS3
    29 kD
                                                                 NS3
    21 kD


    6.9 kD
                                                                NS2B(H)
Western blot analysis of Japanese encephalitis virus
NS2B(H)/NS3 protease at different time.

              marker



                        NS2B(H)/NS3p 0- 8 Hr.




    35.8 kD
                                                NS2B(H)/NS3 protease
     29 kD

     21 kD                                         NS3

                                                 NS2B(H)
Expression of Japanese encephalitis virus
  NS2B(H)/NS3 protease expressed at
  different temperatures.

              1%                         18 ĖšC
                                         25 ĖšC

                                         37 ĖšC
incubate overnight
                        O.D.= 0.4-0.6
                     induction by IPTG
                       Incubate 8 Hrs.
SDS-PAGE analysis of Japanese encephalitis virus
NS2B(H)/NS3 protease expressed at different
temperatures.


                    pTrc 0 hr 37 ĖšC




                                                                                        JEV 37 ĖšC
                                      JEV 18 ĖšC




                                                                                                                 JEV 30 ĖšC
                                                  pTrc 18 ĖšC




                                                                           pTrc 25 ĖšC




                                                                                                    pTrc 37 ĖšC




                                                                                                                             pTrc 30 ĖšC
                                                               JEV 25 ĖšC
           marker




 210 kD
 125 kD
 101 kD
 56.2 kD

 35.8 kD                                                                                                                                   NS2B(H)/NS3

 29 kD


 21 kD                                                                                                                                    NS3 protease



 6.9 kD                                                                                                                                     NS2B(H)
Western blot analysis of Japanese encephalitis
virus NS2B(H)/NS3 protease expressed at
different temperatures.




                                                                                                          NS2B(H)/NS3p 37 ĖšC
                                      NS2B(H)/NS3p 18 ĖšC




                                                                                                                                            NS2B(H)/NS3p 30 ĖšC
                                                                        NS2B(H)/NS3p 25 ĖšC
                    pTrc 0 hr 37 ĖšC




                                                           pTrc 18 ĖšC




                                                                                             pTrc 25 ĖšC



                                                                                                                               pTrc 37 ĖšC




                                                                                                                                                                 pTrc 30 ĖšC
           marker




 101 kD


 35.8 kD                                                                                                                                                                      NS2B(H)/NS3



                                                                                                                                                                              NS3 protease
 21 kD

                                                                                                                                                                                NS2B(H)
 6.9 kD
Expression of Japanese encephalitis virus
  NS2B(H)/NS3 protease expressed at different
  IPTG concentrations
                                     0.1 mM
                                     0.2 mM
              1%                     0.3 mM
                                     0.4 mM
                                     0.5 mM
incubate overnight                   0.6 mM
                                     0.7 mM
                    O.D.= 0.4-0.6    0.8 mM
                 induction by IPTG
                   Incubate 8 Hrs.
SDS-PAGE analysis of Japanese encephalitis virus
NS2B(H)/NS3 protease expressed at different IPTG
concentrations.




                        0.1mM




                                      0.8mM
               marker



     210 kD
     125 kD
     101 kD
     56.2 kD


     35.8 kD                                  NS2B(H)/NS3

     29 kD

                                               NS3 protease
     21 kD



     6.9 kD
                                              NS2B(H)
Western blot analysis of Japaneseencephalitis
  virus NS2B(H)/NS3 protease expressed at
  different IPTG concentrations

                   0.1mM




                                    0.8mM
          marker




35.8 kD
                                            NS2B(H)/NS3 protease
29 kD
Expression of Japanese encephalitis virus
NS2B(H)/NS3 protease at small scale
expression.
Expression of Japanese encephalitis virus
 NS2B(H)/NS3 protease at small scale
 expression.


              1%                        Centrifuge,
                                           Lysis,
                                        Sonication
                                        and Collect
incubate overnight                        fraction

                   O.D.= 0.4-0.6
             induction by o.1 mM IPTG
                  Incubate 8 Hrs.
SDS-PAGE analysis of Japanese encephalitis
virus NS2B(H)/NS3 protease at small scale
expression.
           marker
                    C T I   S
 210 kD
 125 kD
 101 kD

                                                       Lane 1: maker
 56.2 kD
                                NS2B(H)/NS3 protease   Lane 2: Control pTrcHis
                                                       Lane 3: Total fraction (T)
 35.8 kD                                               Lane 4: Insoluble fraction (I)
                                                       Lane 5: Soluble fraction (S)
 29 kD

                                 NS3 protease

 21 kD

                                 NS2B(H)
 6.9 kD
Western blot analysis of Japanese encephalitis
virus NS2B(H)/NS3 protease at small scale
expression.


                    T I   S


  35.8 kD                            NS2B(H)/NS3 protease


                                   Lane 1: maker
                                   Lane 2: Control pTrcHis
                                   Lane 3: Total fraction (T)
                                   Lane 4: Insoluble fraction (I)
                                   Lane 5: Soluble fraction (S)
SDS-PAGE analysis of Japanese encephalitis
  virus NS2B(H)/NS3 protease at large scale
  expression.
          marker




                           marker

                   T I S            TI S
210 kD
101 kD
125 kD

56.2 kD                                                         Lane 1: maker
                                                                Lane 2: Total fraction (T)
35.8 kD
                                           NS2B(H)/NS3 protease Lane 3: Insoluble fraction (I)
29 kD                                                           Lane 4: Soluble fraction (S)
                                            NS3 protease
21 kD


6.9 kD                                        NS2B(H)
Western blot analysis of Japanese encephalitis
virus NS2B(H)/NS3 protease at large scale
expression.
 marker



                 marker
          TI S            T I S


                                                         Lane 1: maker
                                  NS2B(H)/NS3 protease
                                                         Lane 2: Total fraction (T)
                                                         Lane 3: Insoluble fraction (I)
                                                         Lane 4: Soluble fraction (S)
                                    NS3 protease


                                      NS2B(H)
Puriļ¬cation of the NS2B(H)/NS3p protein
harboring the N-terminal polyhistidine tag

  The NS2B(H)/NS3 protease was purify by HiTrap
  Chelating column.
Method
Soluble fraction in buffer H




            Wash with Buffer H (30 mM imidazole)



            Elute with Buffer H (100 mM imidazole)
SDS-PAGE analysis of Japanese encephalitis virus
NS2B(H)/NS3 protease from Hi-trap puriļ¬cation.




                                                                                                Elute and concentrate
                                                                             Washing fraction
                                             Soluble fraction




                                                                                                       fraction
                                                                Flowtrough
                                 unduction
                     induction
            marker




  210 kD
  125 kD
  101 kD

  56.2 kD

                                                                                                                        NS2B(H)/NS3 protease
  35.8 kD

  29 kD
                                                                                                                         NS3 protease
  21 kD
  6.9 kD
Western-blot analysis of Japanese encephalitis virus
NS2B(H)/NS3 protease from
Hi-trap column puriļ¬cation




                                                                                                  Elute and concentrate
                                                                               Washing fraction
                                               Soluble fraction




                                                                                                         fraction
                                   unduction




                                                                  Flowtrough
                       induction
              marker




                                                                                                                          NS2B(H)/NS3
    35.8 kD

     29 kD
                                                                                                                          NS3 protease
     21 kD


                                                                                                                              NS2B(H)
     6.9 kD
Characterize the activity of NS2B(H)/
NS3p JEV with Ac-RRRR-pNA
 The substrate Ac-RRRR-pNA is based on the para-
 nitroanilide principle
 the enzyme will cleave between the tetra arginine and
 release pNA
 Free pNA will be monitored at A405 by the
 spectrophotometry method. The change of pNA will
 change the color of buffer and correlate to the activity
 of the enzyme
Result
                                                      Trypsin




                                              NS2B(H)/NS3p JEV


                                                                 substrate




NS2B(H)/NS3p JEV = 10 Ī¼M   trypsin = 0.4 Ī¼M    substrate = 500 Ī¼M
Problem


ā€¢ The protein has by products from the
  puriļ¬cation step.

ā€¢ No activity
ā€¢ The fusion protein was different from
  the previous work of JEV.
The International Journal of Biochemistry & Cell
          Biology 39 (2007) 606ā€“614
Method
Soluble fraction in buffer A
        (50mM Hepes pH 7.0, 500mM NaCl)




              Wash with Buffer A (30 mM imidazole)



              Elute with Buffer A (100 mM imidazole)
Method

The eluted protein

                     (superdex 75 HR 10/300)
peak1
peak2
101 kD
                                             210 kD
                                             125 kD




6.9 kD
                 29 kD


         21 kD
                                   56.2 kD
                         35.8 kD
                                                      Soluble

                                                      Flowthrough

                                                      wash

                                                      Elute

                                                      peak 1

                                                      peak2
                                                                    result




                                                      Soluble

                                                      Flowthrough

                                                       wash

                                                      Elute

                                                      peak 1

                                                       peak2
29 kD




         21 kD
                                             101 kD
                                             210 kD




6.9 kD
                                             125 kD



                                   56.2 kD

                         35.8 kD
                                                      uninduction



                                                       induction

                                                       Soluble

                                                      Flowthrough

                                                        wash

                                                        Elute

                                                      Gel ļ¬ltration
29 kD




         21 kD
                                             101 kD
                                             210 kD




6.9 kD
                                             125 kD



                                   56.2 kD



                         35.8 kD
                                                      uninduction



                                                       induction



                                                       Soluble


                                                      Flowthrough


                                                        wash


                                                        Elute



                                                      Gel ļ¬ltration
29 kD



         21 kD
                                             101 kD
                                             210 kD




6.9 kD
                                             125 kD



                                   56.2 kD

                         35.8 kD
                                                      induction


                                                      Soluble


                                                      Flowthrough


                                                       wash

                                                       Elute

                                                      Gel ļ¬ltration
29 kD

         21 kD
                                             101 kD
                                             210 kD




6.9 kD
                                             125 kD



                                   56.2 kD


                         35.8 kD
                                                      induction

                                                       Soluble

                                                      Flowthrough

                                                       wash


                                                       Elute

                                                      Gel ļ¬ltration
The substrate
The substrate
Protein assay method
 7-Amino-4-Methyl Coumarin (AMC) standard curve


ā€¢ A serial dilution of AMC, from 3 Ī¼M -
   50 Ī¼M, was prepared in 100 Ī¼l assay
   buffer (200 mM Tris-HCl pH. 9.5, 13.5
   mM NaCl and 30% Glycerol).




                                          ā€¢ incubated at 37 ą¹C for 30 minutes


              ā€¢ Fluorescence signals were measured at
                  an excitation wavelength 355 nm and
                  emission 460 at 37 ą¹C nm.
                  Fluorescence signals was plotted
                  against AMC concentration
result

                                            Data 1
                          100000
                                                                   Fluorescence unit
                          80000
      Fluorecence units




                          60000

                          40000

                          20000

                              0
                                   0   20                40   60
                                            [AMC] (ĀµM)




The correlation between units with AMC
 concentrations was calculated from 1/
slope of linear regression. 1 ļ¬‚uorescence
          unit = 6.839 nM [AMC]
Protein assay method
Enzyme Activity assay

NS2B(H)-NS3p JEV protein 100 Ī¼l
assay buffer (200 mM Tris-HCl pH. 9.5,
   13.5 mM NaCl and 30% Glycerol)




                                         ā€¢ incubated at 37 ą¹C for 30 minutes




                              adding 200 Ī¼M of Pyr-RTKR-AMC substrate

                               ā€¢ Fluorescence signals were measured at
                                  an excitation wavelength 355 nm and
                                  emission 460 at 37 ą¹C nm and
                                  monitored every 3 minutes for 2 hr.
result
                                              Data 1
                             30000
                                                                   Control
                                                                   200 mM
         Fluorescence unit

                             20000



                             10000



                                0
                                     0   50            100   150
                                                time




 Progress curves for enzymes-catalyzed hydrolysis
observed at 200 Ī¼M of Pyr-RTKR-AMC were plotted
     between ļ¬‚uorescence signals against time
Protein assay method
     Determination of kinetic parameters

NS2B(H)-NS3p JEV protein 100 Ī¼l
assay buffer (200 mM Tris-HCl pH. 9.5,
   13.5 mM NaCl and 30% Glycerol)




                                           ā€¢ incubated at 37 ą¹C for 30 minutes



                                                         Pyr-RTKR-AMC was varied
                                                  the concentrations from 15 Ī¼M to 500 Ī¼M

                                    ā€¢    Fluorescence signals were measured at an
                                         excitation wavelength 355 nm and emission 460 at
                                         37 ą¹C nm and monitored for 2 hr.
result
                                                         Data 1
                               2000


                               1500


           Velocity (nM/min)   1000


                               500


                                 0
                                      0            200            400           600
                                              [Pyr-RTKR-AMC] (ĀµM)




Vmax (nM/min)                             Km (ĀµM)                  Kcat (s-1)         Kcat/ Km(M-1s-1)

    2672                                   226.4                        3.22               0.014
Whatā€™s next?

ā€¢ Try to improve puriļ¬cation and
  ļ¬nd the amount of active
  protein

ā€¢ compare to Den NS2B(H)-NS3p

More Related Content

More from Chakard Chalayut

The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviourChakard Chalayut
Ā 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Chakard Chalayut
Ā 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Chakard Chalayut
Ā 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global Chakard Chalayut
Ā 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topicChakard Chalayut
Ā 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management Chakard Chalayut
Ā 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with dataChakard Chalayut
Ā 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience Chakard Chalayut
Ā 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?Chakard Chalayut
Ā 
Scratch 2 Social Media
Scratch 2 Social Media Scratch 2 Social Media
Scratch 2 Social Media Chakard Chalayut
Ā 
Scratch to Social Media
Scratch to Social Media Scratch to Social Media
Scratch to Social Media Chakard Chalayut
Ā 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Chakard Chalayut
Ā 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profitChakard Chalayut
Ā 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2Chakard Chalayut
Ā 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in BarcampChakard Chalayut
Ā 

More from Chakard Chalayut (20)

The power of user psychology and behaviour
The power of user psychology and behaviourThe power of user psychology and behaviour
The power of user psychology and behaviour
Ā 
Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability Innovation-Marketing for Sustainability
Innovation-Marketing for Sustainability
Ā 
Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing Art & Science of Viral Video in Digital Marketing
Art & Science of Viral Video in Digital Marketing
Ā 
Marketing Trend from Global
Marketing Trend from Global Marketing Trend from Global
Marketing Trend from Global
Ā 
Digital media 2018
Digital media 2018Digital media 2018
Digital media 2018
Ā 
about SXSW 2018 in AI topic
about SXSW 2018 in AI topicabout SXSW 2018 in AI topic
about SXSW 2018 in AI topic
Ā 
World of chaos
World of chaosWorld of chaos
World of chaos
Ā 
Total Experience Journey Management
Total Experience Journey Management Total Experience Journey Management
Total Experience Journey Management
Ā 
Can we predict human future with data
Can we predict human future with dataCan we predict human future with data
Can we predict human future with data
Ā 
End of content era, Long live the Human Experience
End of content era, Long live the Human Experience End of content era, Long live the Human Experience
End of content era, Long live the Human Experience
Ā 
What da heck is Digital marketing?
What da heck is Digital marketing?What da heck is Digital marketing?
What da heck is Digital marketing?
Ā 
Scratch 2 Social Media
Scratch 2 Social Media Scratch 2 Social Media
Scratch 2 Social Media
Ā 
Scratch to Social Media
Scratch to Social Media Scratch to Social Media
Scratch to Social Media
Ā 
Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry Social Media Marketing For Biotech and Pharmaceutical Industry
Social Media Marketing For Biotech and Pharmaceutical Industry
Ā 
Social Media for non profit
Social Media for non profitSocial Media for non profit
Social Media for non profit
Ā 
Social media CRM
Social media CRMSocial media CRM
Social media CRM
Ā 
Thinkcamp
ThinkcampThinkcamp
Thinkcamp
Ā 
How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2How To Get The Girlfriend Barcampbangkok2
How To Get The Girlfriend Barcampbangkok2
Ā 
How to participate in Barcamp
How to participate in BarcampHow to participate in Barcamp
How to participate in Barcamp
Ā 
Evaluation 2
Evaluation 2Evaluation 2
Evaluation 2
Ā 

Recently uploaded

Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxNirmalaLoungPoorunde1
Ā 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesFatimaKhan178732
Ā 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...EduSkills OECD
Ā 
Hybridoma Technology ( Production , Purification , and Application )
Hybridoma Technology  ( Production , Purification , and Application  ) Hybridoma Technology  ( Production , Purification , and Application  )
Hybridoma Technology ( Production , Purification , and Application ) Sakshi Ghasle
Ā 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13Steve Thomason
Ā 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docxPoojaSen20
Ā 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxheathfieldcps1
Ā 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
Ā 
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting DataJhengPantaleon
Ā 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Celine George
Ā 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfsanyamsingh5019
Ā 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsKarinaGenton
Ā 
Interactive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationInteractive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationnomboosow
Ā 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon AUnboundStockton
Ā 
Alper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentAlper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentInMediaRes1
Ā 
Class 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfClass 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfakmcokerachita
Ā 
Mastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionMastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionSafetyChain Software
Ā 

Recently uploaded (20)

Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptx
Ā 
Staff of Color (SOC) Retention Efforts DDSD
Staff of Color (SOC) Retention Efforts DDSDStaff of Color (SOC) Retention Efforts DDSD
Staff of Color (SOC) Retention Efforts DDSD
Ā 
Separation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and ActinidesSeparation of Lanthanides/ Lanthanides and Actinides
Separation of Lanthanides/ Lanthanides and Actinides
Ā 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Ā 
Hybridoma Technology ( Production , Purification , and Application )
Hybridoma Technology  ( Production , Purification , and Application  ) Hybridoma Technology  ( Production , Purification , and Application  )
Hybridoma Technology ( Production , Purification , and Application )
Ā 
The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13The Most Excellent Way | 1 Corinthians 13
The Most Excellent Way | 1 Corinthians 13
Ā 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docx
Ā 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
Ā 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
Ā 
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data_Math 4-Q4 Week 5.pptx Steps in Collecting Data
_Math 4-Q4 Week 5.pptx Steps in Collecting Data
Ā 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Ā 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdf
Ā 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its Characteristics
Ā 
Model Call Girl in Tilak Nagar Delhi reach out to us at šŸ”9953056974šŸ”
Model Call Girl in Tilak Nagar Delhi reach out to us at šŸ”9953056974šŸ”Model Call Girl in Tilak Nagar Delhi reach out to us at šŸ”9953056974šŸ”
Model Call Girl in Tilak Nagar Delhi reach out to us at šŸ”9953056974šŸ”
Ā 
Interactive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communicationInteractive Powerpoint_How to Master effective communication
Interactive Powerpoint_How to Master effective communication
Ā 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon A
Ā 
Alper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentAlper Gobel In Media Res Media Component
Alper Gobel In Media Res Media Component
Ā 
Class 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfClass 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdf
Ā 
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdfTataKelola dan KamSiber Kecerdasan Buatan v022.pdf
TataKelola dan KamSiber Kecerdasan Buatan v022.pdf
Ā 
Mastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory InspectionMastering the Unannounced Regulatory Inspection
Mastering the Unannounced Regulatory Inspection
Ā 

Evaluation 3

  • 1. Cloning, Expression, Puriļ¬cation and Enzymological Characterization of NS2B/NS3 Protease / RNA Helicase protein of Japanese Encephalitis Virus. Chakard Chalayut Advisor: Asst. Prof. Gerd Katzenmeier, Ph.D. Laboratory of Molecular Virology Institute of Molecular Biology & Genetics
  • 2. Japanese Encephalitis Virus (JEV) -Flaviviridae family -Mosquito-borne neurotropic ļ¬‚avivirus ā€¢causes severe central nerve system diseases
  • 3. Japanese Encephalitis Virus (JEV) Culex tritaeniorhynchus. Source: fehd.gov.hk
  • 5. Japanese Encephalitis Virus (JEV) Source : vietnammedicalpractice.com
  • 7. Japanese Encephalitis Virus (JEV) JEV causes severe central nerve system diseases such as p o l i o mye l i t i s - l i ke acute ļ¬‚accid paralysis, aseptic meningitis and encephalitis Source:wonder.cdc.gov
  • 10. Japanese Encephalitis Virus (JEV) 50,000 Cases
  • 11. Japanese Encephalitis Virus (JEV) 30% fatality rate
  • 12. Japanese Encephalitis Virus (JEV) 10,000 Cases
  • 14. Prevention and treatment of JEV disease Drug No drug exist
  • 15. Prevention and treatment of JEV disease Drug No drug exist Vaccine development Available vaccine
  • 16. Prevention and treatment of JEV disease Drug No drug exist Vaccine development Available vaccine Elimination of mosquitoes Mosquitoes control breeding places
  • 17. Molecular biology of Japanese Encephalitis Virus
  • 18. The NS2B ā€¢ 130 aa ā€¢ activating domain central hydrophilic region (Falgout et al, 1993) ā€¢ 3 membrane spanning parts
  • 19. The NS2B ā€¢ 130 aa ā€¢ activating domain central hydrophilic region (Falgout et al, 1993) ā€¢ 3 membrane spanning parts hydrophobicity plot
  • 20. The NS2B ā€¢ 130 aa ā€¢ activating domain central hydrophilic region (Falgout et al, 1993) ā€¢ 3 membrane spanning parts hydrophobicity plot 51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
  • 21. The NS2B ā€¢ 130 aa Hypothetical model ā€¢ activating domain NS2B-NS3 complex central hydrophilic region (Falgout et al, 1993) ā€¢ 3 membrane spanning parts hydrophobicity plot ąøŗBrinkworth et al, 1999 51 DMWLERAADISWEMDAAITGSSRRLDVKLDDDGDFHLIDDPGVP 95
  • 22. The NS3 Theoretical model from PDB 2I84
  • 23. The NS3 Protease Theoretical model from PDB 2I84
  • 24. The NS3 Protease NTPase RNA Helicase Theoretical model from PDB 2I84
  • 25. The NS3 ā€¢Chymotrypsin-like fold 2-Ī² barrel domains ā€¢Inactive alone Theoretical model from PDB ā€¢Enzymeā€™s pocket is small 2I84
  • 27. The NS3 protease ā€¢NS3 serine protease domain 20 kDa ā€¢catalytic residues His51, Asp75, Ser135
  • 28. Background ā€¢ Lin. C W et al,2007
  • 29. Background ā€¢ Ser to Ile60 were essential region required for NS3 46 protease activity. ā€¢ Ala substition of Trp 50, Glu55, and Arg56 in NS2B shown signiļ¬cantly reduced NS3 protease activity. ā€¢ Lin. C W et al,2007
  • 31. Objective ā€¢ to perform cloning of the NS2B-NS3 portion of the JEV polyprotein, express in E.coli and biochemically purify to determinants of clevage activity and cofactor requirement will be analyzed and compared to dengue virus. ā€¢ The second objective is to study differences in substrate speciļ¬city and inhibitors by using peptide substrates incorporated with ļ¬‚uorogenic or chromogenic reported groups.
  • 32. Method & Result pLS with NS2B-NS3 JEV
  • 33. Method & Result pLS with NS2B-NS3 JEV NS2B(H) NS3p
  • 34. Method & Result pLS with NS2B-NS3 JEV NS2B(H) NS3p SOE-PCR
  • 35. Method & Result pLS with NS2B-NS3 JEV NS2B(H) NS3p SOE-PCR NS2B(H)-NS3p
  • 36. NS2B(H) NS2B(H) Control NS3 protease NS3 protease NS3 protease Control 1500 1500 1000 900 800 1000 700 900 800 600 700 500 600 400 500 400 300 300 200 200 Figure 1 : The PCR product NS2B(H) JEV ampliļ¬ed from NS2B-NS3 Figure 2 : The PCR product NS3protease JEV ampliļ¬ed from NS2B- JEV (Lane 3 and 4). The size of NS2B(H) was 187 bp. NS3 JEV (Lane 3 to 5 ). The size of NS3 protease was 594 bp.
  • 37. Control NS2B(H)-NS3p NS2B(H)-NS3p Control 1500 1000 900 1500 800 700 600 1000 900 500 800 400 700 600 300 500 400 200 300 100 Figure 4 : The NS2B(H)-NS3protease JEV (Lane 3 ) after digested with BamHI and KpnI. The size of NS2B(H)-NS3 protease was 765 bp. Figure 3 : The SOE-PCR product NS2B(H)-NS3protease JEV (Lane 2 to 5 ). The size of NS2B(H)-NS3 protease was 765 bp.
  • 39. Method & Result NS2B(H)-NS3p JEV pTrcHis A Ligation & Transformation Site Screening & Digest with Restriction Enzyme
  • 40. 23.13 kb 2.03 kb 2.32 kb 4.56 kb 6.56 kb 9.42 kb pTrc plasmid Control Size Screening Clone 1 Clone 2 Clone 3 Clone 4 Clone 5 Clone 6 Clone 7 Clone 8 Clone 9 Clone 10 Clone 11 Clone 12 Clone 13 Clone 14 Clone 15 Clone 16 Clone 17
  • 41. Digest with Restriction Enzyme clone 1 undigested clone 1 with BamHI,KpnI clone 1 with BamHI ā€¢ Lane 1 : Ī»/BstII marker ā€¢Lane 2 : Clone 1 with BamHI and KpnI digerstion 8.454 kb 7.242 kb ā€¢Lane 3 : Clone 1 with BamHI digestion 6.369 kb 5.686 kb 4.822 kb 4.324 kb ā€¢Lane 4 : Clone 1 without digestion 3.645 kb 2.323 kb 1.929 kb 1.371 kb 1.264 kb 702 bp
  • 43. Deduced amino acid sequences of Japanese encephalitis virus NS2B(H) NS2B(H) C-terminal NS3p
  • 44. Expression of Japanese encephalitis virus NS2B(H)/NS3 protease at different time. 0 Hr 1% 2 Hr 4 Hr 6 Hr incubate overnight O.D.= 0.4-0.6 8 Hr induction by IPTG
  • 45. SDS-PAGE Analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at different time. marker ptrc 0- 8 Hr. NS2B(H)/NS3p 0- 8 Hr. 210 kD 125 kD 101 kD 56.2 kD 35.8 kD NS2B(H)/NS3 29 kD NS3 21 kD 6.9 kD NS2B(H)
  • 46. Western blot analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at different time. marker NS2B(H)/NS3p 0- 8 Hr. 35.8 kD NS2B(H)/NS3 protease 29 kD 21 kD NS3 NS2B(H)
  • 47. Expression of Japanese encephalitis virus NS2B(H)/NS3 protease expressed at different temperatures. 1% 18 ĖšC 25 ĖšC 37 ĖšC incubate overnight O.D.= 0.4-0.6 induction by IPTG Incubate 8 Hrs.
  • 48. SDS-PAGE analysis of Japanese encephalitis virus NS2B(H)/NS3 protease expressed at different temperatures. pTrc 0 hr 37 ĖšC JEV 37 ĖšC JEV 18 ĖšC JEV 30 ĖšC pTrc 18 ĖšC pTrc 25 ĖšC pTrc 37 ĖšC pTrc 30 ĖšC JEV 25 ĖšC marker 210 kD 125 kD 101 kD 56.2 kD 35.8 kD NS2B(H)/NS3 29 kD 21 kD NS3 protease 6.9 kD NS2B(H)
  • 49. Western blot analysis of Japanese encephalitis virus NS2B(H)/NS3 protease expressed at different temperatures. NS2B(H)/NS3p 37 ĖšC NS2B(H)/NS3p 18 ĖšC NS2B(H)/NS3p 30 ĖšC NS2B(H)/NS3p 25 ĖšC pTrc 0 hr 37 ĖšC pTrc 18 ĖšC pTrc 25 ĖšC pTrc 37 ĖšC pTrc 30 ĖšC marker 101 kD 35.8 kD NS2B(H)/NS3 NS3 protease 21 kD NS2B(H) 6.9 kD
  • 50. Expression of Japanese encephalitis virus NS2B(H)/NS3 protease expressed at different IPTG concentrations 0.1 mM 0.2 mM 1% 0.3 mM 0.4 mM 0.5 mM incubate overnight 0.6 mM 0.7 mM O.D.= 0.4-0.6 0.8 mM induction by IPTG Incubate 8 Hrs.
  • 51. SDS-PAGE analysis of Japanese encephalitis virus NS2B(H)/NS3 protease expressed at different IPTG concentrations. 0.1mM 0.8mM marker 210 kD 125 kD 101 kD 56.2 kD 35.8 kD NS2B(H)/NS3 29 kD NS3 protease 21 kD 6.9 kD NS2B(H)
  • 52. Western blot analysis of Japaneseencephalitis virus NS2B(H)/NS3 protease expressed at different IPTG concentrations 0.1mM 0.8mM marker 35.8 kD NS2B(H)/NS3 protease 29 kD
  • 53.
  • 54. Expression of Japanese encephalitis virus NS2B(H)/NS3 protease at small scale expression.
  • 55. Expression of Japanese encephalitis virus NS2B(H)/NS3 protease at small scale expression. 1% Centrifuge, Lysis, Sonication and Collect incubate overnight fraction O.D.= 0.4-0.6 induction by o.1 mM IPTG Incubate 8 Hrs.
  • 56. SDS-PAGE analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at small scale expression. marker C T I S 210 kD 125 kD 101 kD Lane 1: maker 56.2 kD NS2B(H)/NS3 protease Lane 2: Control pTrcHis Lane 3: Total fraction (T) 35.8 kD Lane 4: Insoluble fraction (I) Lane 5: Soluble fraction (S) 29 kD NS3 protease 21 kD NS2B(H) 6.9 kD
  • 57. Western blot analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at small scale expression. T I S 35.8 kD NS2B(H)/NS3 protease Lane 1: maker Lane 2: Control pTrcHis Lane 3: Total fraction (T) Lane 4: Insoluble fraction (I) Lane 5: Soluble fraction (S)
  • 58. SDS-PAGE analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at large scale expression. marker marker T I S TI S 210 kD 101 kD 125 kD 56.2 kD Lane 1: maker Lane 2: Total fraction (T) 35.8 kD NS2B(H)/NS3 protease Lane 3: Insoluble fraction (I) 29 kD Lane 4: Soluble fraction (S) NS3 protease 21 kD 6.9 kD NS2B(H)
  • 59. Western blot analysis of Japanese encephalitis virus NS2B(H)/NS3 protease at large scale expression. marker marker TI S T I S Lane 1: maker NS2B(H)/NS3 protease Lane 2: Total fraction (T) Lane 3: Insoluble fraction (I) Lane 4: Soluble fraction (S) NS3 protease NS2B(H)
  • 60. Puriļ¬cation of the NS2B(H)/NS3p protein harboring the N-terminal polyhistidine tag The NS2B(H)/NS3 protease was purify by HiTrap Chelating column.
  • 61. Method Soluble fraction in buffer H Wash with Buffer H (30 mM imidazole) Elute with Buffer H (100 mM imidazole)
  • 62. SDS-PAGE analysis of Japanese encephalitis virus NS2B(H)/NS3 protease from Hi-trap puriļ¬cation. Elute and concentrate Washing fraction Soluble fraction fraction Flowtrough unduction induction marker 210 kD 125 kD 101 kD 56.2 kD NS2B(H)/NS3 protease 35.8 kD 29 kD NS3 protease 21 kD 6.9 kD
  • 63. Western-blot analysis of Japanese encephalitis virus NS2B(H)/NS3 protease from Hi-trap column puriļ¬cation Elute and concentrate Washing fraction Soluble fraction fraction unduction Flowtrough induction marker NS2B(H)/NS3 35.8 kD 29 kD NS3 protease 21 kD NS2B(H) 6.9 kD
  • 64. Characterize the activity of NS2B(H)/ NS3p JEV with Ac-RRRR-pNA The substrate Ac-RRRR-pNA is based on the para- nitroanilide principle the enzyme will cleave between the tetra arginine and release pNA Free pNA will be monitored at A405 by the spectrophotometry method. The change of pNA will change the color of buffer and correlate to the activity of the enzyme
  • 65. Result Trypsin NS2B(H)/NS3p JEV substrate NS2B(H)/NS3p JEV = 10 Ī¼M trypsin = 0.4 Ī¼M substrate = 500 Ī¼M
  • 66. Problem ā€¢ The protein has by products from the puriļ¬cation step. ā€¢ No activity ā€¢ The fusion protein was different from the previous work of JEV.
  • 67. The International Journal of Biochemistry & Cell Biology 39 (2007) 606ā€“614
  • 68. Method Soluble fraction in buffer A (50mM Hepes pH 7.0, 500mM NaCl) Wash with Buffer A (30 mM imidazole) Elute with Buffer A (100 mM imidazole)
  • 69. Method The eluted protein (superdex 75 HR 10/300)
  • 71. 101 kD 210 kD 125 kD 6.9 kD 29 kD 21 kD 56.2 kD 35.8 kD Soluble Flowthrough wash Elute peak 1 peak2 result Soluble Flowthrough wash Elute peak 1 peak2
  • 72.
  • 73. 29 kD 21 kD 101 kD 210 kD 6.9 kD 125 kD 56.2 kD 35.8 kD uninduction induction Soluble Flowthrough wash Elute Gel ļ¬ltration
  • 74. 29 kD 21 kD 101 kD 210 kD 6.9 kD 125 kD 56.2 kD 35.8 kD uninduction induction Soluble Flowthrough wash Elute Gel ļ¬ltration
  • 75. 29 kD 21 kD 101 kD 210 kD 6.9 kD 125 kD 56.2 kD 35.8 kD induction Soluble Flowthrough wash Elute Gel ļ¬ltration
  • 76. 29 kD 21 kD 101 kD 210 kD 6.9 kD 125 kD 56.2 kD 35.8 kD induction Soluble Flowthrough wash Elute Gel ļ¬ltration
  • 79. Protein assay method 7-Amino-4-Methyl Coumarin (AMC) standard curve ā€¢ A serial dilution of AMC, from 3 Ī¼M - 50 Ī¼M, was prepared in 100 Ī¼l assay buffer (200 mM Tris-HCl pH. 9.5, 13.5 mM NaCl and 30% Glycerol). ā€¢ incubated at 37 ą¹C for 30 minutes ā€¢ Fluorescence signals were measured at an excitation wavelength 355 nm and emission 460 at 37 ą¹C nm. Fluorescence signals was plotted against AMC concentration
  • 80. result Data 1 100000 Fluorescence unit 80000 Fluorecence units 60000 40000 20000 0 0 20 40 60 [AMC] (ĀµM) The correlation between units with AMC concentrations was calculated from 1/ slope of linear regression. 1 ļ¬‚uorescence unit = 6.839 nM [AMC]
  • 81. Protein assay method Enzyme Activity assay NS2B(H)-NS3p JEV protein 100 Ī¼l assay buffer (200 mM Tris-HCl pH. 9.5, 13.5 mM NaCl and 30% Glycerol) ā€¢ incubated at 37 ą¹C for 30 minutes adding 200 Ī¼M of Pyr-RTKR-AMC substrate ā€¢ Fluorescence signals were measured at an excitation wavelength 355 nm and emission 460 at 37 ą¹C nm and monitored every 3 minutes for 2 hr.
  • 82. result Data 1 30000 Control 200 mM Fluorescence unit 20000 10000 0 0 50 100 150 time Progress curves for enzymes-catalyzed hydrolysis observed at 200 Ī¼M of Pyr-RTKR-AMC were plotted between ļ¬‚uorescence signals against time
  • 83. Protein assay method Determination of kinetic parameters NS2B(H)-NS3p JEV protein 100 Ī¼l assay buffer (200 mM Tris-HCl pH. 9.5, 13.5 mM NaCl and 30% Glycerol) ā€¢ incubated at 37 ą¹C for 30 minutes Pyr-RTKR-AMC was varied the concentrations from 15 Ī¼M to 500 Ī¼M ā€¢ Fluorescence signals were measured at an excitation wavelength 355 nm and emission 460 at 37 ą¹C nm and monitored for 2 hr.
  • 84. result Data 1 2000 1500 Velocity (nM/min) 1000 500 0 0 200 400 600 [Pyr-RTKR-AMC] (ĀµM) Vmax (nM/min) Km (ĀµM) Kcat (s-1) Kcat/ Km(M-1s-1) 2672 226.4 3.22 0.014
  • 85. Whatā€™s next? ā€¢ Try to improve puriļ¬cation and ļ¬nd the amount of active protein ā€¢ compare to Den NS2B(H)-NS3p