SlideShare a Scribd company logo
1 of 23
The Creation of the
Elements and the
Relationship to
Cosmic Events in the
Universe
The Big Bang
 The Big Bang Theory is the accepted scientific
theory about the origin of the universe based
upon multiple lines of evidence.
 The “Big Bang” was a phenomenally energetic
explosion that initiated the expansion of the
universe.
 All matter and energy were compressed at a
single point (singularity) at the time of the
explosion
 We do not know what was before…..?
 The age of the universe is calculated at 13.7
billion years (based on multiple methods of age
dating based on empirical data).
The Big Bang vs. the
Steady State Model
 The Big Bang (1931) was first proposed by an Belgian
cosmologist and priest named George LeMaitre based on
theoretical calculations and astronomical measurements
of distant galaxies (by Edwin Hubble) that demonstrated
that the universe is expanding.
 The competing theory was the Steady State Model (1948)
which said that on the large scale the universe has always
looked the same and that there was no beginning and is
no end. To account for the observed expansion of the
universe, it required that matter to be continuously created
to fill gaps that would be created
by an expanding universe.
Scientific Evidence for the
Big Bang Theory
 The Red Shift of Distant Galaxies
(Hubble, 1927)
 The Cosmic Elemental Abundances of
Hydrogen and Helium and Big Bang
Nucleosynthesis
(Alpher and Gamow, 1948)
 The Cosmic Microwave Background (CMB)
Radiation
(Penzias and Wilson, 1964)
Red Shift is Evident in
Emission Spectra of Light
from Stars and Galaxies
Hubble’s Law and Red Shift
 Everything in the universe is moving away from
everything else (Raisin bread analogy).
 We are not at the center of the universe.
 Edwin Hubble discovered that distant galaxies
are moving away from us at rates faster than
closer galaxies are moving away from us.
Cosmic Elemental
Abuandances
 Hydrogen (74%) and Helium (24%) are
the most abundant elements in the
universe.
 Stellar nucleosynthesis alone cannot
account for the large amount of Helium.
(can only account for about 2%)
 Big Bang nucleosynthesis calculations
accurately predict the present cosmic
abundances of hydrogen and helium.
Big Bang Nucleosynthesis
 All Hydrogen and most Helium in the universe was
produced during the Big Bang Event, starting ~100
seconds after the explosion. A small amount of Lithium
was also produced.
 Big Bang nucleosynthesis ceased within a few minutes
because the universe had expanded sufficiently by
then such that the temperatures and pressures were
too low to support additional fusion reactions.
Cosmic Microwave
Background Radiation
 There is a background signal of microwave radiation emitted
by the universe. It comes from the light energy given off
during the “Big Bang” explosion.
 It can be detected no matter which direction you point an
antennae in the sky, at any time, day or night.
 It was discovered by accident by two astronomers (Penzias
and Wilson) working at Bell Labs in New Jersey in 1964.
Penzias and Wilson won
the Nobel Prize in Physics
in 1978 for their discovery.
Cosmic Microwave
Background Radiation
 Due to the cosmic background microwave radiation, the
remnant radiation left over from the Big Bang, the universe
has an ambient temperature of 3K.
 The CMB radiation is remarkably uniform in its distribution.
It has been mapped by the COBE (Cosmic Background
Explorer) satellite.
Stellar Nucleosynthesis
 Stars create elements by combining lighter nuclei into heavier
nuclei via nuclear fusion reactions in their cores.
 Enormous temperatures (15,000,000 K), pressures, and densities
of matter are needed to initiate fusion (thermonuclear) reactions.
 The basic nuclear reaction in the Sun converts hydrogen to helium
and releases energy in the form of electromagnetic radiation. This
is why stars shine!
Stellar Nucleosynthesis
 Larger stars can fuse heavier elements.
Supernova Nucleosynthesis
 Elements heavier than Iron are made primarly
when giant stars explode in supernova events.
A summary…
(you are made of stardust)
The Life Cycles of Stars
Nebulae
 Nebulae are regions
of gas and dust in
interstellar space
within galaxies.
 Nebulae contain gas
and dust from
previously exploded
stars.
 Nebulae are the
birthplaces of new
stars. (recycling!)
 When stars form,
planets may form
too (a solar system)
Nebulae (continued)
The image,
roughly 3
light-years
across, was
taken May 29-
30, 1999, with
the Wide Field
Planetary
Camera 2. The
colors in the
image
represent
various gases.
Red
represents
sulfur; green,
hydrogen; and
blue, oxygen.
Main Sequence Stars
The Hertzsprung-Russell (H-R) Diagram shows that there is some
relationship between the temperature and luminosity (brightness) of a
star. The clustering indicates something about how stars change over
time. Young-middle age stars always plot on the main sequence.
Main Sequence Stars
Main sequence stars
fuse hydrogen to
helium.
Red Giants and White Dwarfs
V838 Monocerotis – Red Giant
NGC 6369 – Planetary
Nebula with White Dwarf
Supernovae
The Crab Nebula – Supernova Remnant
Observed 1000 years ago.
The Veil Nebula – 5000 to
10000 years old; in our
galaxy
Neutron Stars and Black
Holes

More Related Content

Similar to The_Creation_of_the_Elements_Powerpoint.ppt

HOW RELATIONSHIPS MADE THE UNIVERE & HUMANS
HOW RELATIONSHIPS MADE THE UNIVERE & HUMANSHOW RELATIONSHIPS MADE THE UNIVERE & HUMANS
HOW RELATIONSHIPS MADE THE UNIVERE & HUMANSPaul H. Carr
 
Big Bang Theory & Other Recent Sciences || 2014 - Dr. Mahbub Khan
Big Bang Theory & Other Recent Sciences || 2014 -  Dr. Mahbub KhanBig Bang Theory & Other Recent Sciences || 2014 -  Dr. Mahbub Khan
Big Bang Theory & Other Recent Sciences || 2014 - Dr. Mahbub Khaniqra tube
 
The Big Bang project (astronomy) (3)
The Big Bang project (astronomy) (3)The Big Bang project (astronomy) (3)
The Big Bang project (astronomy) (3)AshJam123
 
The big bang project
The big bang projectThe big bang project
The big bang projectAshJam123
 
Big bang theory2
Big bang theory2Big bang theory2
Big bang theory2davideis
 
the origin of the universe for teenagers.pptx
the origin of the universe for teenagers.pptxthe origin of the universe for teenagers.pptx
the origin of the universe for teenagers.pptxAriannaMoreno10
 
Introduction to big bang
Introduction to big bangIntroduction to big bang
Introduction to big bangSabiq Hafidz
 
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater Questions
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater QuestionsNEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater Questions
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater QuestionsPaul H. Carr
 
Uti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsUti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsHIDEUMI SEKIGUCHI
 
Uti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsUti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsHideumi Sekiguchi
 
Chapter 19 – formation of the universe
Chapter 19 – formation of the universeChapter 19 – formation of the universe
Chapter 19 – formation of the universeAnnie cox
 
The Creative Cooperative Cosmos: Big History, From Hydrogen to Humans
The Creative Cooperative Cosmos: Big History, From Hydrogen to HumansThe Creative Cooperative Cosmos: Big History, From Hydrogen to Humans
The Creative Cooperative Cosmos: Big History, From Hydrogen to HumansPaul H. Carr
 
Evolution of universe - Geochemistry & Thermodynamics
Evolution of universe - Geochemistry & ThermodynamicsEvolution of universe - Geochemistry & Thermodynamics
Evolution of universe - Geochemistry & ThermodynamicsPramoda Raj
 
Bigbang Nucleosynthesis and evidences of big bang theory.pptx
Bigbang Nucleosynthesis and evidences of big bang theory.pptxBigbang Nucleosynthesis and evidences of big bang theory.pptx
Bigbang Nucleosynthesis and evidences of big bang theory.pptxangelicagagbo26
 
Best big bang presentation
Best big bang presentationBest big bang presentation
Best big bang presentationrida rehman
 
The future of the universe and humanity
The future of the universe and humanityThe future of the universe and humanity
The future of the universe and humanityFernando Alcoforado
 

Similar to The_Creation_of_the_Elements_Powerpoint.ppt (20)

HOW RELATIONSHIPS MADE THE UNIVERE & HUMANS
HOW RELATIONSHIPS MADE THE UNIVERE & HUMANSHOW RELATIONSHIPS MADE THE UNIVERE & HUMANS
HOW RELATIONSHIPS MADE THE UNIVERE & HUMANS
 
Big Bang Theory & Other Recent Sciences || 2014 - Dr. Mahbub Khan
Big Bang Theory & Other Recent Sciences || 2014 -  Dr. Mahbub KhanBig Bang Theory & Other Recent Sciences || 2014 -  Dr. Mahbub Khan
Big Bang Theory & Other Recent Sciences || 2014 - Dr. Mahbub Khan
 
The Big Bang project (astronomy) (3)
The Big Bang project (astronomy) (3)The Big Bang project (astronomy) (3)
The Big Bang project (astronomy) (3)
 
The big bang project
The big bang projectThe big bang project
The big bang project
 
Big bang theory2
Big bang theory2Big bang theory2
Big bang theory2
 
the origin of the universe for teenagers.pptx
the origin of the universe for teenagers.pptxthe origin of the universe for teenagers.pptx
the origin of the universe for teenagers.pptx
 
Introduction to big bang
Introduction to big bangIntroduction to big bang
Introduction to big bang
 
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater Questions
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater QuestionsNEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater Questions
NEW HOT-to-COOL COSMOLOGY: Amazing Progress Yet Greater Questions
 
Uti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsUti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physics
 
Uti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physicsUti index-papers-e-chapter6-todays-godless-physics
Uti index-papers-e-chapter6-todays-godless-physics
 
The big band theory
The big band theoryThe big band theory
The big band theory
 
THE UNIVERSE
THE UNIVERSETHE UNIVERSE
THE UNIVERSE
 
Chapter 19 – formation of the universe
Chapter 19 – formation of the universeChapter 19 – formation of the universe
Chapter 19 – formation of the universe
 
The Creative Cooperative Cosmos: Big History, From Hydrogen to Humans
The Creative Cooperative Cosmos: Big History, From Hydrogen to HumansThe Creative Cooperative Cosmos: Big History, From Hydrogen to Humans
The Creative Cooperative Cosmos: Big History, From Hydrogen to Humans
 
Evolution of universe - Geochemistry & Thermodynamics
Evolution of universe - Geochemistry & ThermodynamicsEvolution of universe - Geochemistry & Thermodynamics
Evolution of universe - Geochemistry & Thermodynamics
 
Bigbang Nucleosynthesis and evidences of big bang theory.pptx
Bigbang Nucleosynthesis and evidences of big bang theory.pptxBigbang Nucleosynthesis and evidences of big bang theory.pptx
Bigbang Nucleosynthesis and evidences of big bang theory.pptx
 
D3
D3D3
D3
 
D3
D3D3
D3
 
Best big bang presentation
Best big bang presentationBest big bang presentation
Best big bang presentation
 
The future of the universe and humanity
The future of the universe and humanityThe future of the universe and humanity
The future of the universe and humanity
 

More from carlmanaay

Facism-Anarchism-by-Group-2-PolGov (1).pptx
Facism-Anarchism-by-Group-2-PolGov (1).pptxFacism-Anarchism-by-Group-2-PolGov (1).pptx
Facism-Anarchism-by-Group-2-PolGov (1).pptxcarlmanaay
 
light lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrelight lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrecarlmanaay
 
self defense in karatejsbdbbdsbdbdbdbbfb
self defense in karatejsbdbbdsbdbdbdbbfbself defense in karatejsbdbbdsbdbdbdbbfb
self defense in karatejsbdbbdsbdbdbdbbfbcarlmanaay
 
cell & dna.pptx
cell & dna.pptxcell & dna.pptx
cell & dna.pptxcarlmanaay
 
rate of rxns.pptx
rate of rxns.pptxrate of rxns.pptx
rate of rxns.pptxcarlmanaay
 
s15-miller-chap-8a-lecture.ppt
s15-miller-chap-8a-lecture.ppts15-miller-chap-8a-lecture.ppt
s15-miller-chap-8a-lecture.pptcarlmanaay
 
Heavier elements.ppt
Heavier elements.pptHeavier elements.ppt
Heavier elements.pptcarlmanaay
 
Ch 9 Lipid2.ppt
Ch 9 Lipid2.pptCh 9 Lipid2.ppt
Ch 9 Lipid2.pptcarlmanaay
 
proteins2.pptx
proteins2.pptxproteins2.pptx
proteins2.pptxcarlmanaay
 
STREETFOODS.pptx
STREETFOODS.pptxSTREETFOODS.pptx
STREETFOODS.pptxcarlmanaay
 
molecular geometry.ppt
molecular geometry.pptmolecular geometry.ppt
molecular geometry.pptcarlmanaay
 
judiciary.pptx
judiciary.pptxjudiciary.pptx
judiciary.pptxcarlmanaay
 
mitigation.pptx
mitigation.pptxmitigation.pptx
mitigation.pptxcarlmanaay
 
vulnerability in disaster.pptx
vulnerability in disaster.pptxvulnerability in disaster.pptx
vulnerability in disaster.pptxcarlmanaay
 
Earthquakes (10).ppt
Earthquakes (10).pptEarthquakes (10).ppt
Earthquakes (10).pptcarlmanaay
 

More from carlmanaay (20)

Facism-Anarchism-by-Group-2-PolGov (1).pptx
Facism-Anarchism-by-Group-2-PolGov (1).pptxFacism-Anarchism-by-Group-2-PolGov (1).pptx
Facism-Anarchism-by-Group-2-PolGov (1).pptx
 
light lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrrelight lesson sfdgdfhhghggdwqeseqwwrewrre
light lesson sfdgdfhhghggdwqeseqwwrewrre
 
self defense in karatejsbdbbdsbdbdbdbbfb
self defense in karatejsbdbbdsbdbdbdbbfbself defense in karatejsbdbbdsbdbdbdbbfb
self defense in karatejsbdbbdsbdbdbdbbfb
 
cell & dna.pptx
cell & dna.pptxcell & dna.pptx
cell & dna.pptx
 
rate of rxns.pptx
rate of rxns.pptxrate of rxns.pptx
rate of rxns.pptx
 
s15-miller-chap-8a-lecture.ppt
s15-miller-chap-8a-lecture.ppts15-miller-chap-8a-lecture.ppt
s15-miller-chap-8a-lecture.ppt
 
Heavier elements.ppt
Heavier elements.pptHeavier elements.ppt
Heavier elements.ppt
 
Ch 9 Lipid2.ppt
Ch 9 Lipid2.pptCh 9 Lipid2.ppt
Ch 9 Lipid2.ppt
 
proteins2.pptx
proteins2.pptxproteins2.pptx
proteins2.pptx
 
STREETFOODS.pptx
STREETFOODS.pptxSTREETFOODS.pptx
STREETFOODS.pptx
 
molecular geometry.ppt
molecular geometry.pptmolecular geometry.ppt
molecular geometry.ppt
 
Cha2.pptx
Cha2.pptxCha2.pptx
Cha2.pptx
 
firemeup.pptx
firemeup.pptxfiremeup.pptx
firemeup.pptx
 
RV.pptx
RV.pptxRV.pptx
RV.pptx
 
chap01.ppt
chap01.pptchap01.ppt
chap01.ppt
 
judiciary.pptx
judiciary.pptxjudiciary.pptx
judiciary.pptx
 
EPPG.pptx
EPPG.pptxEPPG.pptx
EPPG.pptx
 
mitigation.pptx
mitigation.pptxmitigation.pptx
mitigation.pptx
 
vulnerability in disaster.pptx
vulnerability in disaster.pptxvulnerability in disaster.pptx
vulnerability in disaster.pptx
 
Earthquakes (10).ppt
Earthquakes (10).pptEarthquakes (10).ppt
Earthquakes (10).ppt
 

Recently uploaded

Heredity: Inheritance and Variation of Traits
Heredity: Inheritance and Variation of TraitsHeredity: Inheritance and Variation of Traits
Heredity: Inheritance and Variation of TraitsCharlene Llagas
 
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfAnalytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfSwapnil Therkar
 
Scheme-of-Work-Science-Stage-4 cambridge science.docx
Scheme-of-Work-Science-Stage-4 cambridge science.docxScheme-of-Work-Science-Stage-4 cambridge science.docx
Scheme-of-Work-Science-Stage-4 cambridge science.docxyaramohamed343013
 
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptx
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptxLIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptx
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptxmalonesandreagweneth
 
Module 4: Mendelian Genetics and Punnett Square
Module 4:  Mendelian Genetics and Punnett SquareModule 4:  Mendelian Genetics and Punnett Square
Module 4: Mendelian Genetics and Punnett SquareIsiahStephanRadaza
 
Grafana in space: Monitoring Japan's SLIM moon lander in real time
Grafana in space: Monitoring Japan's SLIM moon lander  in real timeGrafana in space: Monitoring Japan's SLIM moon lander  in real time
Grafana in space: Monitoring Japan's SLIM moon lander in real timeSatoshi NAKAHIRA
 
Forest laws, Indian forest laws, why they are important
Forest laws, Indian forest laws, why they are importantForest laws, Indian forest laws, why they are important
Forest laws, Indian forest laws, why they are importantadityabhardwaj282
 
Is RISC-V ready for HPC workload? Maybe?
Is RISC-V ready for HPC workload? Maybe?Is RISC-V ready for HPC workload? Maybe?
Is RISC-V ready for HPC workload? Maybe?Patrick Diehl
 
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.aasikanpl
 
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.aasikanpl
 
zoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzohaibmir069
 
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxAnalytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxSwapnil Therkar
 
Temporomandibular joint Muscles of Mastication
Temporomandibular joint Muscles of MasticationTemporomandibular joint Muscles of Mastication
Temporomandibular joint Muscles of Masticationvidulajaib
 
Manassas R - Parkside Middle School 🌎🏫
Manassas R - Parkside Middle School 🌎🏫Manassas R - Parkside Middle School 🌎🏫
Manassas R - Parkside Middle School 🌎🏫qfactory1
 
Behavioral Disorder: Schizophrenia & it's Case Study.pdf
Behavioral Disorder: Schizophrenia & it's Case Study.pdfBehavioral Disorder: Schizophrenia & it's Case Study.pdf
Behavioral Disorder: Schizophrenia & it's Case Study.pdfSELF-EXPLANATORY
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.PraveenaKalaiselvan1
 
Neurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trNeurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trssuser06f238
 
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxMicrophone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxpriyankatabhane
 
Gas_Laws_powerpoint_notes.ppt for grade 10
Gas_Laws_powerpoint_notes.ppt for grade 10Gas_Laws_powerpoint_notes.ppt for grade 10
Gas_Laws_powerpoint_notes.ppt for grade 10ROLANARIBATO3
 
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRCall Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRlizamodels9
 

Recently uploaded (20)

Heredity: Inheritance and Variation of Traits
Heredity: Inheritance and Variation of TraitsHeredity: Inheritance and Variation of Traits
Heredity: Inheritance and Variation of Traits
 
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdfAnalytical Profile of Coleus Forskohlii | Forskolin .pdf
Analytical Profile of Coleus Forskohlii | Forskolin .pdf
 
Scheme-of-Work-Science-Stage-4 cambridge science.docx
Scheme-of-Work-Science-Stage-4 cambridge science.docxScheme-of-Work-Science-Stage-4 cambridge science.docx
Scheme-of-Work-Science-Stage-4 cambridge science.docx
 
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptx
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptxLIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptx
LIGHT-PHENOMENA-BY-CABUALDIONALDOPANOGANCADIENTE-CONDEZA (1).pptx
 
Module 4: Mendelian Genetics and Punnett Square
Module 4:  Mendelian Genetics and Punnett SquareModule 4:  Mendelian Genetics and Punnett Square
Module 4: Mendelian Genetics and Punnett Square
 
Grafana in space: Monitoring Japan's SLIM moon lander in real time
Grafana in space: Monitoring Japan's SLIM moon lander  in real timeGrafana in space: Monitoring Japan's SLIM moon lander  in real time
Grafana in space: Monitoring Japan's SLIM moon lander in real time
 
Forest laws, Indian forest laws, why they are important
Forest laws, Indian forest laws, why they are importantForest laws, Indian forest laws, why they are important
Forest laws, Indian forest laws, why they are important
 
Is RISC-V ready for HPC workload? Maybe?
Is RISC-V ready for HPC workload? Maybe?Is RISC-V ready for HPC workload? Maybe?
Is RISC-V ready for HPC workload? Maybe?
 
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Aiims Metro Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
 
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
Call Girls in Hauz Khas Delhi 💯Call Us 🔝9953322196🔝 💯Escort.
 
zoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistanzoogeography of pakistan.pptx fauna of Pakistan
zoogeography of pakistan.pptx fauna of Pakistan
 
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptxAnalytical Profile of Coleus Forskohlii | Forskolin .pptx
Analytical Profile of Coleus Forskohlii | Forskolin .pptx
 
Temporomandibular joint Muscles of Mastication
Temporomandibular joint Muscles of MasticationTemporomandibular joint Muscles of Mastication
Temporomandibular joint Muscles of Mastication
 
Manassas R - Parkside Middle School 🌎🏫
Manassas R - Parkside Middle School 🌎🏫Manassas R - Parkside Middle School 🌎🏫
Manassas R - Parkside Middle School 🌎🏫
 
Behavioral Disorder: Schizophrenia & it's Case Study.pdf
Behavioral Disorder: Schizophrenia & it's Case Study.pdfBehavioral Disorder: Schizophrenia & it's Case Study.pdf
Behavioral Disorder: Schizophrenia & it's Case Study.pdf
 
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
BIOETHICS IN RECOMBINANT DNA TECHNOLOGY.
 
Neurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 trNeurodevelopmental disorders according to the dsm 5 tr
Neurodevelopmental disorders according to the dsm 5 tr
 
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptxMicrophone- characteristics,carbon microphone, dynamic microphone.pptx
Microphone- characteristics,carbon microphone, dynamic microphone.pptx
 
Gas_Laws_powerpoint_notes.ppt for grade 10
Gas_Laws_powerpoint_notes.ppt for grade 10Gas_Laws_powerpoint_notes.ppt for grade 10
Gas_Laws_powerpoint_notes.ppt for grade 10
 
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCRCall Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
Call Girls In Nihal Vihar Delhi ❤️8860477959 Looking Escorts In 24/7 Delhi NCR
 

The_Creation_of_the_Elements_Powerpoint.ppt

  • 1. The Creation of the Elements and the Relationship to Cosmic Events in the Universe
  • 2. The Big Bang  The Big Bang Theory is the accepted scientific theory about the origin of the universe based upon multiple lines of evidence.  The “Big Bang” was a phenomenally energetic explosion that initiated the expansion of the universe.  All matter and energy were compressed at a single point (singularity) at the time of the explosion  We do not know what was before…..?  The age of the universe is calculated at 13.7 billion years (based on multiple methods of age dating based on empirical data).
  • 3. The Big Bang vs. the Steady State Model  The Big Bang (1931) was first proposed by an Belgian cosmologist and priest named George LeMaitre based on theoretical calculations and astronomical measurements of distant galaxies (by Edwin Hubble) that demonstrated that the universe is expanding.  The competing theory was the Steady State Model (1948) which said that on the large scale the universe has always looked the same and that there was no beginning and is no end. To account for the observed expansion of the universe, it required that matter to be continuously created to fill gaps that would be created by an expanding universe.
  • 4. Scientific Evidence for the Big Bang Theory  The Red Shift of Distant Galaxies (Hubble, 1927)  The Cosmic Elemental Abundances of Hydrogen and Helium and Big Bang Nucleosynthesis (Alpher and Gamow, 1948)  The Cosmic Microwave Background (CMB) Radiation (Penzias and Wilson, 1964)
  • 5. Red Shift is Evident in Emission Spectra of Light from Stars and Galaxies
  • 6. Hubble’s Law and Red Shift  Everything in the universe is moving away from everything else (Raisin bread analogy).  We are not at the center of the universe.  Edwin Hubble discovered that distant galaxies are moving away from us at rates faster than closer galaxies are moving away from us.
  • 7. Cosmic Elemental Abuandances  Hydrogen (74%) and Helium (24%) are the most abundant elements in the universe.  Stellar nucleosynthesis alone cannot account for the large amount of Helium. (can only account for about 2%)  Big Bang nucleosynthesis calculations accurately predict the present cosmic abundances of hydrogen and helium.
  • 8. Big Bang Nucleosynthesis  All Hydrogen and most Helium in the universe was produced during the Big Bang Event, starting ~100 seconds after the explosion. A small amount of Lithium was also produced.  Big Bang nucleosynthesis ceased within a few minutes because the universe had expanded sufficiently by then such that the temperatures and pressures were too low to support additional fusion reactions.
  • 9.
  • 10. Cosmic Microwave Background Radiation  There is a background signal of microwave radiation emitted by the universe. It comes from the light energy given off during the “Big Bang” explosion.  It can be detected no matter which direction you point an antennae in the sky, at any time, day or night.  It was discovered by accident by two astronomers (Penzias and Wilson) working at Bell Labs in New Jersey in 1964. Penzias and Wilson won the Nobel Prize in Physics in 1978 for their discovery.
  • 11. Cosmic Microwave Background Radiation  Due to the cosmic background microwave radiation, the remnant radiation left over from the Big Bang, the universe has an ambient temperature of 3K.  The CMB radiation is remarkably uniform in its distribution. It has been mapped by the COBE (Cosmic Background Explorer) satellite.
  • 12. Stellar Nucleosynthesis  Stars create elements by combining lighter nuclei into heavier nuclei via nuclear fusion reactions in their cores.  Enormous temperatures (15,000,000 K), pressures, and densities of matter are needed to initiate fusion (thermonuclear) reactions.  The basic nuclear reaction in the Sun converts hydrogen to helium and releases energy in the form of electromagnetic radiation. This is why stars shine!
  • 13. Stellar Nucleosynthesis  Larger stars can fuse heavier elements.
  • 14. Supernova Nucleosynthesis  Elements heavier than Iron are made primarly when giant stars explode in supernova events.
  • 15. A summary… (you are made of stardust)
  • 16. The Life Cycles of Stars
  • 17. Nebulae  Nebulae are regions of gas and dust in interstellar space within galaxies.  Nebulae contain gas and dust from previously exploded stars.  Nebulae are the birthplaces of new stars. (recycling!)  When stars form, planets may form too (a solar system)
  • 18. Nebulae (continued) The image, roughly 3 light-years across, was taken May 29- 30, 1999, with the Wide Field Planetary Camera 2. The colors in the image represent various gases. Red represents sulfur; green, hydrogen; and blue, oxygen.
  • 19. Main Sequence Stars The Hertzsprung-Russell (H-R) Diagram shows that there is some relationship between the temperature and luminosity (brightness) of a star. The clustering indicates something about how stars change over time. Young-middle age stars always plot on the main sequence.
  • 20. Main Sequence Stars Main sequence stars fuse hydrogen to helium.
  • 21. Red Giants and White Dwarfs V838 Monocerotis – Red Giant NGC 6369 – Planetary Nebula with White Dwarf
  • 22. Supernovae The Crab Nebula – Supernova Remnant Observed 1000 years ago. The Veil Nebula – 5000 to 10000 years old; in our galaxy
  • 23. Neutron Stars and Black Holes