SlideShare a Scribd company logo
DR. KAMLESH LALA
M.B.B.S.; D.PED, FCGP
FAMILY PHYSICIAN
NARANPURA
KAMLESHLALA@ HOTMAIL.COM
 Immunisation is one of the most cost
effective of all the health care interventions
practiced worldwide.
 Vaccination provides the opportunity to
eradicate, eliminate or significantly reduce
common infectious diseases to save lives and
to reduce human suffering.
 A vaccination schedule is a series of vaccinations,
including the timing of all doses, which may be either
recommended or compulsory depending on the
country of residence, needs of the community, disease
burden, feasibility of implementation, availability of
vaccines and cost effectiveness.
 Based on above issues, every country decides its own
immunisation schedule as per the local
epidemiological situation and programmatic needs.
Guidelines for evidence-based review on
vaccine-related recommendations are available
from Advisory Committee on Immunization
Practice (ACIP), Strategic Group of Advisory
Experts on immunization (SAGE), European
Center for Disease Control (ECDC) and WHO.
ACIP review the evidence for best practices and
release updated guidance every 3 – 5 years.
Indian Academy of Pediatrics (IAP) Advisory Committee
on Vaccines & Immunization Practices (ACVIP), set up
as a special subcommittee of the academy, has been
entrusted with the responsibility to frame the
recommendations.
The WHO launched global immunisation program
in 1974, known as Expanded Program on
Immunisation (EPI) to protect all children of the
world against six killer diseases.
And the journey continues with newer and newer
vaccines.
Age
Vaccine
Birth 6 weeks 10 weeks` 14 weeks 9 months
BCG BCG
OPV OPV 1 OPV 2 OPV 3
DPT DPT 1 DPT 2 DPT 3
Measles Measles
 1978 - The Govt of India launched its EPI to cover BCG,
DTP, OPV and Typhoid.
 1981 - Typhoid-paratyphoid vaccine was dropped from EPI
due to higher reactogenicity and low efficacy of the
vaccines
 1983 - tetanus toxoid vaccine for pregnant woman added in
EPI.
 1985 - EPI was modified as Universal Immunisation
Programme (UIP).
 1985 - First dose of measles was added .
 1992 - UIP become a part of child survival and safe
motherhood (CSSM).
 2002 - Hepatitis B was piloted and scaled up in entire
country .
 2006 - Japanese encephalitis in endemic areas.
 2010 -Phase wise introduction of Second dose of
measles .
 2011 December - Pentavalent vaccine introduced in
phase wise.
 2014 December - Mission Indradhanush was launched
to cover children up to two years and pregnant
women.
 2016 - New vaccines are added namely Rubella, IPV
and Rotavirus.
 Also tOPV was replaced by bOPV.
 Adult JE vaccination was started
 2017 - Pneumococcal conjugate vaccine PCV was
added in UIP in certain states (HP, UP, Bihar).
 2017 October - Intensified Mission Indradhanush IMI
was launched with a target to achieve 90%
coverage by 2018 instead of 2020.
 2017 February - Measles-Rubella MR campaign started.
 Thus under UIP, government is providing vaccination to
prevent 11 vaccine preventable diseases (VPD) to infants.
 DTP
 HepB Pentavalent
 Hib
 Polio
 MR
 Childhood TB
 Rotavirus diarrhoea
 JE
INDIVIDUAL VACCINES
 At birth or as early as possible preferably
within 24 hours.
 If missed by any reason, it should be given
till one year of age.
 Universal hepatitis B vaccination within 24 hours
of birth for medically stable infants weighing more
than 2 Kg.
 Three doses are given at 6-10-14 weeks as a
pentavalent vaccine. Here 4 doses are permissible
including zero dose.
 For catch up, at 0 – 1 – 6 months.
 No booster is required.
 If mother is HBsAg positive, give 0.5 ml
HBIG along with HepB vaccine.
 For orphan infant, post vaccination
serologic testing is must.
 Single dose revaccination for infants born to
HBsAg positive mothers not responding to
initial vaccine series tested at 9-12 months
age.
 Zero dose within 15 days of birth
 Three doses at 6, 10,and 14 weeks
 OPV booster with DTP/Quadrivalent at 18
months.
 Additional doses of OPV on all pulse polio days till
5 years of age.
 It will be discontinued once IPV is freely available.
On 25 Feb 2012 INDIA is removed from the list of
“POLIO ENDEMIC COUNTRIES”
 As a part of polio end game strategy, IPV has been
introduced.
 If available or as a combination (Hexavalent) vaccine:
three doses at 6-10-14 weeks
 If not possible, give at least one dose at 14 weeks along
with OPV (either standalone or combination vaccine)
 Two fractional intradermal doses of IPV (fIPV- 0.1 ml)
at 6 and 14 weeks are either equally or more effective.
Given in govt. facilities.
 Again if available, booster at 12-18 months.
 DTwP is superior to DTaP.
 3 primary doses at 6-10-14 weeks either as
DTP or pentavalent or hexavalent
 First booster at 16-24 months either as DTP
or Quadrivalent
 Second booster at 4-6 years
 Immunity wanes more rapidly after first year with aP
vaccine. So WHO advised to consider additional
boosters and immunisation of mothers during
pregnancy. So Tdap vaccine is for countries using
DTaP
 Single dose to all adolescents and adults who have not
received the same.
 Women are recommended to receive a dose of Tdap
during each pregnancy between 27 to 36 weeks
regardless of previous receipt of it.
 Three doses at 6-10-14 weeks as a pentavalent
 Booster at 16-24 months as Quadrivalent
 Catch up schedule:
 For age 6 -12 months, two doses plus one booster
 For age 12-15 months, one dose plus one booster (can be
given after 4 weeks of last dose)
 For age 15 months to 5 years, only one dose.
 No catch up above 5 years.
 Remember, this is an ORAL vaccine.
 First dose should be started as early as 6 weeks.
 For Rotarix®
 Two doses at 4 weeks interval: 6 and 10 weeks
 For other brands
 Three doses at 6-10-14 weeks age.
 For both the vaccines:
 First dose not later than 16 weeks.
 Last dose not later than 32 weeks
 If given for the first time, two doses are to be given
at one month interval for children aged 6 months
to 9 years
 Only half the dose is required for children from 6
months to 3 years.
Age Group Dose No of doses
in the first
year of
vaccination
If
previously
received
one or
more doses
6 months to 3 years 0.25 ml 2 doses at 4
weeks apart
1
3 years to 9 years 0.5 ml 2 doses at 4
weeks apart
1
9 years and older 0.5 ml 1 1
 It may not be practical to recommend routine
influenza vaccine to everyone in India.
 It is recommended for high risk groups of children
below five, medical practitioners, pregnant women
and elderly.
 The dose is to be repeated every year around July-
August.
 Adult (0.5 ml) dose cannot be halved to make a
pediatric dose.
 Two brands are available: Synflorix® and Prevenar ®
 Three doses at 6-10-14 weeks.
 One booster at 15 months
 Catch up schedule
Age
No of doses
Booster
At 15
months
6-12 months 2 1 4 weeks apart
12-23 months 1 1 8 weeks apart
2-5 years 1 No Booster
 Total three doses are given
 9-12 months (270 days completed)
Monovalent measles is replaced by MMR
 15-18 months
 4-6 years
 Additional dose of MR vaccine during MR
campaign for children 9 months to 15 years
irrespective of previous immunisation.
• Compared to earlier ViPS and oral typhoid
vaccines,
• TCV provides longer-lasting protection,
• Requires fewer doses and
• Is suitable for children under two years
of age.
Developed for the first time by an Indian Company.
Two brands are available in India. (2013)
Typbar TCV® (25mcg/dose) which is also WHO
prequalified vaccine.
Other one is Tyvax CV® (5mcg/dose)
IAP advocates former one Typbar TCV®
 First dose starting at 6 months of age
 Natural boosting may occur in endemic
areas.
 There is a lack of evidence concerning
the need for booster vaccination.
 So at present no booster recommended
 Only one dose of HepA live attenuated vaccine
starting at age 12 months onward. No booster.
(Biovac A ®)
 Two doses of Hep A killed vaccine. (Havrix®)
 First dose at 12-23 months
 Second dose after six months
 Havrix® 720 can be given till 18 years.
 Havrix® 1440 for adults after 18 years.
 Hepatitis A and B combination vaccine
 Available as junior and adult
 Used for catch up immunisation only – not for routine
 First dose at 12-15 months.
 Second dose any time after 3 months of first
dose.
 Catch up
 For children aged 7-12 years:
 2 doses with a gap of 3 months
 For persons aged 13 years and older:
 2 doses with a gap of 4 weeks.
 For children age 2 months to 5 years DTaP or DTwP
 For child between 5 to 7 years of age, DT is given.
 Later on if patient needs tetanus prophylaxis, ACIP
recommends Td or if appropriate Tdap, but not single
antigen tetanus.
 Booster dose with Td is to be given every ten years
throughout life time.
 Pregnancy
 2 doses : 1st as early as possible and second after 4 weeks of
first dose and before 36 weeks.
 Booster dose: Only one dose in last trimester if previously two
doses are taken.
RABIES
 One dose is reduced both in PrEP and PEP
by ACIP way back in 2010. (But by IAP
recommended only this year).
 No need for RIG, if previously vaccinated
either PrEP or PEP.
 hRIG and eRIG are equally effective.
 No need for skin testing before eRIG.
 If anatomically feasible, the full dose of RIG
should be thoroughly infiltrated in the area
around and into the wounds along with first
dose of ARV or within 7 days of the same in
category III bites.
 The remaining dose if any not to be injected IM
at a distance from wound. It can be spared for
another patient after due aseptic precautions.
Scrupulous wound cleaning and deep irrigation with
soap and water (at least for 15 minutes), application
of a potent antiseptic agent, and timely
administration of first anti rabies vaccine followed
by complete course of rabies vaccine are key factors
in increasing survival when RIG is unavailable.
Wound toilet is must even if patient reports late
(should be advised if wound is still not healed)
 Pre Exposure Prophylaxis:
Two doses on day 0 and 7.
 Post Exposure Prophylaxis: Four dose schedule
 Essen Regimen: 0 , 3, 7 and between 14-28 days.
 Zagreb Regimen: Two doses on day 0, and one dose on days 7
and 21.
 IPC Regimen: 2 site ID on days 0, 3 and 7.
 Re-exposure if within 3 months: No need for vaccine.
 Re-exposure at any time after three months:
 Two dose on days 0 and 3.
 4 site ID on day 0
 I site ID on days 0 and 3
 No suturing or bandage
 No contraindication for use of PrEP or PEP
including pregnancy, immunocomprised, person
taking chloroquine or HCQS.
 It should never be given in gluteal region. And if it
is given, then this dose should not be counted.
 Change in brand and the route of administration
are acceptable.
 Should a vaccine dose is delayed, resume the
schedule from where left. No need to
restart.
 No need for ARV after a bite by rodent (rat),
squirrel, hare and rabbit. Bat rabies is not
conclusively proved in India and so exposure
to bat also does not warrant PEP.
 History of rabies vaccination in dog is not always a
guarantee that the biting animal is not rabid. There are
several factors for failure of vaccination to dog. So
better to give PEP.
 PEP should be started immediately after the bite. The
observation period of 10 days is valid for dogs and cats
only. If biting animal is healthy throughout
observation period, PEP can be converted to PrEP by
skipping the fourth dose.
Introduced in 2017.
 In view of the irregular availability and high cost of
RIGs, human monoclonal Ab is an alternative to RIGs,
in category III bites.
 Available in India as Rabishield®.
Agent Dose in IU per Kg
body weight
Concentration
IU Per ml
hRIG 20 150
eRIG 40 200
RHMAB 3.33 40 and 100
 Gardasil® is 9 valent while Cervarix® is bivalent.
 Gardasil® is indicated for both male and female.
 Cervarix® is indicated for females only.
 Cervarix® is not available in USA.
Vaccine Age in years Dose Interval
Both 9 – 14 2 0 - 6
Gardasil® 15 - 45 3 0 – 2 - 6
Cervarix® 15 - 25 3 0 – 1 - 6
 Meningococcal Conjugate Vaccine MCV4 or
MenACWY single dose for microbiologists,
military recruits, students living in dormitories
and travellers to endemic regions for adults less
than 55 years.
 Revaccination recommended every 5 years
 Polysaccharide vaccine is for adults more than 55
years
 Vaccination must for travellers to Hajj
Age wise schedule of vaccines
BCG
OPV Zero
HepB
 OPV
 IPV
 DTP As pentavalent or hexavalent
 HepB
 Hib
 Rotavirus
 PCV 10 (Synflorix®) or PCV 13 (Prevenar®)
 Typhoid TCV
 (Can be given at nine months to reduce
the visit)
 Influenza
 MMR - 1
 Typhoid TCV, if not given at 6 months
Hepatitis A
Depending upon brand,
either single or two doses
 MMR - 2
 PCV Booster
 Chicken Pox – 1
Second dose can be given any time after 3
months
 DTP Booster
 Hib Booster can be given as Quadravalent
 OPV - 5
 IPV (If available in the market)
 DTP Booster – 2
 OPV - 6
 MMR - 3
 Td or Tdap
 HPV
 Finish the schedule as per brand.
 Adults need vaccines based on their age, health
conditions, job, lifestyle, or travel habits.
 Vaccines are given according to catch up schedule.
 Routine vaccinations are:
 Flu vaccine
 Pneumococcal Vaccine
 Tdap vaccine
 Zoster vaccine
 Flu shot is given every year.
 Tdap and/or Td is given as discussed earlier
 Zoster vaccine advised depending on vaccine.
 RZV after 50 years and ZVL after 60 years.
 MMR, Chicken Pox, HepA, HepB, Hib, HPV.
(If not given earlier during childhood)
 It is recommended for
 All children younger than 2 years old
 All adults 65 years or older
 People from 2 to 64 years old with
certain medical conditions.
 cerebrospinal fluid (CSF) leaks
 cochlear implants
 sickle cell disease or other hemoglobinopathies
 congenital or acquired asplenia ‚
 congenital or acquired immunodeficiencies ‚
 HIV infection ‚
 chronic renal failure, ‚nephrotic syndrome ‚
 leukemia ‚lymphoma ‚Hodgkin disease ‚generalized
malignancy, ‚iatrogenic immunosuppression, ‚solid
organ transplant,‚multiple myeloma
PPSV23 OR Pneumovax®
It is recommended for
All adults 65 years or older
People from 2 to 64 years old with
certain medical conditions.
 Chronic heart or lung disease
 Diabetes mellitus,
 Alcoholism ‚
 Chronic liver disease
 Adults who smoke cigarettes
 PCV13 Prevenar® and PPSV23 Pneumovax® should not
be administered simultaneously.
 Better immune response if PCV13 is administered first.
 PPSV23 after one year of PCV13.
 Booster of PPSV23 is given after 5 years, if first dose
given before 65 years.
 If PPSV 23 is administered first
 PCV 13 after8 weeks in children 6-18 years.
 PCV 13 after one year in adults 19 years and older.
 References:
 Weekly Epidemiological Record WER 48(92):
2017; 729-748.
 WER, Typhoid Vaccines, March 2018
 http://www.who.int/wer
 WHO position paper April 2018
 IAP ACVIP recommendations December 2018.
The brand names and pictures
mentioned are for information
only.
I do not advertise any brand.
Vaccine schedule 2019

More Related Content

What's hot

Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization Program
Priyanka Ch
 
EPI
EPIEPI
universal immunisation
universal immunisationuniversal immunisation
universal immunisation
salman habeeb
 
national immunisation policy somalia
national immunisation policy somalia national immunisation policy somalia
national immunisation policy somalia
jarati
 
Expanded Programme On Immunization In Nigeria
Expanded Programme On Immunization In NigeriaExpanded Programme On Immunization In Nigeria
Expanded Programme On Immunization In NigeriaMaimunat
 
Expanded Programme on Immunization: Poverty & Social Impact Analysis
Expanded Programme on Immunization: Poverty & Social Impact AnalysisExpanded Programme on Immunization: Poverty & Social Impact Analysis
Expanded Programme on Immunization: Poverty & Social Impact Analysis
Sustainable Development Policy Institute
 
National Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB PerspectivesNational Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB Perspectives
Mohammad Aslam Shaiekh
 
Routine immunization program in india
Routine immunization program in indiaRoutine immunization program in india
Routine immunization program in india
ITSU - Immunization Technical Support Unit
 
National immunization schedule
National immunization scheduleNational immunization schedule
National immunization schedule
Aashiya aara Ali
 
Universal vaccination programme
Universal  vaccination programmeUniversal  vaccination programme
Universal vaccination programme
Paavana0809
 
Immunization in India
Immunization in IndiaImmunization in India
Immunization in India
Vignesh Loganathan
 
Vaccinations schedule in Sri Lanka
Vaccinations schedule in Sri LankaVaccinations schedule in Sri Lanka
Vaccinations schedule in Sri Lanka
Chamath Fernando
 
IAP Guidebook on immunization 2007
IAP Guidebook on immunization 2007IAP Guidebook on immunization 2007
IAP Guidebook on immunization 2007
Dr.Nehal Vaidya
 
Vaccine in Nepal
Vaccine in NepalVaccine in Nepal
Vaccine in Nepal
anhui medical university
 
Epi program (blood)
Epi program (blood)Epi program (blood)
Epi program (blood)
Dr.Muhammad Omer
 
Universal immunisation program
Universal immunisation programUniversal immunisation program
Universal immunisation program
Shivangi dixit
 
Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization Program
Sravani Ambati
 
Universal immunization programme RRT
Universal immunization programme RRTUniversal immunization programme RRT
Universal immunization programme RRT
Ranjith Thampi
 
National Immunization Schedule
National Immunization ScheduleNational Immunization Schedule
National Immunization Schedule
Manisha Mandal
 
Checklists for Vaccines and Immunization
Checklists for Vaccines and ImmunizationChecklists for Vaccines and Immunization
Checklists for Vaccines and ImmunizationEveryWomanEveryChild
 

What's hot (20)

Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization Program
 
EPI
EPIEPI
EPI
 
universal immunisation
universal immunisationuniversal immunisation
universal immunisation
 
national immunisation policy somalia
national immunisation policy somalia national immunisation policy somalia
national immunisation policy somalia
 
Expanded Programme On Immunization In Nigeria
Expanded Programme On Immunization In NigeriaExpanded Programme On Immunization In Nigeria
Expanded Programme On Immunization In Nigeria
 
Expanded Programme on Immunization: Poverty & Social Impact Analysis
Expanded Programme on Immunization: Poverty & Social Impact AnalysisExpanded Programme on Immunization: Poverty & Social Impact Analysis
Expanded Programme on Immunization: Poverty & Social Impact Analysis
 
National Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB PerspectivesNational Immunization Program of Nepal from POSDCORB Perspectives
National Immunization Program of Nepal from POSDCORB Perspectives
 
Routine immunization program in india
Routine immunization program in indiaRoutine immunization program in india
Routine immunization program in india
 
National immunization schedule
National immunization scheduleNational immunization schedule
National immunization schedule
 
Universal vaccination programme
Universal  vaccination programmeUniversal  vaccination programme
Universal vaccination programme
 
Immunization in India
Immunization in IndiaImmunization in India
Immunization in India
 
Vaccinations schedule in Sri Lanka
Vaccinations schedule in Sri LankaVaccinations schedule in Sri Lanka
Vaccinations schedule in Sri Lanka
 
IAP Guidebook on immunization 2007
IAP Guidebook on immunization 2007IAP Guidebook on immunization 2007
IAP Guidebook on immunization 2007
 
Vaccine in Nepal
Vaccine in NepalVaccine in Nepal
Vaccine in Nepal
 
Epi program (blood)
Epi program (blood)Epi program (blood)
Epi program (blood)
 
Universal immunisation program
Universal immunisation programUniversal immunisation program
Universal immunisation program
 
Universal Immunization Program
Universal Immunization ProgramUniversal Immunization Program
Universal Immunization Program
 
Universal immunization programme RRT
Universal immunization programme RRTUniversal immunization programme RRT
Universal immunization programme RRT
 
National Immunization Schedule
National Immunization ScheduleNational Immunization Schedule
National Immunization Schedule
 
Checklists for Vaccines and Immunization
Checklists for Vaccines and ImmunizationChecklists for Vaccines and Immunization
Checklists for Vaccines and Immunization
 

Similar to Vaccine schedule 2019

Immunization schedule update
Immunization schedule   updateImmunization schedule   update
Immunization schedule update
Milan Mahakal
 
Vaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopauseVaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopause
Dr Meenakshi Sharma
 
Indian academy of pediatrics (iap) recommended immunization
Indian academy of pediatrics (iap) recommended immunizationIndian academy of pediatrics (iap) recommended immunization
Indian academy of pediatrics (iap) recommended immunization
mandar haval
 
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
DGFPublicAwareness
 
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
Lifecare Centre
 
Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,
DJ CrissCross
 
Vaccinations along all age groups in India
Vaccinations along all age groups in IndiaVaccinations along all age groups in India
Vaccinations along all age groups in India
KIMS
 
Immunization class 2022.pptx
Immunization  class 2022.pptxImmunization  class 2022.pptx
Immunization class 2022.pptx
Gayathri Nair
 
0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture
ANJUMKHATUN3
 
Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)
mandar haval
 
Childhood immunization
Childhood immunizationChildhood immunization
Childhood immunization
bran GOT
 
LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014
Gaurav Gupta
 
DNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-ImmunizationDNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-Immunization
Nibedita Mitra
 
Lecture 07. Childhood Immunization
Lecture 07. Childhood ImmunizationLecture 07. Childhood Immunization
Immunization routine table2
Immunization routine table2Immunization routine table2
Immunization routine table2jhansi94944
 
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
Lifecare Centre
 
0-18yrs-child-combined-schedule.pdf
0-18yrs-child-combined-schedule.pdf0-18yrs-child-combined-schedule.pdf
0-18yrs-child-combined-schedule.pdf
OdirisNOdirisN
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
jyothi132223
 
Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)
Sonali Paradhi Mhatre
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017
Gaurav Gupta
 

Similar to Vaccine schedule 2019 (20)

Immunization schedule update
Immunization schedule   updateImmunization schedule   update
Immunization schedule update
 
Vaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopauseVaccination in women from adolescence to menopause
Vaccination in women from adolescence to menopause
 
Indian academy of pediatrics (iap) recommended immunization
Indian academy of pediatrics (iap) recommended immunizationIndian academy of pediatrics (iap) recommended immunization
Indian academy of pediatrics (iap) recommended immunization
 
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls D.G.F. Guidelines on  Immunization for  Indian Adolescents Girls
D.G.F. Guidelines on Immunization for Indian Adolescents Girls
 
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...Delhi gynaecologist forum Guidelines on  Immunization for Indian Adolescent...
Delhi gynaecologist forum Guidelines on Immunization for Indian Adolescent...
 
Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,Recommended Immunization Schedules For Children And Adolescents,
Recommended Immunization Schedules For Children And Adolescents,
 
Vaccinations along all age groups in India
Vaccinations along all age groups in IndiaVaccinations along all age groups in India
Vaccinations along all age groups in India
 
Immunization class 2022.pptx
Immunization  class 2022.pptxImmunization  class 2022.pptx
Immunization class 2022.pptx
 
0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture0-18yrs-child-combined-schedule.pdf fracture
0-18yrs-child-combined-schedule.pdf fracture
 
Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)Immunisation guidlines 2013( IAP)
Immunisation guidlines 2013( IAP)
 
Childhood immunization
Childhood immunizationChildhood immunization
Childhood immunization
 
LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014LAIV in India - Should we use it? Sep 2014
LAIV in India - Should we use it? Sep 2014
 
DNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-ImmunizationDNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-Immunization
 
Lecture 07. Childhood Immunization
Lecture 07. Childhood ImmunizationLecture 07. Childhood Immunization
Lecture 07. Childhood Immunization
 
Immunization routine table2
Immunization routine table2Immunization routine table2
Immunization routine table2
 
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...Immunization for INDIAN Adolescents  Dr. Jyoti Agarwal Dr. Sharda Jain  Dr. J...
Immunization for INDIAN Adolescents Dr. Jyoti Agarwal Dr. Sharda Jain Dr. J...
 
0-18yrs-child-combined-schedule.pdf
0-18yrs-child-combined-schedule.pdf0-18yrs-child-combined-schedule.pdf
0-18yrs-child-combined-schedule.pdf
 
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptxfinalnewervaccinesakhileshppt-210521062533(3)(1).pptx
finalnewervaccinesakhileshppt-210521062533(3)(1).pptx
 
Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)Pediatric immunization (part 3/4)
Pediatric immunization (part 3/4)
 
Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017Chicken pox vaccine presentation jalandhar july 2017
Chicken pox vaccine presentation jalandhar july 2017
 

More from kamleshlala

Argument ppt
Argument pptArgument ppt
Argument ppt
kamleshlala
 
Anger management ppt
Anger management pptAnger management ppt
Anger management ppt
kamleshlala
 
Intramuscular injection ppp
Intramuscular injection pppIntramuscular injection ppp
Intramuscular injection ppp
kamleshlala
 
Intramuscular injection pain ppt
Intramuscular injection pain pptIntramuscular injection pain ppt
Intramuscular injection pain ppt
kamleshlala
 
Safe Injection Practice
Safe Injection PracticeSafe Injection Practice
Safe Injection Practice
kamleshlala
 
Safe Injection Practice
Safe Injection PracticeSafe Injection Practice
Safe Injection Practice
kamleshlala
 

More from kamleshlala (6)

Argument ppt
Argument pptArgument ppt
Argument ppt
 
Anger management ppt
Anger management pptAnger management ppt
Anger management ppt
 
Intramuscular injection ppp
Intramuscular injection pppIntramuscular injection ppp
Intramuscular injection ppp
 
Intramuscular injection pain ppt
Intramuscular injection pain pptIntramuscular injection pain ppt
Intramuscular injection pain ppt
 
Safe Injection Practice
Safe Injection PracticeSafe Injection Practice
Safe Injection Practice
 
Safe Injection Practice
Safe Injection PracticeSafe Injection Practice
Safe Injection Practice
 

Recently uploaded

Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness JourneyTom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
greendigital
 
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptxTriangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Dr. Rabia Inam Gandapore
 
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model SafeSurat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Savita Shen $i11
 
POST OPERATIVE OLIGURIA and its management
POST OPERATIVE OLIGURIA and its managementPOST OPERATIVE OLIGURIA and its management
POST OPERATIVE OLIGURIA and its management
touseefaziz1
 
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists  Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
Saeid Safari
 
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptxANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
Swetaba Besh
 
NVBDCP.pptx Nation vector borne disease control program
NVBDCP.pptx Nation vector borne disease control programNVBDCP.pptx Nation vector borne disease control program
NVBDCP.pptx Nation vector borne disease control program
Sapna Thakur
 
Knee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdfKnee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdf
vimalpl1234
 
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Oleg Kshivets
 
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptxMaxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
Dr. Rabia Inam Gandapore
 
Superficial & Deep Fascia of the NECK.pptx
Superficial & Deep Fascia of the NECK.pptxSuperficial & Deep Fascia of the NECK.pptx
Superficial & Deep Fascia of the NECK.pptx
Dr. Rabia Inam Gandapore
 
Ophthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE examOphthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE exam
KafrELShiekh University
 
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
VarunMahajani
 
Cervical & Brachial Plexus By Dr. RIG.pptx
Cervical & Brachial Plexus By Dr. RIG.pptxCervical & Brachial Plexus By Dr. RIG.pptx
Cervical & Brachial Plexus By Dr. RIG.pptx
Dr. Rabia Inam Gandapore
 
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptxHow STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
FFragrant
 
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
bkling
 
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
kevinkariuki227
 
Non-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdfNon-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdf
MedicoseAcademics
 
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIONDACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
DR SETH JOTHAM
 
Physiology of Chemical Sensation of smell.pdf
Physiology of Chemical Sensation of smell.pdfPhysiology of Chemical Sensation of smell.pdf
Physiology of Chemical Sensation of smell.pdf
MedicoseAcademics
 

Recently uploaded (20)

Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness JourneyTom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
Tom Selleck Health: A Comprehensive Look at the Iconic Actor’s Wellness Journey
 
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptxTriangles of Neck and Clinical Correlation by Dr. RIG.pptx
Triangles of Neck and Clinical Correlation by Dr. RIG.pptx
 
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model SafeSurat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
Surat @ℂall @Girls ꧁❤8527049040❤꧂@ℂall @Girls Service Vip Top Model Safe
 
POST OPERATIVE OLIGURIA and its management
POST OPERATIVE OLIGURIA and its managementPOST OPERATIVE OLIGURIA and its management
POST OPERATIVE OLIGURIA and its management
 
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists  Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
Ozempic: Preoperative Management of Patients on GLP-1 Receptor Agonists
 
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptxANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF URINARY SYSTEM.pptx
 
NVBDCP.pptx Nation vector borne disease control program
NVBDCP.pptx Nation vector borne disease control programNVBDCP.pptx Nation vector borne disease control program
NVBDCP.pptx Nation vector borne disease control program
 
Knee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdfKnee anatomy and clinical tests 2024.pdf
Knee anatomy and clinical tests 2024.pdf
 
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
Lung Cancer: Artificial Intelligence, Synergetics, Complex System Analysis, S...
 
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptxMaxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
Maxilla, Mandible & Hyoid Bone & Clinical Correlations by Dr. RIG.pptx
 
Superficial & Deep Fascia of the NECK.pptx
Superficial & Deep Fascia of the NECK.pptxSuperficial & Deep Fascia of the NECK.pptx
Superficial & Deep Fascia of the NECK.pptx
 
Ophthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE examOphthalmology Clinical Tests for OSCE exam
Ophthalmology Clinical Tests for OSCE exam
 
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
Pulmonary Thromboembolism - etilogy, types, medical- Surgical and nursing man...
 
Cervical & Brachial Plexus By Dr. RIG.pptx
Cervical & Brachial Plexus By Dr. RIG.pptxCervical & Brachial Plexus By Dr. RIG.pptx
Cervical & Brachial Plexus By Dr. RIG.pptx
 
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptxHow STIs Influence the Development of Pelvic Inflammatory Disease.pptx
How STIs Influence the Development of Pelvic Inflammatory Disease.pptx
 
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
Report Back from SGO 2024: What’s the Latest in Cervical Cancer?
 
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
TEST BANK for Operations Management, 14th Edition by William J. Stevenson, Ve...
 
Non-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdfNon-respiratory Functions of the Lungs.pdf
Non-respiratory Functions of the Lungs.pdf
 
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIONDACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
ACUTE SCROTUM.....pdf. ACUTE SCROTAL CONDITIOND
 
Physiology of Chemical Sensation of smell.pdf
Physiology of Chemical Sensation of smell.pdfPhysiology of Chemical Sensation of smell.pdf
Physiology of Chemical Sensation of smell.pdf
 

Vaccine schedule 2019

  • 1. DR. KAMLESH LALA M.B.B.S.; D.PED, FCGP FAMILY PHYSICIAN NARANPURA KAMLESHLALA@ HOTMAIL.COM
  • 2.  Immunisation is one of the most cost effective of all the health care interventions practiced worldwide.  Vaccination provides the opportunity to eradicate, eliminate or significantly reduce common infectious diseases to save lives and to reduce human suffering.
  • 3.  A vaccination schedule is a series of vaccinations, including the timing of all doses, which may be either recommended or compulsory depending on the country of residence, needs of the community, disease burden, feasibility of implementation, availability of vaccines and cost effectiveness.  Based on above issues, every country decides its own immunisation schedule as per the local epidemiological situation and programmatic needs.
  • 4. Guidelines for evidence-based review on vaccine-related recommendations are available from Advisory Committee on Immunization Practice (ACIP), Strategic Group of Advisory Experts on immunization (SAGE), European Center for Disease Control (ECDC) and WHO. ACIP review the evidence for best practices and release updated guidance every 3 – 5 years.
  • 5. Indian Academy of Pediatrics (IAP) Advisory Committee on Vaccines & Immunization Practices (ACVIP), set up as a special subcommittee of the academy, has been entrusted with the responsibility to frame the recommendations.
  • 6. The WHO launched global immunisation program in 1974, known as Expanded Program on Immunisation (EPI) to protect all children of the world against six killer diseases. And the journey continues with newer and newer vaccines.
  • 7. Age Vaccine Birth 6 weeks 10 weeks` 14 weeks 9 months BCG BCG OPV OPV 1 OPV 2 OPV 3 DPT DPT 1 DPT 2 DPT 3 Measles Measles
  • 8.  1978 - The Govt of India launched its EPI to cover BCG, DTP, OPV and Typhoid.  1981 - Typhoid-paratyphoid vaccine was dropped from EPI due to higher reactogenicity and low efficacy of the vaccines  1983 - tetanus toxoid vaccine for pregnant woman added in EPI.  1985 - EPI was modified as Universal Immunisation Programme (UIP).  1985 - First dose of measles was added .  1992 - UIP become a part of child survival and safe motherhood (CSSM).
  • 9.  2002 - Hepatitis B was piloted and scaled up in entire country .  2006 - Japanese encephalitis in endemic areas.  2010 -Phase wise introduction of Second dose of measles .  2011 December - Pentavalent vaccine introduced in phase wise.  2014 December - Mission Indradhanush was launched to cover children up to two years and pregnant women.
  • 10.  2016 - New vaccines are added namely Rubella, IPV and Rotavirus.  Also tOPV was replaced by bOPV.  Adult JE vaccination was started  2017 - Pneumococcal conjugate vaccine PCV was added in UIP in certain states (HP, UP, Bihar).  2017 October - Intensified Mission Indradhanush IMI was launched with a target to achieve 90% coverage by 2018 instead of 2020.  2017 February - Measles-Rubella MR campaign started.
  • 11.  Thus under UIP, government is providing vaccination to prevent 11 vaccine preventable diseases (VPD) to infants.  DTP  HepB Pentavalent  Hib  Polio  MR  Childhood TB  Rotavirus diarrhoea  JE
  • 12.
  • 14.  At birth or as early as possible preferably within 24 hours.  If missed by any reason, it should be given till one year of age.
  • 15.  Universal hepatitis B vaccination within 24 hours of birth for medically stable infants weighing more than 2 Kg.  Three doses are given at 6-10-14 weeks as a pentavalent vaccine. Here 4 doses are permissible including zero dose.  For catch up, at 0 – 1 – 6 months.  No booster is required.
  • 16.  If mother is HBsAg positive, give 0.5 ml HBIG along with HepB vaccine.  For orphan infant, post vaccination serologic testing is must.  Single dose revaccination for infants born to HBsAg positive mothers not responding to initial vaccine series tested at 9-12 months age.
  • 17.  Zero dose within 15 days of birth  Three doses at 6, 10,and 14 weeks  OPV booster with DTP/Quadrivalent at 18 months.  Additional doses of OPV on all pulse polio days till 5 years of age.  It will be discontinued once IPV is freely available.
  • 18. On 25 Feb 2012 INDIA is removed from the list of “POLIO ENDEMIC COUNTRIES”
  • 19.  As a part of polio end game strategy, IPV has been introduced.  If available or as a combination (Hexavalent) vaccine: three doses at 6-10-14 weeks  If not possible, give at least one dose at 14 weeks along with OPV (either standalone or combination vaccine)  Two fractional intradermal doses of IPV (fIPV- 0.1 ml) at 6 and 14 weeks are either equally or more effective. Given in govt. facilities.  Again if available, booster at 12-18 months.
  • 20.  DTwP is superior to DTaP.  3 primary doses at 6-10-14 weeks either as DTP or pentavalent or hexavalent  First booster at 16-24 months either as DTP or Quadrivalent  Second booster at 4-6 years
  • 21.
  • 22.  Immunity wanes more rapidly after first year with aP vaccine. So WHO advised to consider additional boosters and immunisation of mothers during pregnancy. So Tdap vaccine is for countries using DTaP  Single dose to all adolescents and adults who have not received the same.  Women are recommended to receive a dose of Tdap during each pregnancy between 27 to 36 weeks regardless of previous receipt of it.
  • 23.  Three doses at 6-10-14 weeks as a pentavalent  Booster at 16-24 months as Quadrivalent  Catch up schedule:  For age 6 -12 months, two doses plus one booster  For age 12-15 months, one dose plus one booster (can be given after 4 weeks of last dose)  For age 15 months to 5 years, only one dose.  No catch up above 5 years.
  • 24.
  • 25.  Remember, this is an ORAL vaccine.  First dose should be started as early as 6 weeks.  For Rotarix®  Two doses at 4 weeks interval: 6 and 10 weeks  For other brands  Three doses at 6-10-14 weeks age.  For both the vaccines:  First dose not later than 16 weeks.  Last dose not later than 32 weeks
  • 26.
  • 27.  If given for the first time, two doses are to be given at one month interval for children aged 6 months to 9 years  Only half the dose is required for children from 6 months to 3 years.
  • 28. Age Group Dose No of doses in the first year of vaccination If previously received one or more doses 6 months to 3 years 0.25 ml 2 doses at 4 weeks apart 1 3 years to 9 years 0.5 ml 2 doses at 4 weeks apart 1 9 years and older 0.5 ml 1 1
  • 29.  It may not be practical to recommend routine influenza vaccine to everyone in India.  It is recommended for high risk groups of children below five, medical practitioners, pregnant women and elderly.  The dose is to be repeated every year around July- August.  Adult (0.5 ml) dose cannot be halved to make a pediatric dose.
  • 30.
  • 31.  Two brands are available: Synflorix® and Prevenar ®  Three doses at 6-10-14 weeks.  One booster at 15 months  Catch up schedule Age No of doses Booster At 15 months 6-12 months 2 1 4 weeks apart 12-23 months 1 1 8 weeks apart 2-5 years 1 No Booster
  • 32.  Total three doses are given  9-12 months (270 days completed) Monovalent measles is replaced by MMR  15-18 months  4-6 years  Additional dose of MR vaccine during MR campaign for children 9 months to 15 years irrespective of previous immunisation.
  • 33. • Compared to earlier ViPS and oral typhoid vaccines, • TCV provides longer-lasting protection, • Requires fewer doses and • Is suitable for children under two years of age.
  • 34. Developed for the first time by an Indian Company. Two brands are available in India. (2013) Typbar TCV® (25mcg/dose) which is also WHO prequalified vaccine. Other one is Tyvax CV® (5mcg/dose) IAP advocates former one Typbar TCV®
  • 35.  First dose starting at 6 months of age  Natural boosting may occur in endemic areas.  There is a lack of evidence concerning the need for booster vaccination.  So at present no booster recommended
  • 36.
  • 37.  Only one dose of HepA live attenuated vaccine starting at age 12 months onward. No booster. (Biovac A ®)  Two doses of Hep A killed vaccine. (Havrix®)  First dose at 12-23 months  Second dose after six months  Havrix® 720 can be given till 18 years.  Havrix® 1440 for adults after 18 years.
  • 38.  Hepatitis A and B combination vaccine  Available as junior and adult  Used for catch up immunisation only – not for routine
  • 39.  First dose at 12-15 months.  Second dose any time after 3 months of first dose.  Catch up  For children aged 7-12 years:  2 doses with a gap of 3 months  For persons aged 13 years and older:  2 doses with a gap of 4 weeks.
  • 40.  For children age 2 months to 5 years DTaP or DTwP  For child between 5 to 7 years of age, DT is given.  Later on if patient needs tetanus prophylaxis, ACIP recommends Td or if appropriate Tdap, but not single antigen tetanus.  Booster dose with Td is to be given every ten years throughout life time.  Pregnancy  2 doses : 1st as early as possible and second after 4 weeks of first dose and before 36 weeks.  Booster dose: Only one dose in last trimester if previously two doses are taken.
  • 42.  One dose is reduced both in PrEP and PEP by ACIP way back in 2010. (But by IAP recommended only this year).  No need for RIG, if previously vaccinated either PrEP or PEP.  hRIG and eRIG are equally effective.  No need for skin testing before eRIG.
  • 43.  If anatomically feasible, the full dose of RIG should be thoroughly infiltrated in the area around and into the wounds along with first dose of ARV or within 7 days of the same in category III bites.  The remaining dose if any not to be injected IM at a distance from wound. It can be spared for another patient after due aseptic precautions.
  • 44. Scrupulous wound cleaning and deep irrigation with soap and water (at least for 15 minutes), application of a potent antiseptic agent, and timely administration of first anti rabies vaccine followed by complete course of rabies vaccine are key factors in increasing survival when RIG is unavailable. Wound toilet is must even if patient reports late (should be advised if wound is still not healed)
  • 45.  Pre Exposure Prophylaxis: Two doses on day 0 and 7.  Post Exposure Prophylaxis: Four dose schedule  Essen Regimen: 0 , 3, 7 and between 14-28 days.  Zagreb Regimen: Two doses on day 0, and one dose on days 7 and 21.  IPC Regimen: 2 site ID on days 0, 3 and 7.  Re-exposure if within 3 months: No need for vaccine.  Re-exposure at any time after three months:  Two dose on days 0 and 3.  4 site ID on day 0  I site ID on days 0 and 3
  • 46.  No suturing or bandage  No contraindication for use of PrEP or PEP including pregnancy, immunocomprised, person taking chloroquine or HCQS.  It should never be given in gluteal region. And if it is given, then this dose should not be counted.  Change in brand and the route of administration are acceptable.
  • 47.  Should a vaccine dose is delayed, resume the schedule from where left. No need to restart.  No need for ARV after a bite by rodent (rat), squirrel, hare and rabbit. Bat rabies is not conclusively proved in India and so exposure to bat also does not warrant PEP.
  • 48.  History of rabies vaccination in dog is not always a guarantee that the biting animal is not rabid. There are several factors for failure of vaccination to dog. So better to give PEP.  PEP should be started immediately after the bite. The observation period of 10 days is valid for dogs and cats only. If biting animal is healthy throughout observation period, PEP can be converted to PrEP by skipping the fourth dose.
  • 50.  In view of the irregular availability and high cost of RIGs, human monoclonal Ab is an alternative to RIGs, in category III bites.  Available in India as Rabishield®. Agent Dose in IU per Kg body weight Concentration IU Per ml hRIG 20 150 eRIG 40 200 RHMAB 3.33 40 and 100
  • 51.
  • 52.  Gardasil® is 9 valent while Cervarix® is bivalent.  Gardasil® is indicated for both male and female.  Cervarix® is indicated for females only.  Cervarix® is not available in USA. Vaccine Age in years Dose Interval Both 9 – 14 2 0 - 6 Gardasil® 15 - 45 3 0 – 2 - 6 Cervarix® 15 - 25 3 0 – 1 - 6
  • 53.  Meningococcal Conjugate Vaccine MCV4 or MenACWY single dose for microbiologists, military recruits, students living in dormitories and travellers to endemic regions for adults less than 55 years.  Revaccination recommended every 5 years  Polysaccharide vaccine is for adults more than 55 years  Vaccination must for travellers to Hajj
  • 54. Age wise schedule of vaccines
  • 55.
  • 57.  OPV  IPV  DTP As pentavalent or hexavalent  HepB  Hib  Rotavirus  PCV 10 (Synflorix®) or PCV 13 (Prevenar®)
  • 58.  Typhoid TCV  (Can be given at nine months to reduce the visit)  Influenza
  • 59.  MMR - 1  Typhoid TCV, if not given at 6 months
  • 60. Hepatitis A Depending upon brand, either single or two doses
  • 61.  MMR - 2  PCV Booster  Chicken Pox – 1 Second dose can be given any time after 3 months
  • 62.  DTP Booster  Hib Booster can be given as Quadravalent  OPV - 5  IPV (If available in the market)
  • 63.  DTP Booster – 2  OPV - 6  MMR - 3
  • 64.  Td or Tdap  HPV  Finish the schedule as per brand.
  • 65.  Adults need vaccines based on their age, health conditions, job, lifestyle, or travel habits.  Vaccines are given according to catch up schedule.  Routine vaccinations are:  Flu vaccine  Pneumococcal Vaccine  Tdap vaccine  Zoster vaccine
  • 66.  Flu shot is given every year.  Tdap and/or Td is given as discussed earlier  Zoster vaccine advised depending on vaccine.  RZV after 50 years and ZVL after 60 years.  MMR, Chicken Pox, HepA, HepB, Hib, HPV. (If not given earlier during childhood)
  • 67.  It is recommended for  All children younger than 2 years old  All adults 65 years or older  People from 2 to 64 years old with certain medical conditions.
  • 68.  cerebrospinal fluid (CSF) leaks  cochlear implants  sickle cell disease or other hemoglobinopathies  congenital or acquired asplenia ‚  congenital or acquired immunodeficiencies ‚  HIV infection ‚  chronic renal failure, ‚nephrotic syndrome ‚  leukemia ‚lymphoma ‚Hodgkin disease ‚generalized malignancy, ‚iatrogenic immunosuppression, ‚solid organ transplant,‚multiple myeloma
  • 69. PPSV23 OR Pneumovax® It is recommended for All adults 65 years or older People from 2 to 64 years old with certain medical conditions.
  • 70.  Chronic heart or lung disease  Diabetes mellitus,  Alcoholism ‚  Chronic liver disease  Adults who smoke cigarettes
  • 71.  PCV13 Prevenar® and PPSV23 Pneumovax® should not be administered simultaneously.  Better immune response if PCV13 is administered first.  PPSV23 after one year of PCV13.  Booster of PPSV23 is given after 5 years, if first dose given before 65 years.  If PPSV 23 is administered first  PCV 13 after8 weeks in children 6-18 years.  PCV 13 after one year in adults 19 years and older.
  • 72.
  • 73.  References:  Weekly Epidemiological Record WER 48(92): 2017; 729-748.  WER, Typhoid Vaccines, March 2018  http://www.who.int/wer  WHO position paper April 2018  IAP ACVIP recommendations December 2018.
  • 74. The brand names and pictures mentioned are for information only. I do not advertise any brand.