SlideShare a Scribd company logo
scientific information management
   Alberto Labarga, Feb 13th 2009
LIMS: Laboratory Information Management System
ELN: Electronic Laboratory Notebook
SDMS: Scientific Data Management System
ideal
Your           system should …
users
manage your
instruments
manage your
store
manage your biological
Samples


Cell lines


Tissues
experiments
manage your
requests   schedule   execute   results   collaborative analysis
Workflows: protein identification
   Gel

                                Liquid
               Spots
                               sample
  Picking

            Digestion and   Digestion and
             deposition     concentation




               MALDI           LC-MS             2LC-MS

                                         .wiff            .wiff



                  Data processing (MASCOT, SEQUEST)
standards
Support
CONTENT: Minimal/Core Information
   -> MIBBI (http://www.mibbi.org)

SEMANTIC: Terminology used, ontologies
   -> OBI (http://obi-ontology.org)

SYNTAX: Data Model, Data Exchange
   ->Fuge (http://fuge.sourceforge.net/)
MIBBI: Standard Content
MIBBI: Standard Content
OBO: Ontologies and
controlled vocabulart
any device
Be accessible from
other software
be accessible from
Your LIMS goes here
external resources
integrate
submission

                                curation

ws   ws   ws         ws   ws




          dataflow              workflow
paper labboks
support your
infrastructure
integrate with your
architecture
a pluggeable
functional genomics platform




                                       web application
 document management system

       Service Provider Interface

LDAP       iggLIMS    BASE      GEMS
protocols


               reports




publications
                  requests




  raw data
visualization
data analysis
further, it should
But going a little bit
life cycle
cover the full                of information
collaboration
support
co-creation
ideation
visualization
documents
mine your
knowledge
Help to generate new
Antileukoproteinase, Secretory leukocyte protease inhibitor, P03973

uniprot:    http://www.uniprot.org/uniprot/P03973
genecards: http://www.genecards.org/cgi-bin/carddisp.pl?id=P03973
dasty:        http://www.ebi.ac.uk/dasty/client/ebi.php?q=P03973




      >sp|P03973|SLPI_HUMAN Antileukoproteinase OS=Homo sapiens GN=SLPI
      MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
      KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG
      MCGKSCVSPVKA
performance
evaluate your
Scientific overviews (institutions, groups)

Citation analysis

Scientific impact and excellence assessment

Measurement of the impact of funding and
programs on scientific production

Identification of scientific experts for
conferences, workshops and peer panels
organizations.
data deluge!
And be prepared for the
Illumina / Solexa
                                        Genetic Analyzer


Applied Biosystems   Roche / 454                            Applied Biosystems
                     Genome Sequencer                       SOLiD
ABI 3730XL




                                        3000 Mb/run
                     100 Mb/run
1 Mb/day
3000x
In 2010
available
scientific
information
will double
every 72 hours
Scientific Data Management

More Related Content

Similar to Scientific Data Management

Data analysis & integration challenges in genomics
Data analysis & integration challenges in genomicsData analysis & integration challenges in genomics
Data analysis & integration challenges in genomics
mikaelhuss
 
The BioAssay Research Database
The BioAssay Research DatabaseThe BioAssay Research Database
The BioAssay Research DatabaseRajarshi Guha
 
Advanced Bioinformatics for Genomics and BioData Driven Research
Advanced Bioinformatics for Genomics and BioData Driven ResearchAdvanced Bioinformatics for Genomics and BioData Driven Research
Advanced Bioinformatics for Genomics and BioData Driven Research
European Bioinformatics Institute
 
DCC Keynote 2007
DCC Keynote 2007DCC Keynote 2007
DCC Keynote 2007
Carole Goble
 
Closing the Gap in Time: From Raw Data to Real Science
Closing the Gap in Time: From Raw Data to Real ScienceClosing the Gap in Time: From Raw Data to Real Science
Closing the Gap in Time: From Raw Data to Real Science
Justin Johnson
 
Towards automated phenotypic cell profiling with high-content imaging
Towards automated phenotypic cell profiling with high-content imagingTowards automated phenotypic cell profiling with high-content imaging
Towards automated phenotypic cell profiling with high-content imaging
Ola Spjuth
 
Towards Automated AI-guided Drug Discovery Labs
Towards Automated AI-guided Drug Discovery LabsTowards Automated AI-guided Drug Discovery Labs
Towards Automated AI-guided Drug Discovery Labs
Ola Spjuth
 
Practical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS projectPractical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS project
US Environmental Protection Agency (EPA), Center for Computational Toxicology and Exposure
 
Azizi biorepository: Challenges and opportunities
Azizi biorepository: Challenges and opportunitiesAzizi biorepository: Challenges and opportunities
Azizi biorepository: Challenges and opportunities
ILRI
 
If we build it will they come?
If we build it will they come?If we build it will they come?
If we build it will they come?
myGrid team
 
Software Pipelines: The Good, The Bad and The Ugly
Software Pipelines: The Good, The Bad and The UglySoftware Pipelines: The Good, The Bad and The Ugly
Software Pipelines: The Good, The Bad and The Ugly
João André Carriço
 
2014 Taverna Tutorial Introduction to eScience and workflows
2014 Taverna Tutorial Introduction to eScience and workflows2014 Taverna Tutorial Introduction to eScience and workflows
2014 Taverna Tutorial Introduction to eScience and workflows
myGrid team
 
FAIR Computational Workflows
FAIR Computational WorkflowsFAIR Computational Workflows
FAIR Computational Workflows
Carole Goble
 
Implementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTSImplementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTS
Valery Tkachenko
 
Being FAIR: FAIR data and model management SSBSS 2017 Summer School
Being FAIR:  FAIR data and model management SSBSS 2017 Summer SchoolBeing FAIR:  FAIR data and model management SSBSS 2017 Summer School
Being FAIR: FAIR data and model management SSBSS 2017 Summer School
Carole Goble
 
ISMB Workshop 2014
ISMB Workshop 2014ISMB Workshop 2014
ISMB Workshop 2014
Alejandra Gonzalez-Beltran
 
Role of bioinformatics in life sciences research
Role of bioinformatics in life sciences researchRole of bioinformatics in life sciences research
Role of bioinformatics in life sciences research
Anshika Bansal
 
Biocatalogue Talk Slides
Biocatalogue Talk SlidesBiocatalogue Talk Slides
Biocatalogue Talk Slides
BioCatalogue
 
ICAR 2015 Workshop - Nick Provart
ICAR 2015 Workshop - Nick ProvartICAR 2015 Workshop - Nick Provart
ICAR 2015 Workshop - Nick Provart
Araport
 

Similar to Scientific Data Management (20)

Data analysis & integration challenges in genomics
Data analysis & integration challenges in genomicsData analysis & integration challenges in genomics
Data analysis & integration challenges in genomics
 
The BioAssay Research Database
The BioAssay Research DatabaseThe BioAssay Research Database
The BioAssay Research Database
 
ISA - a short overview - Dec 2013
ISA - a short overview - Dec 2013ISA - a short overview - Dec 2013
ISA - a short overview - Dec 2013
 
Advanced Bioinformatics for Genomics and BioData Driven Research
Advanced Bioinformatics for Genomics and BioData Driven ResearchAdvanced Bioinformatics for Genomics and BioData Driven Research
Advanced Bioinformatics for Genomics and BioData Driven Research
 
DCC Keynote 2007
DCC Keynote 2007DCC Keynote 2007
DCC Keynote 2007
 
Closing the Gap in Time: From Raw Data to Real Science
Closing the Gap in Time: From Raw Data to Real ScienceClosing the Gap in Time: From Raw Data to Real Science
Closing the Gap in Time: From Raw Data to Real Science
 
Towards automated phenotypic cell profiling with high-content imaging
Towards automated phenotypic cell profiling with high-content imagingTowards automated phenotypic cell profiling with high-content imaging
Towards automated phenotypic cell profiling with high-content imaging
 
Towards Automated AI-guided Drug Discovery Labs
Towards Automated AI-guided Drug Discovery LabsTowards Automated AI-guided Drug Discovery Labs
Towards Automated AI-guided Drug Discovery Labs
 
Practical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS projectPractical semantics in the pharmaceutical industry - the Open PHACTS project
Practical semantics in the pharmaceutical industry - the Open PHACTS project
 
Azizi biorepository: Challenges and opportunities
Azizi biorepository: Challenges and opportunitiesAzizi biorepository: Challenges and opportunities
Azizi biorepository: Challenges and opportunities
 
If we build it will they come?
If we build it will they come?If we build it will they come?
If we build it will they come?
 
Software Pipelines: The Good, The Bad and The Ugly
Software Pipelines: The Good, The Bad and The UglySoftware Pipelines: The Good, The Bad and The Ugly
Software Pipelines: The Good, The Bad and The Ugly
 
2014 Taverna Tutorial Introduction to eScience and workflows
2014 Taverna Tutorial Introduction to eScience and workflows2014 Taverna Tutorial Introduction to eScience and workflows
2014 Taverna Tutorial Introduction to eScience and workflows
 
FAIR Computational Workflows
FAIR Computational WorkflowsFAIR Computational Workflows
FAIR Computational Workflows
 
Implementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTSImplementing chemistry platform for OpenPHACTS
Implementing chemistry platform for OpenPHACTS
 
Being FAIR: FAIR data and model management SSBSS 2017 Summer School
Being FAIR:  FAIR data and model management SSBSS 2017 Summer SchoolBeing FAIR:  FAIR data and model management SSBSS 2017 Summer School
Being FAIR: FAIR data and model management SSBSS 2017 Summer School
 
ISMB Workshop 2014
ISMB Workshop 2014ISMB Workshop 2014
ISMB Workshop 2014
 
Role of bioinformatics in life sciences research
Role of bioinformatics in life sciences researchRole of bioinformatics in life sciences research
Role of bioinformatics in life sciences research
 
Biocatalogue Talk Slides
Biocatalogue Talk SlidesBiocatalogue Talk Slides
Biocatalogue Talk Slides
 
ICAR 2015 Workshop - Nick Provart
ICAR 2015 Workshop - Nick ProvartICAR 2015 Workshop - Nick Provart
ICAR 2015 Workshop - Nick Provart
 

More from Alberto Labarga

El Salto Communities - EditorsLab 2017
El Salto Communities - EditorsLab 2017El Salto Communities - EditorsLab 2017
El Salto Communities - EditorsLab 2017
Alberto Labarga
 
Shokesu - Premio Nobel de Literatura a Bob Dylan
Shokesu - Premio Nobel de Literatura a Bob DylanShokesu - Premio Nobel de Literatura a Bob Dylan
Shokesu - Premio Nobel de Literatura a Bob Dylan
Alberto Labarga
 
Genome visualization challenges
Genome visualization challengesGenome visualization challenges
Genome visualization challenges
Alberto Labarga
 
SocialLearning: descubriendo contenidos educativos de manera colaborativa
SocialLearning: descubriendo contenidos educativos de manera colaborativaSocialLearning: descubriendo contenidos educativos de manera colaborativa
SocialLearning: descubriendo contenidos educativos de manera colaborativa
Alberto Labarga
 
Hacksanfermin 2015 :: Dropcoin Street
Hacksanfermin 2015 :: Dropcoin StreetHacksanfermin 2015 :: Dropcoin Street
Hacksanfermin 2015 :: Dropcoin Street
Alberto Labarga
 
hacksanfermin 2015 :: Parking inteligente
hacksanfermin 2015 :: Parking inteligentehacksanfermin 2015 :: Parking inteligente
hacksanfermin 2015 :: Parking inteligente
Alberto Labarga
 
jpd5 big data
jpd5 big datajpd5 big data
jpd5 big data
Alberto Labarga
 
Vidas Contadas :: Visualizar 2015
Vidas Contadas :: Visualizar 2015Vidas Contadas :: Visualizar 2015
Vidas Contadas :: Visualizar 2015
Alberto Labarga
 
Periodismo de datos y visualización de datos abiertos #siglibre9
Periodismo de datos y visualización de datos abiertos #siglibre9Periodismo de datos y visualización de datos abiertos #siglibre9
Periodismo de datos y visualización de datos abiertos #siglibre9
Alberto Labarga
 
myHealthHackmedicine
myHealthHackmedicinemyHealthHackmedicine
myHealthHackmedicine
Alberto Labarga
 
Big Data y Salud
Big Data y SaludBig Data y Salud
Big Data y Salud
Alberto Labarga
 
Arduino: Control de motores
Arduino: Control de motoresArduino: Control de motores
Arduino: Control de motores
Alberto Labarga
 
Entrada/salida analógica con Arduino
Entrada/salida analógica con ArduinoEntrada/salida analógica con Arduino
Entrada/salida analógica con Arduino
Alberto Labarga
 
Práctica con Arduino: Simon Dice
Práctica con Arduino: Simon DicePráctica con Arduino: Simon Dice
Práctica con Arduino: Simon Dice
Alberto Labarga
 
Entrada/Salida digital con Arduino
Entrada/Salida digital con ArduinoEntrada/Salida digital con Arduino
Entrada/Salida digital con Arduino
Alberto Labarga
 
Presentación Laboratorio de Fabricación Digital UPNA 2014
Presentación Laboratorio de Fabricación Digital UPNA 2014Presentación Laboratorio de Fabricación Digital UPNA 2014
Presentación Laboratorio de Fabricación Digital UPNA 2014
Alberto Labarga
 
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
Alberto Labarga
 
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
Alberto Labarga
 
Introducción a la impresión 3D
Introducción a la impresión 3DIntroducción a la impresión 3D
Introducción a la impresión 3D
Alberto Labarga
 
Vidas Contadas
Vidas ContadasVidas Contadas
Vidas Contadas
Alberto Labarga
 

More from Alberto Labarga (20)

El Salto Communities - EditorsLab 2017
El Salto Communities - EditorsLab 2017El Salto Communities - EditorsLab 2017
El Salto Communities - EditorsLab 2017
 
Shokesu - Premio Nobel de Literatura a Bob Dylan
Shokesu - Premio Nobel de Literatura a Bob DylanShokesu - Premio Nobel de Literatura a Bob Dylan
Shokesu - Premio Nobel de Literatura a Bob Dylan
 
Genome visualization challenges
Genome visualization challengesGenome visualization challenges
Genome visualization challenges
 
SocialLearning: descubriendo contenidos educativos de manera colaborativa
SocialLearning: descubriendo contenidos educativos de manera colaborativaSocialLearning: descubriendo contenidos educativos de manera colaborativa
SocialLearning: descubriendo contenidos educativos de manera colaborativa
 
Hacksanfermin 2015 :: Dropcoin Street
Hacksanfermin 2015 :: Dropcoin StreetHacksanfermin 2015 :: Dropcoin Street
Hacksanfermin 2015 :: Dropcoin Street
 
hacksanfermin 2015 :: Parking inteligente
hacksanfermin 2015 :: Parking inteligentehacksanfermin 2015 :: Parking inteligente
hacksanfermin 2015 :: Parking inteligente
 
jpd5 big data
jpd5 big datajpd5 big data
jpd5 big data
 
Vidas Contadas :: Visualizar 2015
Vidas Contadas :: Visualizar 2015Vidas Contadas :: Visualizar 2015
Vidas Contadas :: Visualizar 2015
 
Periodismo de datos y visualización de datos abiertos #siglibre9
Periodismo de datos y visualización de datos abiertos #siglibre9Periodismo de datos y visualización de datos abiertos #siglibre9
Periodismo de datos y visualización de datos abiertos #siglibre9
 
myHealthHackmedicine
myHealthHackmedicinemyHealthHackmedicine
myHealthHackmedicine
 
Big Data y Salud
Big Data y SaludBig Data y Salud
Big Data y Salud
 
Arduino: Control de motores
Arduino: Control de motoresArduino: Control de motores
Arduino: Control de motores
 
Entrada/salida analógica con Arduino
Entrada/salida analógica con ArduinoEntrada/salida analógica con Arduino
Entrada/salida analógica con Arduino
 
Práctica con Arduino: Simon Dice
Práctica con Arduino: Simon DicePráctica con Arduino: Simon Dice
Práctica con Arduino: Simon Dice
 
Entrada/Salida digital con Arduino
Entrada/Salida digital con ArduinoEntrada/Salida digital con Arduino
Entrada/Salida digital con Arduino
 
Presentación Laboratorio de Fabricación Digital UPNA 2014
Presentación Laboratorio de Fabricación Digital UPNA 2014Presentación Laboratorio de Fabricación Digital UPNA 2014
Presentación Laboratorio de Fabricación Digital UPNA 2014
 
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
Conceptos de electrónica - Laboratorio de Fabricación Digital UPNA 2014
 
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
Introducción a la plataforma Arduino - Laboratorio de Fabricación Digital UPN...
 
Introducción a la impresión 3D
Introducción a la impresión 3DIntroducción a la impresión 3D
Introducción a la impresión 3D
 
Vidas Contadas
Vidas ContadasVidas Contadas
Vidas Contadas
 

Recently uploaded

June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
Levi Shapiro
 
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Dr. Vinod Kumar Kanvaria
 
Synthetic Fiber Construction in lab .pptx
Synthetic Fiber Construction in lab .pptxSynthetic Fiber Construction in lab .pptx
Synthetic Fiber Construction in lab .pptx
Pavel ( NSTU)
 
Introduction to AI for Nonprofits with Tapp Network
Introduction to AI for Nonprofits with Tapp NetworkIntroduction to AI for Nonprofits with Tapp Network
Introduction to AI for Nonprofits with Tapp Network
TechSoup
 
Advantages and Disadvantages of CMS from an SEO Perspective
Advantages and Disadvantages of CMS from an SEO PerspectiveAdvantages and Disadvantages of CMS from an SEO Perspective
Advantages and Disadvantages of CMS from an SEO Perspective
Krisztián Száraz
 
Acetabularia Information For Class 9 .docx
Acetabularia Information For Class 9  .docxAcetabularia Information For Class 9  .docx
Acetabularia Information For Class 9 .docx
vaibhavrinwa19
 
The Challenger.pdf DNHS Official Publication
The Challenger.pdf DNHS Official PublicationThe Challenger.pdf DNHS Official Publication
The Challenger.pdf DNHS Official Publication
Delapenabediema
 
Model Attribute Check Company Auto Property
Model Attribute  Check Company Auto PropertyModel Attribute  Check Company Auto Property
Model Attribute Check Company Auto Property
Celine George
 
A Strategic Approach: GenAI in Education
A Strategic Approach: GenAI in EducationA Strategic Approach: GenAI in Education
A Strategic Approach: GenAI in Education
Peter Windle
 
South African Journal of Science: Writing with integrity workshop (2024)
South African Journal of Science: Writing with integrity workshop (2024)South African Journal of Science: Writing with integrity workshop (2024)
South African Journal of Science: Writing with integrity workshop (2024)
Academy of Science of South Africa
 
Pride Month Slides 2024 David Douglas School District
Pride Month Slides 2024 David Douglas School DistrictPride Month Slides 2024 David Douglas School District
Pride Month Slides 2024 David Douglas School District
David Douglas School District
 
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
MysoreMuleSoftMeetup
 
The approach at University of Liverpool.pptx
The approach at University of Liverpool.pptxThe approach at University of Liverpool.pptx
The approach at University of Liverpool.pptx
Jisc
 
Azure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHatAzure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHat
Scholarhat
 
The basics of sentences session 5pptx.pptx
The basics of sentences session 5pptx.pptxThe basics of sentences session 5pptx.pptx
The basics of sentences session 5pptx.pptx
heathfieldcps1
 
JEE1_This_section_contains_FOUR_ questions
JEE1_This_section_contains_FOUR_ questionsJEE1_This_section_contains_FOUR_ questions
JEE1_This_section_contains_FOUR_ questions
ShivajiThube2
 
TESDA TM1 REVIEWER FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
TESDA TM1 REVIEWER  FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...TESDA TM1 REVIEWER  FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
TESDA TM1 REVIEWER FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
EugeneSaldivar
 
The Diamonds of 2023-2024 in the IGRA collection
The Diamonds of 2023-2024 in the IGRA collectionThe Diamonds of 2023-2024 in the IGRA collection
The Diamonds of 2023-2024 in the IGRA collection
Israel Genealogy Research Association
 
Operation Blue Star - Saka Neela Tara
Operation Blue Star   -  Saka Neela TaraOperation Blue Star   -  Saka Neela Tara
Operation Blue Star - Saka Neela Tara
Balvir Singh
 
Chapter 3 - Islamic Banking Products and Services.pptx
Chapter 3 - Islamic Banking Products and Services.pptxChapter 3 - Islamic Banking Products and Services.pptx
Chapter 3 - Islamic Banking Products and Services.pptx
Mohd Adib Abd Muin, Senior Lecturer at Universiti Utara Malaysia
 

Recently uploaded (20)

June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
June 3, 2024 Anti-Semitism Letter Sent to MIT President Kornbluth and MIT Cor...
 
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
 
Synthetic Fiber Construction in lab .pptx
Synthetic Fiber Construction in lab .pptxSynthetic Fiber Construction in lab .pptx
Synthetic Fiber Construction in lab .pptx
 
Introduction to AI for Nonprofits with Tapp Network
Introduction to AI for Nonprofits with Tapp NetworkIntroduction to AI for Nonprofits with Tapp Network
Introduction to AI for Nonprofits with Tapp Network
 
Advantages and Disadvantages of CMS from an SEO Perspective
Advantages and Disadvantages of CMS from an SEO PerspectiveAdvantages and Disadvantages of CMS from an SEO Perspective
Advantages and Disadvantages of CMS from an SEO Perspective
 
Acetabularia Information For Class 9 .docx
Acetabularia Information For Class 9  .docxAcetabularia Information For Class 9  .docx
Acetabularia Information For Class 9 .docx
 
The Challenger.pdf DNHS Official Publication
The Challenger.pdf DNHS Official PublicationThe Challenger.pdf DNHS Official Publication
The Challenger.pdf DNHS Official Publication
 
Model Attribute Check Company Auto Property
Model Attribute  Check Company Auto PropertyModel Attribute  Check Company Auto Property
Model Attribute Check Company Auto Property
 
A Strategic Approach: GenAI in Education
A Strategic Approach: GenAI in EducationA Strategic Approach: GenAI in Education
A Strategic Approach: GenAI in Education
 
South African Journal of Science: Writing with integrity workshop (2024)
South African Journal of Science: Writing with integrity workshop (2024)South African Journal of Science: Writing with integrity workshop (2024)
South African Journal of Science: Writing with integrity workshop (2024)
 
Pride Month Slides 2024 David Douglas School District
Pride Month Slides 2024 David Douglas School DistrictPride Month Slides 2024 David Douglas School District
Pride Month Slides 2024 David Douglas School District
 
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
Mule 4.6 & Java 17 Upgrade | MuleSoft Mysore Meetup #46
 
The approach at University of Liverpool.pptx
The approach at University of Liverpool.pptxThe approach at University of Liverpool.pptx
The approach at University of Liverpool.pptx
 
Azure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHatAzure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHat
 
The basics of sentences session 5pptx.pptx
The basics of sentences session 5pptx.pptxThe basics of sentences session 5pptx.pptx
The basics of sentences session 5pptx.pptx
 
JEE1_This_section_contains_FOUR_ questions
JEE1_This_section_contains_FOUR_ questionsJEE1_This_section_contains_FOUR_ questions
JEE1_This_section_contains_FOUR_ questions
 
TESDA TM1 REVIEWER FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
TESDA TM1 REVIEWER  FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...TESDA TM1 REVIEWER  FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
TESDA TM1 REVIEWER FOR NATIONAL ASSESSMENT WRITTEN AND ORAL QUESTIONS WITH A...
 
The Diamonds of 2023-2024 in the IGRA collection
The Diamonds of 2023-2024 in the IGRA collectionThe Diamonds of 2023-2024 in the IGRA collection
The Diamonds of 2023-2024 in the IGRA collection
 
Operation Blue Star - Saka Neela Tara
Operation Blue Star   -  Saka Neela TaraOperation Blue Star   -  Saka Neela Tara
Operation Blue Star - Saka Neela Tara
 
Chapter 3 - Islamic Banking Products and Services.pptx
Chapter 3 - Islamic Banking Products and Services.pptxChapter 3 - Islamic Banking Products and Services.pptx
Chapter 3 - Islamic Banking Products and Services.pptx
 

Scientific Data Management