In this ppt one can know the diiferent softwares and several online servers for the epitope mapping.This mapping helpful for production of different vaccines and antibodies.
2. Antigen-antibody interaction
• Antigen is recognized by the immune system and stimulates an
antibody response
• Can be a bacteria, virus, a protein…
• Originally the term antigen came from antibody generator
Antigen
3. An
• Antigen is recognized as foreign by the immune system and
is engulfed by antigen presenting cells, such as macrophages,
monocytes and dendritic cells
Antigen presenting cell
Antigen
Antigen-antibody interaction
4. Antigen-antibody interaction
• The antigen is degrated into smaller fragments and displayed
on the cell surface together with specialized glycoproteins
Antigen presenting cell
Antigen
6. Antigen-antibody interaction
• T-cells stimulate B-cells to produce
antibodies towards the specific antigen
Antigen presenting cell
T-cell
B-cell
Antibodies
Antigen
9. Antigen presenting cell
T-cellSelf protein
(auto-antigen)
B-cell
Auto-antibodies
• Abnormal functioning of the immune system, it fails to recognize
protein/tissue ~ antibody response is produced against these
• A disease that results from such an immune response is termed an
autoimmune disease
Auto-immune disease
10. Epitope mapping
• Epitope mapping is the process of identifying the binding
sites of antibodies on their target antigens
• Several strategies for epitope mapping exist:
recombinant proteins
X-ray co-crystallography
phage-display
peptide scanning
truncated resin-bound peptides
Through Bioinformatical analysis
11. Need
Used for vaccine development against influenza,small
pox,pertusis
mAB and Polyclonal antobodies production.
To know the antigen-antibody interaction.
12. Why epitope mapping ??
Conventional vaccine production is time consuming.
Atteneuated or killed pathogen may cause disease in
host genome.
To know the different consensus and conserved
sequence which forms epitopes.
13. Epitope based vaccine
Immunoprotective and immuno dominat epitopes are
used.
rDNA technology is used for multitarget vaccine
production.
Linear epitope or conformational epitope is used.
Also used as adjuvents. e.g T cell epitopes.
14.
15. Prediction of potential T- cell
binding-epitopes
Interaction occures between R groups of epitope and
Grooves/pocket of MHC molecules.
RANKEP –online server predicts peptides binders to
MHC-I and MHC-II alleles.
PSSM(position specific scoring matrices) algorithim is
used in RANKEP.
16. Lets take an example
>A56881 PIR2 release 71.00
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKH
NMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELA
HYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMP
EGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVIL
YSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGI
AEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQ
KVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVH
EIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADS
SIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRI
SKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPM
FKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS
VSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPD
RPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQA
AAETLSEVA
Protein blast was done to know the function of this protein
28. PREDICTION OF B-CELL BINDING
EPITOPES
B cell epitopes are recognized by B cell receptors or
antibodies in their native structure.
Score is calculated on the bais of AA properties such as
hydrophilicity,charge,exposed surface area and secondary
structures.
Different online server are present for continuous and
discontinous B-cell epitopes.
It has been tested on B cell epitope database (BCIPEP),
and will therefore presumbly have better performance for
prediction of B cell epitope of the antigen. Bcepred can
predict continuous B cell epitopes.
32. CONCLUSION
Epitope mapping gives high throughput analysis of
dfferent candidate sequences for prediction of
potential epitopes.
Less time consuming and less expensive.
Editor's Notes
Imagine that we have an antigen. An Antigen, is a molecule, usually foreign, which is recognized by the immune system and stimulates a antibody response. Originally the term came from antibody generator. An antigen can be a bacteria, virus, a protein, a lipid, carbohydrate…..
This antigen is recognized as foreign by the immune system and the antigen is engulfed by antigen presenting cells
The antigen is degrated into smaller fragments and displayed on the cell surface together with specialized glycoproteints.
T-Cells will recognize the antigen-glycoprotein complex
T-Cells stimulate B-cells to produce antibodies towards the specific antigen. These antibodies are of significant importance, so I’m going to take a moment to introduce you to these antibodies.
Next the antibodies produced will interact with the antigen. The region of an antigen that interacts with an antibody is defined as an epitope. And it is this specific interaction between the antibody and the epitope of the antigen that I’m interested in.
Finally, when the antibodies have bound to the antigen, the antigen is neutralized.
This is more or less what happens, when an antigen induces an antigen response. The antigen is recognized as foreign by the immune system, a cascade of cellular reactions takes place, and eventually specific antibodies are generated towards the antigen, and finally the antigen is neutralized.
Occasionally, abnormal functioning of the immune system occur, the immune system fails to recognize own cells/proteins, and an antibody response is produced against these. A Disease that results from such an immune response is termed an auto-immune disease.
The Antibodies produced in this process are termed auto-antibodies, whereas the protein/tissue that triggers this immune response is termed auto-antigen.
type 1 diabetes is one of the most known autoimmune diseases, where the insulin producing cells are destroyed, another example is celiac disease, which I’m going to introduce you to.