Leonardo attended European Rotors presenting its contribution to the Swiss Innovation Day illustrating a possible roadmap from the first Swiss helicopter to the first Swiss hybrid helicopter
European Rotors - Certification by SimulationLeonardo
During European Rotors we presented our view and experience on certification by simulation with a look at the RoCS (Rotorcraft Certification by Simulation) project
eMARINE Global (OTCQB: EMRN) is a leading provider of information and communications technology (ICT) solutions for the global maritime industry. Founded in 2001 and based in South Korea, e-MARINE is working with a growing base of marquee customers to achieve maritime ICT convergence through fully integrated products and services, offering state-of-the-art e-navigation, marine Internet of Things (IoT), and marine big-data solutions. Learn more at EMRNinfo.com
ISCF Future Flight Networking Event - Use casesKTN
This webcast covers the physical, virtual & technology operations already in existence or in planning that can support an integrated aviation system. Areas to consider will be flight corridors for experimentation/feasibility/demo flights, regional connectivity in island and remote communities, the demonstration of drones or air taxis, the demonstration of a partially integrated system and the use of drones to deliver vital health care services.
The aim of the this event is to:
- Convene interested parties to enable new collaborations to form
- Raise awareness of the successful applicants from Phase I (as they will lead the consortia for Phase II)
- Attract non-traditional aviation companies to Future Flight
- Inform on the capabilities and expertise on offer to support your Future Flight project
Future Flight is a £125m Industrial Strategy Challenge Programme seeking to demonstrate novel aviation systems to completely transform the way we move people and goods. The programme seeks to demonstration a fully integrated system in 2024 delivered by large consortia of mixed expertise.
Find out more: https://ktn-uk.co.uk/news/future-flight-workshops
This event covers what regulations and standards need to be in place to ensure the safety of new aircraft in built environments and near airports. Covering how a new and novel integrated aviation system should be regulated to ensure safety looking at regulations and standards, fuels and charging and how modelling mirrors reality.
The aim of the this event is to:
Convene interested parties to enable new collaborations to form
Raise awareness of the successful applicants from Phase I
Attract non-traditional aviation companies to Future Flight
Inform on the capabilities and expertise on offer to support your Future Flight project
Future Flight is a £125m Industrial Strategy Challenge Programme seeking to demonstrate novel aviation systems to completely transform the way we move people and goods. The programme seeks to demonstration a fully integrated system in 2024 delivered by large consortia of mixed expertise.
Find out more: https://ktn-uk.co.uk/news/future-flight-workshops
Global eVTOL Aircraft Market Analysis 2020-2025NarayanSharma67
The global eVTOL Aircraft market is anticipated to grow at a CAGR of around 20.50% during 2020-2025, due to the increasing demand for alternative mode of transportation and growing need for operational efficiency.
For more info visit: https://www.marknteladvisors.com/research-library/global-evtol-aircraft-market-analysis.html
European Rotors - Certification by SimulationLeonardo
During European Rotors we presented our view and experience on certification by simulation with a look at the RoCS (Rotorcraft Certification by Simulation) project
eMARINE Global (OTCQB: EMRN) is a leading provider of information and communications technology (ICT) solutions for the global maritime industry. Founded in 2001 and based in South Korea, e-MARINE is working with a growing base of marquee customers to achieve maritime ICT convergence through fully integrated products and services, offering state-of-the-art e-navigation, marine Internet of Things (IoT), and marine big-data solutions. Learn more at EMRNinfo.com
ISCF Future Flight Networking Event - Use casesKTN
This webcast covers the physical, virtual & technology operations already in existence or in planning that can support an integrated aviation system. Areas to consider will be flight corridors for experimentation/feasibility/demo flights, regional connectivity in island and remote communities, the demonstration of drones or air taxis, the demonstration of a partially integrated system and the use of drones to deliver vital health care services.
The aim of the this event is to:
- Convene interested parties to enable new collaborations to form
- Raise awareness of the successful applicants from Phase I (as they will lead the consortia for Phase II)
- Attract non-traditional aviation companies to Future Flight
- Inform on the capabilities and expertise on offer to support your Future Flight project
Future Flight is a £125m Industrial Strategy Challenge Programme seeking to demonstrate novel aviation systems to completely transform the way we move people and goods. The programme seeks to demonstration a fully integrated system in 2024 delivered by large consortia of mixed expertise.
Find out more: https://ktn-uk.co.uk/news/future-flight-workshops
This event covers what regulations and standards need to be in place to ensure the safety of new aircraft in built environments and near airports. Covering how a new and novel integrated aviation system should be regulated to ensure safety looking at regulations and standards, fuels and charging and how modelling mirrors reality.
The aim of the this event is to:
Convene interested parties to enable new collaborations to form
Raise awareness of the successful applicants from Phase I
Attract non-traditional aviation companies to Future Flight
Inform on the capabilities and expertise on offer to support your Future Flight project
Future Flight is a £125m Industrial Strategy Challenge Programme seeking to demonstrate novel aviation systems to completely transform the way we move people and goods. The programme seeks to demonstration a fully integrated system in 2024 delivered by large consortia of mixed expertise.
Find out more: https://ktn-uk.co.uk/news/future-flight-workshops
Global eVTOL Aircraft Market Analysis 2020-2025NarayanSharma67
The global eVTOL Aircraft market is anticipated to grow at a CAGR of around 20.50% during 2020-2025, due to the increasing demand for alternative mode of transportation and growing need for operational efficiency.
For more info visit: https://www.marknteladvisors.com/research-library/global-evtol-aircraft-market-analysis.html
DJI's Drone Solutions for Smart Cities of the Futuresitecmy
Keynote Presentation by Bryan Liu, Head of Enterprise for APAC, DJI at the Selangor Smart City & Future Commerce Convention 2017, on the topic titled 'DJI's Drone Solutions for Smart Cities of the Future'
E-mobility | Part 4 - EV charging and the next frontier (English)Vertex Holdings
For the mass adoption of electric vehicle (EV) to become a reality, EV charging infrastructure must be made accessible, quick and reliable. Current signs indicate the sector is moving in the right direction – with China, Europe, US and Japan accelerating their charging infrastructure rollout plans, and notable charging network operators (i.e. ChargePoint, EVgo and Tritium) making billion-dollar exits.
Read more: https://bit.ly/3E8u4SL
TMC 2017 Spring Far Horizon Future Truck FinalPaul Menig
Short presentation, with backup ideas, to the Technology and Maintenance Council Spring 2017 meeting. This is the Far Horizon report for the Future Truck Committee.
Future Challenges for Electric VehiclesTorben Haagh
Want to learn more about current and future developments in Electric Vehicles?
Visit our Download Center for more articles, whitepapers and interviews:
http://bit.ly/ev-articles
IDTechEx Research: Manned Electric AircraftIDTechEx
About 20 companies make or will soon make electric aircraft. Nearly all are pure electric and fixed wing, the motorised hang glider and the self-launching sailplane being typical, with one hour endurance. A bigger value market being addressed is training planes and bigger still will be hybrid fixed wing and vertical takeoff aircraft hybrid and pure electric with the pure electric ones only managing 30 minutes. In these slides we discuss possible uses, improvements and other types too.
For more information, see http://www.idtechex.com/aircraft.
Slides by Dr. Peter Harrop of IDTechEx.
Yes, but probably not just yet. The latest iterations of the venerable internal combustion engine are still competitive, both from an environmental and an economical standpoint.
This report takes a look into the patenting activity around hybrid vehicles uncovering the inventors, the companies and the intellectual property history behind different drivetrain configurations, its research momentum and key intellectual property indicators.
A hybrid vehicle is a vehicle that uses two or more distinct power sources to move the vehicle. The term most commonly refers to hybrid electric vehicles (HEVs), which combine an internal combustion engine and one or more electric motors.
A hybrid electric vehicle (HEV) is a type of hybrid vehicle and electric vehicle which combines a conventional internal combustion engine (ICE) propulsion system with an electric propulsion system.
Current HEVs reduce petroleum consumption under certain conditions, compared to otherwise similar conventional vehicles by using three mechanisms:
1. Reducing wasted energy during idle/low output by turning the ICE off.
2. Regenerative braking which is recapturing waste energy.
3. Reducing the size and power of the ICE.
This report focuses on how Patent data can help uncover the trends, gaps and opportunities that exist around this area. You will find the information on the research activity, existing & emerging trends in the different technological advancements in hybrid vehicle domain.
This report was prepared by mining patent data using Patent iNSIGHT Pro, a comprehensive patent analysis platform that helps one accelerate time-to-decision from patent analysis activities.
Published: Jul 20, 2012
DJI's Drone Solutions for Smart Cities of the Futuresitecmy
Keynote Presentation by Bryan Liu, Head of Enterprise for APAC, DJI at the Selangor Smart City & Future Commerce Convention 2017, on the topic titled 'DJI's Drone Solutions for Smart Cities of the Future'
E-mobility | Part 4 - EV charging and the next frontier (English)Vertex Holdings
For the mass adoption of electric vehicle (EV) to become a reality, EV charging infrastructure must be made accessible, quick and reliable. Current signs indicate the sector is moving in the right direction – with China, Europe, US and Japan accelerating their charging infrastructure rollout plans, and notable charging network operators (i.e. ChargePoint, EVgo and Tritium) making billion-dollar exits.
Read more: https://bit.ly/3E8u4SL
TMC 2017 Spring Far Horizon Future Truck FinalPaul Menig
Short presentation, with backup ideas, to the Technology and Maintenance Council Spring 2017 meeting. This is the Far Horizon report for the Future Truck Committee.
Future Challenges for Electric VehiclesTorben Haagh
Want to learn more about current and future developments in Electric Vehicles?
Visit our Download Center for more articles, whitepapers and interviews:
http://bit.ly/ev-articles
IDTechEx Research: Manned Electric AircraftIDTechEx
About 20 companies make or will soon make electric aircraft. Nearly all are pure electric and fixed wing, the motorised hang glider and the self-launching sailplane being typical, with one hour endurance. A bigger value market being addressed is training planes and bigger still will be hybrid fixed wing and vertical takeoff aircraft hybrid and pure electric with the pure electric ones only managing 30 minutes. In these slides we discuss possible uses, improvements and other types too.
For more information, see http://www.idtechex.com/aircraft.
Slides by Dr. Peter Harrop of IDTechEx.
Yes, but probably not just yet. The latest iterations of the venerable internal combustion engine are still competitive, both from an environmental and an economical standpoint.
This report takes a look into the patenting activity around hybrid vehicles uncovering the inventors, the companies and the intellectual property history behind different drivetrain configurations, its research momentum and key intellectual property indicators.
A hybrid vehicle is a vehicle that uses two or more distinct power sources to move the vehicle. The term most commonly refers to hybrid electric vehicles (HEVs), which combine an internal combustion engine and one or more electric motors.
A hybrid electric vehicle (HEV) is a type of hybrid vehicle and electric vehicle which combines a conventional internal combustion engine (ICE) propulsion system with an electric propulsion system.
Current HEVs reduce petroleum consumption under certain conditions, compared to otherwise similar conventional vehicles by using three mechanisms:
1. Reducing wasted energy during idle/low output by turning the ICE off.
2. Regenerative braking which is recapturing waste energy.
3. Reducing the size and power of the ICE.
This report focuses on how Patent data can help uncover the trends, gaps and opportunities that exist around this area. You will find the information on the research activity, existing & emerging trends in the different technological advancements in hybrid vehicle domain.
This report was prepared by mining patent data using Patent iNSIGHT Pro, a comprehensive patent analysis platform that helps one accelerate time-to-decision from patent analysis activities.
Published: Jul 20, 2012
The electrical systems for aircraft at both ends of the complexity spectrum share many common essential components. The segments are Aircraft type, Region, and System Type in aircraft electrical systems market report.
Get the full report here: - https://bit.ly/3tshTPp
#aircraftelectricalsystemsmarket #aircraftelectricalsystemsmarketreport #aircraftelectricalsystemsmarkettrends #aircraftelectricalsystemsmarketanalysis #aircraftelectricalsystemsmarketshare #aircraftelectricalsystemsmarketgrowth #aircraftelectricalsystemsmarketsize #aircraftelectricalsystemsmarketforecast
Highlights:
* Investigates opportunities to encourage early replacement of electric motors by more efficient ones.
* By installing efficient motors, energy is saved and CO2 emissions are reduced.
* Accelerated replacement also increases reliability and reduces risk of unplanned downtime.
* Energy Efficiency Directive (EED) encourages early replacement of motors.
The page shows the global network of in-vehicle motor business, and the prospects for future business at Nidec, the world's No.1 comprehensive motor manufacturer. Nidec provides a wide lineup of high-performance, energy-efficient motors, and is quick to respond to recent customer demands in the EV and HEV vehicle markets.
The United Nations Industrial Development Organization's Low Carbon Transport Project hosted a workshop seminar on sustainable transport and mobility for cities in Durban on the 30th of March 2017. This workshop was presented with the aim of highlighting the benefits of using electrified mobility powered by renewable energy. The objectives of the workshop included: Enlightening members of the sustainable transport fraternity in South Africa; sharing the current policy developments for sustainable transport use and operations; discussing the environmental benefits of including electric vehicles in South Africa’s transportation modal mix; offering insights to the various types of transport modes available and those suitable for city commuting and public services; proposing methods to include green vehicles into local government fleets; discussing the possibilities of converting a fleet to electric drive vehicles through other initiatives; demonstrating macroeconomic factors to better understand how the introduction of electrified transport modes could add value to the economy of the city and South Africa at large.
1st Leonardo Helicopters SAR Workshop - AW139 SAR Overview and UpdatesLeonardo
During our first Leonardo Helicopters SAR Workshop we gave a brief overview and update on the AW139, with a special focus on new capabilities and mission kits dedicated to SAR operations.
European Rotors - Mission Management System’s Capabilities for Law Enforcemen...Leonardo
Leonardo attended at European Rotors the Police Aviation Conference illustrating its Mission Management System’s capabilities for Law Enforcement Operators
European Rotors - Rotorcraft and VTOL SymposiumLeonardo
Leonardo attended at European Rotors the Rotorcraft and VTOL Symposium 2021 sharing its vision for the present, the impending challenges, and the outlooks for the future
Core Web Vitals SEO Workshop - improve your performance [pdf]Peter Mead
Core Web Vitals to improve your website performance for better SEO results with CWV.
CWV Topics include:
- Understanding the latest Core Web Vitals including the significance of LCP, INP and CLS + their impact on SEO
- Optimisation techniques from our experts on how to improve your CWV on platforms like WordPress and WP Engine
- The impact of user experience and SEO
The Forgotten Secret Weapon of Digital Marketing: Email
Digital marketing is a rapidly changing, ever evolving industry--Influencers, Threads, X, AI, etc. But one of the most effective digital marketing tools is also one of the oldest: Email. Find out from two Houston-based digital experts how to maximize your results from email.
Key Takeaways:
Email has the best ROI of any digital tactic
It can be used at any stage of the customer journey
It is increasingly important as the cookie-less future gets closer and closer
Mastering Local SEO for Service Businesses in the AI Era is tailored specifically for local service providers like plumbers, dentists, and others seeking to dominate their local search landscape. This session delves into leveraging AI advancements to enhance your online visibility and search rankings through the Content Factory model, designed for creating high-impact, SEO-driven content. Discover the Dollar-a-Day advertising strategy, a cost-effective approach to boost your local SEO efforts and attract more customers with minimal investment. Gain practical insights on optimizing your online presence to meet the specific needs of local service seekers, ensuring your business not only appears but stands out in local searches. This concise, action-oriented workshop is your roadmap to navigating the complexities of digital marketing in the AI age, driving more leads, conversions, and ultimately, success for your local service business.
Key Takeaways:
Embrace AI for Local SEO: Learn to harness the power of AI technologies to optimize your website and content for local search. Understand the pivotal role AI plays in analyzing search trends and consumer behavior, enabling you to tailor your SEO strategies to meet the specific demands of your target local audience. Leverage the Content Factory Model: Discover the step-by-step process of creating SEO-optimized content at scale. This approach ensures a steady stream of high-quality content that engages local customers and boosts your search rankings. Get an action guide on implementing this model, complete with templates and scheduling strategies to maintain a consistent online presence. Maximize ROI with Dollar-a-Day Advertising: Dive into the cost-effective Dollar-a-Day advertising strategy that amplifies your visibility in local searches without breaking the bank. Learn how to strategically allocate your budget across platforms to target potential local customers effectively. The session includes an action guide on setting up, monitoring, and optimizing your ad campaigns to ensure maximum impact with minimal investment.
Everyone knows the power of stories, but when asked to come up with them, we struggle. Either we second guess ourselves as to the story's relevance, or we just come up blank and can't think of any. Unlocking Everyday Narratives: The Power of Storytelling in Marketing will teach you how to recognize stories in the moment and to recall forgotten moments that your audience needs to hear.
Key Takeaways:
Understand Why Personal Stories Connect Better
How To Remember Forgotten Stories
How To Use Customer Experiences As Stories For Your Brand
How to Run Landing Page Tests On and Off Paid Social PlatformsVWO
Join us for an exclusive webinar featuring Mariate, Alexandra and Nima where we will unveil a comprehensive blueprint for crafting a successful paid media strategy focused on landing page testing.With escalating costs in paid advertising, understanding how to maximize each visitor’s experience is crucial for retention and conversion.
This session will dive into the methodologies for executing and analyzing landing page tests within paid social channels, offering a blend of theoretical knowledge and practical insights.
The Pearmill team will guide you through the nuances of setting up and managing landing page experiments on paid social platforms. You will learn about the critical rules to follow, the structure of effective tests, optimal conversion duration and budget allocation.
The session will also cover data analysis techniques and criteria for graduating landing pages.
In the second part of the webinar, Pearmill will explore the use of A/B testing platforms. Discover common pitfalls to avoid in A/B testing and gain insights into analyzing A/B tests results effectively.
A.I. (artificial intelligence) platforms are popping up all the time, and many of them can and should be used to help grow your brand, increase your sales and decrease your marketing costs.In this presentation:We will review some of the best AI platforms that are available for you to use.We will interact with some of the platforms in real-time, so attendees can see how they work.We will also look at some current brands that are using AI to help them create marketing messages, saving them time and money in the process. Lastly, we will discuss the pros and cons of using AI in marketing & branding and have a lively conversation that includes comments from the audience.
Key Takeaways:
Attendees will learn about LLM platforms, like ChatGPT, and how they work, with preset examples and real time interactions with the platform. Attendees will learn about other AI platforms that are creating graphic design elements at the push of a button...pre-set examples and real-time interactions.Attendees will discuss the pros & cons of AI in marketing + branding and share their perspectives with one another. Attendees will learn about the cost savings and the time savings associated with using AI, should they choose to.
The session includes a brief history of the evolution of search before diving into the roles technology, content, and links play in developing a powerful SEO strategy in a world of Generative AI and social search. Discover how to optimize for TikTok searches, Google's Gemini, and Search Generative Experience while developing a powerful arsenal of tools and templates to help maximize the effectiveness of your SEO initiatives.
Key Takeaways:
Understand how search engines work
Be able to find out where your users search
Know what is required for each discipline of SEO
Feel confident creating an SEO Plan
Confidently measure SEO performance
When most people in the industry talk about online or digital reputation management, what they're really saying is Google search and PPC. And it's usually reactive, left dealing with the aftermath of negative information published somewhere online. That's outdated. It leaves executives, organizations and other high-profile individuals at a high risk of a digital reputation attack that spans channels and tactics. But the tools needed to safeguard against an attack are more cybersecurity-oriented than most marketing and communications professionals can manage. Business leaders Leaders grasp the importance; 83% of executives place reputation in their top five areas of risk, yet only 23% are confident in their ability to address it. To succeed in 2024 and beyond, you need to turn online reputation on its axis and think like an attacker.\
Key Takeaways:
- New framework for examining and safeguarding an online reputation
- Tools and techniques to keep you a step ahead
- Practical examples that demonstrate when to act, how to act and how to recover
Top 3 Ways to Align Sales and Marketing Teams for Rapid GrowthDemandbase
In this session, Demandbase’s Stephanie Quinn, Sr. Director of Integrated and Digital Marketing, Devin Rosenberg, Director of Sales, and Kevin Rooney, Senior Director of Sales Development will share how sales and marketing shapes their day-to-day and what key areas are needed for true alignment.
Digital marketing is the art and science of promoting products or services using digital channels to reach and engage with potential customers. It encompasses a wide range of online tactics and strategies aimed at increasing brand visibility, driving website traffic, generating leads, and ultimately, converting those leads into customers.
https://nidmindia.com/
Financial curveballs sent many American families reeling in 2023. Household budgets were squeezed by rising interest rates, surging prices on everyday goods, and a stagnating housing market. Consumers were feeling strapped. That sentiment, however, appears to be waning. The question is, to what extent?
To take the pulse of consumers’ feelings about their financial well-being ahead of a highly anticipated election, ThinkNow conducted a nationally representative quantitative survey. The survey highlights consumers’ hopes and anxieties as we move into 2024. Let's unpack the key findings to gain insights about where we stand.
5 big bets to drive growth in 2024 without one additional marketing dollar AND how to adapt to the biggest shifting eCommerce trend- AI.
1) Romance Your Customers - Retention
2) ‘Alternative’ Lead Gen - Advocacy
3) The Beautiful Basics - Conversion Rate Optimization
4) Land that Bottom Line - Profitability
5) Roll the Dice - New Business Models
Monthly Social Media News Update May 2024Andy Lambert
TL;DR. These are the three themes that stood out to us over the course of last month.
1️⃣ Social media is becoming increasingly significant for brand discovery. Marketers are now understanding the impact of social and budgets are shifting accordingly.
2️⃣ Instagram’s new algorithm and latest guidance will help us maintain organic growth. Instagram continues to evolve, but Reels remains the most crucial tool for growth.
3️⃣ Collaboration will help us unlock growth. Who we work with will define how fast we grow. Meta continues to evolve their Creator Marketplace and now TikTok are beginning to push ‘collabs’ more too.
Most small businesses struggle to see marketing results. In this session, we will eliminate any confusion about what to do next, solving your marketing problems so your business can thrive. You’ll learn how to create a foundational marketing OS (operating system) based on neuroscience and backed by real-world results. You’ll be taught how to develop deep customer connections, and how to have your CRM dynamically segment and sell at any stage in the customer’s journey. By the end of the session, you’ll remove confusion and chaos and replace it with clarity and confidence for long-term marketing success.
Key Takeaways:
• Uncover the power of a foundational marketing system that dynamically communicates with prospects and customers on autopilot.
• Harness neuroscience and Tribal Alignment to transform your communication strategies, turning potential clients into fans and those fans into loyal customers.
• Discover the art of automated segmentation, pinpointing your most lucrative customers and identifying the optimal moments for successful conversions.
• Streamline your business with a content production plan that eliminates guesswork, wasted time, and money.
For too many years marketing and sales have operated in silos...while in some forward thinking companies, the two organizations work together to drive new opportunity development and revenue. This session will explore the lessons learned in that beautiful dance that can occur when marketing and sales work together...to drive new opportunity development, account expansion and customer satisfaction.
No, this is not a conversation about MQLs and SQLs. Instead we will focus on a framework that allows the two organizations to drive company success together.
European Rotors - Contributing to the Swiss Innovation Day
1. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter – a Leonardo Company
From the 1st Swiss Helicopter to the 1st Swiss
Hybrid Helicopter
Cologne
November, 17th, 2021
Michele Riccobono
Kopter CTO
2. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
The «new generation» single...
FADEC
turboshaft engine
with outstanding
hot and high
performance
Shrouded
low noise
and high
safety
tail rotor
High
tail-boom
clearance
Superior
cargo-hold
with rear
access
Latest
generation
Garmin G3000H
IFR-compatible
flight deck with
and NVG friendly
glass cockpit
and touchscreen
control
Advanced rotor system
with 5 blades in
full composites
for low vibration
and low noise
Up to 1+8
Passengers
on individual
crashworthy
seats
6.5 m3 modular cabin
with equivalent size
compared to a
twin-engine helicopter
Crashworthy
composite
airframe
Dual hydraulic
and
dual electrical
systems
All images for reference only
Apr 2021 |
Kopter Group AG | Company Presentation 2
3. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
…with first-in-class cabin and flexibility
Apr 2021 |
Kopter Group AG | Company Presentation 3
All images for reference only
Comfortable rear access through clamshell doors and high tail boom
Equipment, stretcher or cargo easy loading
Passenger sliding doors and pilot hinge doors on both sides
Unobstructed side accessibility, without structural
elements between cockpit and cabin area
A truly multipurpose vertical platform
4. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
• Are eVTOLs going to replace helicopters?
Kopter Group AG I Title Feb 2021 I 4
• Can we develop a fully electric helicopter?
The two questions behind the Kopter Roadmap
5. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 5
Can we develop a fully electric helicopter?
Cell energy density evolution scenarios
Lithium-sulfur batteries commercialize,
offering gravimetric cell energy density
of up to ~2,510 Wh/kg, pushing base
case CAGR levels by 2.5%
Targets from Innolith are met
with prior cell density growth
rates of 7% CAGR (2020-2025)
and their batteries are
commercialized at scale
Traditional Lithium-ion
batteries continue to progress
up to 350 Wh/kg and solid-
state batteries are scaled
- Best case
- Base case
Even after density develops sufficiently, there will be a 5+ year delay for
wider adoption (certification, production timeline, adaption for aviation usage)
Good confidence,
current investment
focus mainly driven by
automotive industry
Low confidence,
enabling technologies
still in early stage and
any investments for
industrialization could
probably not be driven
by automotive industry
Note: LHS: Assumes that targets from Tesla, QuantumScape, Innolith etc. will be met and that solid state batteries commercialize; RHS: Assumes all else equal; 1) Next to battery cell density, battery degradation
improvement critical is to secure sufficient energy capture;
Source: Expert interviews
Battery cells energy density is the main hurdle to achieve full electric flight
2030+ evolution remains uncertain due to lower automotive investment appetite
Battery Evolution Scenarios
6. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 6
Trade-off between Range and Payload generates different operating scenarios
Operational Scenarios
Long Light Single Helicopter* Range & Payload: Full Electric vs Turbine
Increase in Battery capacity
(both Energy & Power)
Take Off
Power
Limit
Key Evidences
Payload reduction in favour of
Battery Capacity allows to
increase flight Range
Power needed to take off requires
a minimum battery size to allow
the Helicopter to take-off
Despite battery density expected
growth, Full Electric Helicopter
does not guarantee the same
Payload and Range as of a
Turbine HC
Balance between Range and
Payload set new potential
operating scenarios once
battery technology to reach
maturity in 2040+
Today
Range
Note: (*) considering a conventional Architecture; Main Assumptions: Fixed MTOW, Turbine efficiency ~25%, cell-to-module ratio 1,1, volumes analysis not considered
Details in the next slides
Details in next slides
Lower
Range
Lower Payload Higher Payload
Today nominal
performance
Higher
Range
Range: 100%
Payload: 40%
Range: 50%
Payload: ~130%
Electric vs. Turbine Helicopter
7. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 7
The Hybrid Helicopter
Why add electric propulsion?
• New operational scenarios
(e.g., congested hostile areas)
• Mitigate operational risks
• Simplify training procedures
• Improve public acceptance
• Higher efficiency propulsion
lower operating cost
• Lower CO2 output
environmental benefits
8. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 8
Additional safety
Extra power during critical operations
The Roadmap: from Hybrid for Safety to Hybrid for Performance
Single Engine Hybrid
9. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 9
Use Case Scenarios
Engine Failure inside the H-V Curve
1. Engine failure immediately counteracted by the
electrical propulsion system
Single
Hybrid
100
4. Energy
reserve for
a safe,
controlled
landing.
2. Continuous safe flight
out of the avoid zone
State of
Charge
3. Descent – reduced electric
power consumption
10. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 10
Hybrid Mission Enhancement
Power, Endurance and Weight: The trade-off
Depending on required capabilities and available battery capacity a trade-off is
possible between power available, battery weight and endurance
Single engine with twin engine capability and safety
Endurance
11. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 11
Hybrid versus current Rotorcraft Categories
Safety benefits
Installed Elec Power Battery Weight Benefit in the event of engine IFSD
Low Low Autorotation Support
Medium Low to Medium «Cat-A like» procedures
High Medium to High «Uneventful» emergency handling
Training benefits
Installed Elec Power Battery Weight Benefit in the event of engine IFSD
Low Low Risk reduction in Autorotation training
Medium Low to Medium No need for full autorotation landing training
High Medium to High No need for specific Engine Failure training
12. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 12
A Class of its Own
Finding a Path Toward Extended Operating Capabilities
Single Turbine
Performance Class 3
Upon engine failure at any time during the
flight, a forced landing will be required
Certified in
Category B
The Hybrid architecture may
offer at low altitude a safety
level superior to Category A
rotorcrafts.
Perfo
Class
Engine Failure
Before TDP After TDP
1
2
3
“H”
Rejected
Take-Off +
“AEO” Obstacle
Clearance &
Safe Landing
Forced
Landing
OEI Obstacle
Clearance
Rejected
Take-Off
TDP
TDP: Take-off Decision Point
13. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG I Title Feb 2021 I 13
Hybrid versus current Rotorcraft Categories
Extension of the Safety Continuum
PERFORMANCE CLASS 3
Non-hostile environments
Non-congested hostile environments without a safe forced landing capability under specific
approval
Take-off and landing phases to/from an aerodrome or operating site located outside a
congested hostile environment without an assured safe forced landing capability
PERFORMANCE CLASS 2
Operations without an assured safe forced landing capability during the take-off and landing
phases only with approval by the competent authority
PROPOSED PERFORMANCE CLASS “H” - additional operations:
• Take-off and landing to/from an operating site (HEMS included) in hostile environment
• Flights over congested areas within “electric flight” distance of a safe landing capability
14. Kopter Group AG makes no representation or warranty as to the completeness of this information
and shall not be held liable for any representations (expressed or implied) regarding information contained in this document or any other written or oral communications.
Kopter – a Leonardo Company
Kopter Group AG
Binzstrasse 31
8620 Wetzikon
Switzerland
Registered Office
Flugplatzareal 10
8753 Mollis
Switzerland
E contact@koptergroup.com
T +41 44 552 33 33
koptergroup.com
Kopter – a Leonardo Company