Submit Search
Upload
insulina.fasta.docx
•
Download as DOCX, PDF
•
0 likes
•
6 views
M
MANUELCHEPE
Follow
insulina en programa fasta
Read less
Read more
Health & Medicine
Report
Share
Report
Share
1 of 1
Download now
Recommended
ENFERMEDADES LIGADAS AL SEXO
ENFERMEDADES LIGADAS AL SEXO. II ESPECIALIDAD DE BIOLOGIA MOLECULAR Y GENETIC...
ENFERMEDADES LIGADAS AL SEXO. II ESPECIALIDAD DE BIOLOGIA MOLECULAR Y GENETIC...
MANUELCHEPE
Tuberculosis-diapositivas
EXPO BIOQUIMICA - TBC.pptx
EXPO BIOQUIMICA - TBC.pptx
MANUELCHEPE
VIRUS DE PAPILOMA HUMANO
EXPOSCION VPH-MARCADORES I.pdf
EXPOSCION VPH-MARCADORES I.pdf
MANUELCHEPE
https://www.hubspot.com/state-of-marketing · Scaling relationships and proving ROI · Social media is the place for search, sales, and service · Authentic influencer partnerships fuel brand growth · The strongest connections happen via call, click, chat, and camera. · Time saved with AI leads to more creative work · Seeking: A single source of truth · TLDR; Get on social, try AI, and align your systems. · More human marketing, powered by robots
2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot
Marius Sescu
ChatGPT is a revolutionary addition to the world since its introduction in 2022. A big shift in the sector of information gathering and processing happened because of this chatbot. What is the story of ChatGPT? How is the bot responding to prompts and generating contents? Swipe through these slides prepared by Expeed Software, a web development company regarding the development and technical intricacies of ChatGPT!
Everything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPT
Expeed Software
The realm of product design is a constantly changing environment where technology and style intersect. Every year introduces fresh challenges and exciting trends that mold the future of this captivating art form. In this piece, we delve into the significant trends set to influence the look and functionality of product design in the year 2024.
Product Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage Engineerings
Pixeldarts
Mental health has been in the news quite a bit lately. Dozens of U.S. states are currently suing Meta for contributing to the youth mental health crisis by inserting addictive features into their products, while the U.S. Surgeon General is touring the nation to bring awareness to the growing epidemic of loneliness and isolation. The country has endured periods of low national morale, such as in the 1970s when high inflation and the energy crisis worsened public sentiment following the Vietnam War. The current mood, however, feels different. Gallup recently reported that national mental health is at an all-time low, with few bright spots to lift spirits. To better understand how Americans are feeling and their attitudes towards mental health in general, ThinkNow conducted a nationally representative quantitative survey of 1,500 respondents and found some interesting differences among ethnic, age and gender groups. Technology For example, 52% agree that technology and social media have a negative impact on mental health, but when broken out by race, 61% of Whites felt technology had a negative effect, and only 48% of Hispanics thought it did. While technology has helped us keep in touch with friends and family in faraway places, it appears to have degraded our ability to connect in person. Staying connected online is a double-edged sword since the same news feed that brings us pictures of the grandkids and fluffy kittens also feeds us news about the wars in Israel and Ukraine, the dysfunction in Washington, the latest mass shooting and the climate crisis. Hispanics may have a built-in defense against the isolation technology breeds, owing to their large, multigenerational households, strong social support systems, and tendency to use social media to stay connected with relatives abroad. Age and Gender When asked how individuals rate their mental health, men rate it higher than women by 11 percentage points, and Baby Boomers rank it highest at 83%, saying it’s good or excellent vs. 57% of Gen Z saying the same. Gen Z spends the most amount of time on social media, so the notion that social media negatively affects mental health appears to be correlated. Unfortunately, Gen Z is also the generation that’s least comfortable discussing mental health concerns with healthcare professionals. Only 40% of them state they’re comfortable discussing their issues with a professional compared to 60% of Millennials and 65% of Boomers. Race Affects Attitudes As seen in previous research conducted by ThinkNow, Asian Americans lag other groups when it comes to awareness of mental health issues. Twenty-four percent of Asian Americans believe that having a mental health issue is a sign of weakness compared to the 16% average for all groups. Asians are also considerably less likely to be aware of mental health services in their communities (42% vs. 55%) and most likely to seek out information on social media (51% vs. 35%).
How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental Health
ThinkNow
This article is all about what AI trends will emerge in the field of creative operations in 2024. All the marketers and brand builders should be aware of these trends for their further use and save themselves some time!
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
marketingartwork
Recommended
ENFERMEDADES LIGADAS AL SEXO
ENFERMEDADES LIGADAS AL SEXO. II ESPECIALIDAD DE BIOLOGIA MOLECULAR Y GENETIC...
ENFERMEDADES LIGADAS AL SEXO. II ESPECIALIDAD DE BIOLOGIA MOLECULAR Y GENETIC...
MANUELCHEPE
Tuberculosis-diapositivas
EXPO BIOQUIMICA - TBC.pptx
EXPO BIOQUIMICA - TBC.pptx
MANUELCHEPE
VIRUS DE PAPILOMA HUMANO
EXPOSCION VPH-MARCADORES I.pdf
EXPOSCION VPH-MARCADORES I.pdf
MANUELCHEPE
https://www.hubspot.com/state-of-marketing · Scaling relationships and proving ROI · Social media is the place for search, sales, and service · Authentic influencer partnerships fuel brand growth · The strongest connections happen via call, click, chat, and camera. · Time saved with AI leads to more creative work · Seeking: A single source of truth · TLDR; Get on social, try AI, and align your systems. · More human marketing, powered by robots
2024 State of Marketing Report – by Hubspot
2024 State of Marketing Report – by Hubspot
Marius Sescu
ChatGPT is a revolutionary addition to the world since its introduction in 2022. A big shift in the sector of information gathering and processing happened because of this chatbot. What is the story of ChatGPT? How is the bot responding to prompts and generating contents? Swipe through these slides prepared by Expeed Software, a web development company regarding the development and technical intricacies of ChatGPT!
Everything You Need To Know About ChatGPT
Everything You Need To Know About ChatGPT
Expeed Software
The realm of product design is a constantly changing environment where technology and style intersect. Every year introduces fresh challenges and exciting trends that mold the future of this captivating art form. In this piece, we delve into the significant trends set to influence the look and functionality of product design in the year 2024.
Product Design Trends in 2024 | Teenage Engineerings
Product Design Trends in 2024 | Teenage Engineerings
Pixeldarts
Mental health has been in the news quite a bit lately. Dozens of U.S. states are currently suing Meta for contributing to the youth mental health crisis by inserting addictive features into their products, while the U.S. Surgeon General is touring the nation to bring awareness to the growing epidemic of loneliness and isolation. The country has endured periods of low national morale, such as in the 1970s when high inflation and the energy crisis worsened public sentiment following the Vietnam War. The current mood, however, feels different. Gallup recently reported that national mental health is at an all-time low, with few bright spots to lift spirits. To better understand how Americans are feeling and their attitudes towards mental health in general, ThinkNow conducted a nationally representative quantitative survey of 1,500 respondents and found some interesting differences among ethnic, age and gender groups. Technology For example, 52% agree that technology and social media have a negative impact on mental health, but when broken out by race, 61% of Whites felt technology had a negative effect, and only 48% of Hispanics thought it did. While technology has helped us keep in touch with friends and family in faraway places, it appears to have degraded our ability to connect in person. Staying connected online is a double-edged sword since the same news feed that brings us pictures of the grandkids and fluffy kittens also feeds us news about the wars in Israel and Ukraine, the dysfunction in Washington, the latest mass shooting and the climate crisis. Hispanics may have a built-in defense against the isolation technology breeds, owing to their large, multigenerational households, strong social support systems, and tendency to use social media to stay connected with relatives abroad. Age and Gender When asked how individuals rate their mental health, men rate it higher than women by 11 percentage points, and Baby Boomers rank it highest at 83%, saying it’s good or excellent vs. 57% of Gen Z saying the same. Gen Z spends the most amount of time on social media, so the notion that social media negatively affects mental health appears to be correlated. Unfortunately, Gen Z is also the generation that’s least comfortable discussing mental health concerns with healthcare professionals. Only 40% of them state they’re comfortable discussing their issues with a professional compared to 60% of Millennials and 65% of Boomers. Race Affects Attitudes As seen in previous research conducted by ThinkNow, Asian Americans lag other groups when it comes to awareness of mental health issues. Twenty-four percent of Asian Americans believe that having a mental health issue is a sign of weakness compared to the 16% average for all groups. Asians are also considerably less likely to be aware of mental health services in their communities (42% vs. 55%) and most likely to seek out information on social media (51% vs. 35%).
How Race, Age and Gender Shape Attitudes Towards Mental Health
How Race, Age and Gender Shape Attitudes Towards Mental Health
ThinkNow
This article is all about what AI trends will emerge in the field of creative operations in 2024. All the marketers and brand builders should be aware of these trends for their further use and save themselves some time!
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
AI Trends in Creative Operations 2024 by Artwork Flow.pdf
marketingartwork
A rare case of double-diverticulae of the Gallbladder found during a routine elective cholecystectomy is presented including intra operative and specimen images.
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Mohamad محمد Al-Gailani الكيلاني
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂall Girl Serviℂes Available 24x7x365
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Model Neeha Mumbai
Our backs are like superheroes, holding us up and helping us move around. But sometimes, even superheroes can get hurt. That’s where slip discs come in. They’re like when the inside of a special part of our back pushes out a little. This can make our backs feel sore and uncomfortable. When our backs have a slipped disc, there are signs we can watch out for. First, there’s pain in one spot, like the lower back or neck. It can feel sharp and spread to other places. Then, our arms or legs might feel tingly or numb, like when they fall asleep. We might even have trouble moving some muscles or notice changes in how fast we react.
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Gokuldas Hospital
By Shafna finu Ajk college of nursing Nursing student
Mgr university bsc nursing adult health previous question paper with answers
Mgr university bsc nursing adult health previous question paper with answers
ShafnaP5
SEMESTER- V CHILD HEALTH NURSING-I Modern child care emphasizes a holistic approach, nurturing a child's physical, emotional, social, and cognitive development. Shifting from a disease-centered model, modern child care prioritizes preventive care and fostering healthy growth in children. The modern concept of child care recognizes the family as a crucial partner, advocating for family-centered care that addresses individual needs. Incorporating play, proper nutrition, and a safe environment, modern child care fosters optimal child development in all domains. Modern child care empowers nurses to act as advocates, educators, and caregivers, ensuring the well-being of children at every stage.
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
Sachin Sharma
The New Drugs and Clinical Trials Rules, 2019 (NDCT Rules, 2019) apply to all new drugs, investigational new drugs for human use, clinical trials, bioequivalence studies, bioavailability studies, and ethics committees. The rules also apply to orphan drugs, phytopharmaceutical drugs, and biomedical and health research.
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
Akash Agnihotri
Are you curious about what’s new in ovarian cancer research or unsure what the findings mean? Join Dr. Elena Pereira, a gynecologic oncologist at Lenox Hill Hospital, to learn about the latest updates from the Society of Gynecologic Oncology (SGO) 2024 Annual Meeting on Women’s Cancer. Dr. Pereira will discuss what the research presented at the conference means for you and answer your questions about the new developments.
Report Back from SGO: What’s the Latest in Ovarian Cancer?
Report Back from SGO: What’s the Latest in Ovarian Cancer?
bkling
Automatic pill identifier is tool to identify the drug pill in which we need to enter data to get the information
Overview on the Automatic pill identifier
Overview on the Automatic pill identifier
Nidhi Joshi
ANAPHYLAXIS #DNB/MD LECTURES #INTERNAL MEDICINE #EMERGENCY MEDICINE
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
Dr. Sohan Biswas
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment 8630512678 ℂall Girls
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
jamal khanI11
it's an review article based on the clinical symptoms that arise after the alcohol withdrawal that can get worse in just 2 days after the withdraw of alcohol this review includes the pathophysiology and management of AWS. Management includes both the allopathic and ayurvedic Management and thus keeping in mind that the disorder can go to chronic in just 2 days treatment should be started from day 1st and giving ayurvedic formulations can be a better choice over allopathic because these can be administered for a very long time compared to allopathic and also works on the root cause of disorder clear out toxicity and person starts to recover soon. Only limitation is can not be given in chronic state.
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Yash Garg
The presentation is all about the insightfull short and crisp description of drug development life cycle including the drug discovery,clinical trial phases, branded,generic drugs,biologis,biosimilers,acts, patent and exclusivity of drug product.
Drug development life cycle indepth overview.pptx
Drug development life cycle indepth overview.pptx
MohammadAbuzar19
Join Dr. Muhammad Ali Rabbani, Assistant Professor of Anatomy, for an enlightening exploration of advanced concepts in the histology of connective tissue. Building upon foundational knowledge, this lecture delves into the histological features, classification, and functional significance of various types of connective tissue, providing a comprehensive understanding of their roles in maintaining tissue integrity and homeostasis. From the dynamic interplay of cells and extracellular matrix components to the clinical correlations and medical applications, embark on a journey through the intricacies of connective tissue histology with Dr. Rabbani as your guide. 🔬 Key Topics Covered: - Interstitial Fluid: Explore the composition and physiological significance of interstitial fluid in connective tissue, including its role in maintaining tissue hydration, nutrient exchange, and waste removal. - Types of Connective Tissue: Examine the diverse types of connective tissue, including connective tissue proper, embryonic connective tissue, and specialized variants, and understand their structural characteristics, cellular composition, and functional adaptations. - Histological Features: Investigate the histological features of connective tissue, ranging from loose and dense connective tissue to specialized types such as reticular and mucoid connective tissue, and comprehend their unique properties and functions. - Adipose Tissue: Gain insight into the structure, function, and histogenesis of adipose tissue, including the classification of white and brown adipose tissue, their physiological roles, and regulatory mechanisms. - Clinical Correlations: Explore the clinical relevance of connective tissue histology in health and disease, including its implications for tissue repair, inflammation, metabolic disorders, and therapeutic interventions. 🎓 Learning Objectives: By the end of this session, students will: - Describe the composition and functions of interstitial fluid in connective tissue. - Summarize the histological features and classification of various types of connective tissue. - Compare and contrast different types of connective tissue based on cellular composition, fiber arrangement, and functional adaptations. - Explain the physiological roles of adipose tissue and its significance in metabolic regulation, thermogenesis, and pathological conditions. 💡 Medical Applications: - Apply knowledge of connective tissue histology to interpret histopathological findings, diagnose connective tissue disorders, and develop targeted therapeutic strategies. - Explore research opportunities aimed at unraveling the molecular mechanisms underlying connective tissue physiology and pathology, with implications for regenerative medicine and tissue engineering. 🔍 Connect with Dr. Muhammad Ali Rabbani to deepen your understanding of advanced concepts in connective tissue histology and their clinical relevance! 🔍
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
MedicoseAcademics
Tips and tricks to pass the cardiovascular station for PACES exam
Tips and tricks to pass the cardiovascular station for PACES exam
Tips and tricks to pass the cardiovascular station for PACES exam
Junhao Koh
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 Cash Payment
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
anushka vermaI11
анатомія і фізіологія нервової системи
duus neurology.pdf anatomy. phisiology///
duus neurology.pdf anatomy. phisiology///
sofia95y
Holistic Approaches to Depression, Mental Well-Being, Mind Health, and Stress Treatment.
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Health Kinesiology Natural Bioenergetics
Explore the innovative world of Video Capsule Endoscopy (VCE) and its applications in pediatric care. This SlideShare presentation covers the procedure, benefits, and considerations for using VCE in children. Learn how this non-invasive diagnostic tool is revolutionizing the detection and treatment of gastrointestinal conditions in young patients, offering a safer and more comfortable alternative to traditional methods.
Video capsule endoscopy (VCE ) in children
Video capsule endoscopy (VCE ) in children
Raju678948
Renal Replacement Therapy in Acute Kidney Injury -time and modality -Dr Ayman Seddik
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Ayman Seddik
Saudi Arabia [ Abortion pills) Jeddah/riaydh/dammam/++918133066128☎️] cytotec tablets uses abortion pills 💊💊 How effective is the abortion pill? 💊💊 +918133066128) "Abortion pills in Jeddah" how to get cytotec tablets in Riyadh " Abortion pills in dammam*💊💊 The abortion pill is very effective. If you’re taking mifepristone and misoprostol, it depends on how far along the pregnancy is, and how many doses of medicine you take:💊💊 +918133066128) how to buy cytotec pills At 8 weeks pregnant or less, it works about 94-98% of the time. +918133066128[ 💊💊💊 At 8-9 weeks pregnant, it works about 94-96% of the time. +918133066128) At 9-10 weeks pregnant, it works about 91-93% of the time. +918133066128)💊💊 If you take an extra dose of misoprostol, it works about 99% of the time. At 10-11 weeks pregnant, it works about 87% of the time. +918133066128) If you take an extra dose of misoprostol, it works about 98% of the time. In general, taking both mifepristone and+918133066128 misoprostol works a bit better than taking misoprostol only. +918133066128 Taking misoprostol alone works to end the+918133066128 pregnancy about 85-95% of the time — depending on how far along the+918133066128 pregnancy is and how you take the medicine. +918133066128 The abortion pill usually works, but if it doesn’t, you can take more medicine or have an in-clinic abortion. +918133066128 When can I take the abortion pill?+918133066128 In general, you can have a medication abortion up to 77 days (11 weeks)+918133066128 after the first day of your last period. If it’s been 78 days or more since the first day of your last+918133066128 period, you can have an in-clinic abortion to end your pregnancy.+918133066128 Why do people choose the abortion pill? Which kind of abortion you choose all depends on your personal+918133066128 preference and situation. With+918133066128 medication+918133066128 abortion, some people like that you don’t need to have a procedure in a doctor’s office. You can have your medication abortion on your own+918133066128 schedule, at home or in another comfortable place that you choose.+918133066128 You get to decide who you want to be with during your abortion, or you can go it alone. Because+918133066128 medication abortion is similar to a miscarriage, many people feel like it’s more “natural” and less invasive. And some+918133066128 people may not have an in-clinic abortion provider close by, so abortion pills are more available to+918133066128 them. +918133066128 Your doctor, nurse, or health center staff can help you decide which kind of abortion is best for you. +918133066128 More questions from patients: Saudi Arabia+918133066128 CYTOTEC Misoprostol Tablets. Misoprostol is a medication that can prevent stomach ulcers if you also take NSAID medications. It reduces the amount of acid in your stomach, which protects your stomach lining. The brand name of this medication is Cytotec®.+918133066128) Unwanted Kit is a combination of two medicines, which i
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Abortion pills in Kuwait Cytotec pills in Kuwait
How our culture helps to save energy.
Skeleton Culture Code
Skeleton Culture Code
Skeleton Technologies
Materials from Pepsico for their presentation at the 2024 CAGNY conference. Made 2/21/24
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024
Neil Kimberley
More Related Content
Recently uploaded
A rare case of double-diverticulae of the Gallbladder found during a routine elective cholecystectomy is presented including intra operative and specimen images.
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Mohamad محمد Al-Gailani الكيلاني
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂall Girl Serviℂes Available 24x7x365
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Model Neeha Mumbai
Our backs are like superheroes, holding us up and helping us move around. But sometimes, even superheroes can get hurt. That’s where slip discs come in. They’re like when the inside of a special part of our back pushes out a little. This can make our backs feel sore and uncomfortable. When our backs have a slipped disc, there are signs we can watch out for. First, there’s pain in one spot, like the lower back or neck. It can feel sharp and spread to other places. Then, our arms or legs might feel tingly or numb, like when they fall asleep. We might even have trouble moving some muscles or notice changes in how fast we react.
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Gokuldas Hospital
By Shafna finu Ajk college of nursing Nursing student
Mgr university bsc nursing adult health previous question paper with answers
Mgr university bsc nursing adult health previous question paper with answers
ShafnaP5
SEMESTER- V CHILD HEALTH NURSING-I Modern child care emphasizes a holistic approach, nurturing a child's physical, emotional, social, and cognitive development. Shifting from a disease-centered model, modern child care prioritizes preventive care and fostering healthy growth in children. The modern concept of child care recognizes the family as a crucial partner, advocating for family-centered care that addresses individual needs. Incorporating play, proper nutrition, and a safe environment, modern child care fosters optimal child development in all domains. Modern child care empowers nurses to act as advocates, educators, and caregivers, ensuring the well-being of children at every stage.
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
Sachin Sharma
The New Drugs and Clinical Trials Rules, 2019 (NDCT Rules, 2019) apply to all new drugs, investigational new drugs for human use, clinical trials, bioequivalence studies, bioavailability studies, and ethics committees. The rules also apply to orphan drugs, phytopharmaceutical drugs, and biomedical and health research.
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
Akash Agnihotri
Are you curious about what’s new in ovarian cancer research or unsure what the findings mean? Join Dr. Elena Pereira, a gynecologic oncologist at Lenox Hill Hospital, to learn about the latest updates from the Society of Gynecologic Oncology (SGO) 2024 Annual Meeting on Women’s Cancer. Dr. Pereira will discuss what the research presented at the conference means for you and answer your questions about the new developments.
Report Back from SGO: What’s the Latest in Ovarian Cancer?
Report Back from SGO: What’s the Latest in Ovarian Cancer?
bkling
Automatic pill identifier is tool to identify the drug pill in which we need to enter data to get the information
Overview on the Automatic pill identifier
Overview on the Automatic pill identifier
Nidhi Joshi
ANAPHYLAXIS #DNB/MD LECTURES #INTERNAL MEDICINE #EMERGENCY MEDICINE
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
Dr. Sohan Biswas
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment 8630512678 ℂall Girls
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
jamal khanI11
it's an review article based on the clinical symptoms that arise after the alcohol withdrawal that can get worse in just 2 days after the withdraw of alcohol this review includes the pathophysiology and management of AWS. Management includes both the allopathic and ayurvedic Management and thus keeping in mind that the disorder can go to chronic in just 2 days treatment should be started from day 1st and giving ayurvedic formulations can be a better choice over allopathic because these can be administered for a very long time compared to allopathic and also works on the root cause of disorder clear out toxicity and person starts to recover soon. Only limitation is can not be given in chronic state.
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Yash Garg
The presentation is all about the insightfull short and crisp description of drug development life cycle including the drug discovery,clinical trial phases, branded,generic drugs,biologis,biosimilers,acts, patent and exclusivity of drug product.
Drug development life cycle indepth overview.pptx
Drug development life cycle indepth overview.pptx
MohammadAbuzar19
Join Dr. Muhammad Ali Rabbani, Assistant Professor of Anatomy, for an enlightening exploration of advanced concepts in the histology of connective tissue. Building upon foundational knowledge, this lecture delves into the histological features, classification, and functional significance of various types of connective tissue, providing a comprehensive understanding of their roles in maintaining tissue integrity and homeostasis. From the dynamic interplay of cells and extracellular matrix components to the clinical correlations and medical applications, embark on a journey through the intricacies of connective tissue histology with Dr. Rabbani as your guide. 🔬 Key Topics Covered: - Interstitial Fluid: Explore the composition and physiological significance of interstitial fluid in connective tissue, including its role in maintaining tissue hydration, nutrient exchange, and waste removal. - Types of Connective Tissue: Examine the diverse types of connective tissue, including connective tissue proper, embryonic connective tissue, and specialized variants, and understand their structural characteristics, cellular composition, and functional adaptations. - Histological Features: Investigate the histological features of connective tissue, ranging from loose and dense connective tissue to specialized types such as reticular and mucoid connective tissue, and comprehend their unique properties and functions. - Adipose Tissue: Gain insight into the structure, function, and histogenesis of adipose tissue, including the classification of white and brown adipose tissue, their physiological roles, and regulatory mechanisms. - Clinical Correlations: Explore the clinical relevance of connective tissue histology in health and disease, including its implications for tissue repair, inflammation, metabolic disorders, and therapeutic interventions. 🎓 Learning Objectives: By the end of this session, students will: - Describe the composition and functions of interstitial fluid in connective tissue. - Summarize the histological features and classification of various types of connective tissue. - Compare and contrast different types of connective tissue based on cellular composition, fiber arrangement, and functional adaptations. - Explain the physiological roles of adipose tissue and its significance in metabolic regulation, thermogenesis, and pathological conditions. 💡 Medical Applications: - Apply knowledge of connective tissue histology to interpret histopathological findings, diagnose connective tissue disorders, and develop targeted therapeutic strategies. - Explore research opportunities aimed at unraveling the molecular mechanisms underlying connective tissue physiology and pathology, with implications for regenerative medicine and tissue engineering. 🔍 Connect with Dr. Muhammad Ali Rabbani to deepen your understanding of advanced concepts in connective tissue histology and their clinical relevance! 🔍
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
MedicoseAcademics
Tips and tricks to pass the cardiovascular station for PACES exam
Tips and tricks to pass the cardiovascular station for PACES exam
Tips and tricks to pass the cardiovascular station for PACES exam
Junhao Koh
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 Cash Payment
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
anushka vermaI11
анатомія і фізіологія нервової системи
duus neurology.pdf anatomy. phisiology///
duus neurology.pdf anatomy. phisiology///
sofia95y
Holistic Approaches to Depression, Mental Well-Being, Mind Health, and Stress Treatment.
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Health Kinesiology Natural Bioenergetics
Explore the innovative world of Video Capsule Endoscopy (VCE) and its applications in pediatric care. This SlideShare presentation covers the procedure, benefits, and considerations for using VCE in children. Learn how this non-invasive diagnostic tool is revolutionizing the detection and treatment of gastrointestinal conditions in young patients, offering a safer and more comfortable alternative to traditional methods.
Video capsule endoscopy (VCE ) in children
Video capsule endoscopy (VCE ) in children
Raju678948
Renal Replacement Therapy in Acute Kidney Injury -time and modality -Dr Ayman Seddik
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Ayman Seddik
Saudi Arabia [ Abortion pills) Jeddah/riaydh/dammam/++918133066128☎️] cytotec tablets uses abortion pills 💊💊 How effective is the abortion pill? 💊💊 +918133066128) "Abortion pills in Jeddah" how to get cytotec tablets in Riyadh " Abortion pills in dammam*💊💊 The abortion pill is very effective. If you’re taking mifepristone and misoprostol, it depends on how far along the pregnancy is, and how many doses of medicine you take:💊💊 +918133066128) how to buy cytotec pills At 8 weeks pregnant or less, it works about 94-98% of the time. +918133066128[ 💊💊💊 At 8-9 weeks pregnant, it works about 94-96% of the time. +918133066128) At 9-10 weeks pregnant, it works about 91-93% of the time. +918133066128)💊💊 If you take an extra dose of misoprostol, it works about 99% of the time. At 10-11 weeks pregnant, it works about 87% of the time. +918133066128) If you take an extra dose of misoprostol, it works about 98% of the time. In general, taking both mifepristone and+918133066128 misoprostol works a bit better than taking misoprostol only. +918133066128 Taking misoprostol alone works to end the+918133066128 pregnancy about 85-95% of the time — depending on how far along the+918133066128 pregnancy is and how you take the medicine. +918133066128 The abortion pill usually works, but if it doesn’t, you can take more medicine or have an in-clinic abortion. +918133066128 When can I take the abortion pill?+918133066128 In general, you can have a medication abortion up to 77 days (11 weeks)+918133066128 after the first day of your last period. If it’s been 78 days or more since the first day of your last+918133066128 period, you can have an in-clinic abortion to end your pregnancy.+918133066128 Why do people choose the abortion pill? Which kind of abortion you choose all depends on your personal+918133066128 preference and situation. With+918133066128 medication+918133066128 abortion, some people like that you don’t need to have a procedure in a doctor’s office. You can have your medication abortion on your own+918133066128 schedule, at home or in another comfortable place that you choose.+918133066128 You get to decide who you want to be with during your abortion, or you can go it alone. Because+918133066128 medication abortion is similar to a miscarriage, many people feel like it’s more “natural” and less invasive. And some+918133066128 people may not have an in-clinic abortion provider close by, so abortion pills are more available to+918133066128 them. +918133066128 Your doctor, nurse, or health center staff can help you decide which kind of abortion is best for you. +918133066128 More questions from patients: Saudi Arabia+918133066128 CYTOTEC Misoprostol Tablets. Misoprostol is a medication that can prevent stomach ulcers if you also take NSAID medications. It reduces the amount of acid in your stomach, which protects your stomach lining. The brand name of this medication is Cytotec®.+918133066128) Unwanted Kit is a combination of two medicines, which i
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Abortion pills in Kuwait Cytotec pills in Kuwait
Recently uploaded
(20)
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Gallbladder Double-Diverticular: A Case Report المرارة مزدوجة التج: تقرير حالة
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Young & Hot ℂall Girls Patna 8250077686 WhatsApp Number Best Rates of Patna ℂ...
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Signs It’s Time for Physiotherapy Sessions Prioritizing Wellness
Mgr university bsc nursing adult health previous question paper with answers
Mgr university bsc nursing adult health previous question paper with answers
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
SEMESTER-V CHILD HEALTH NURSING-UNIT-1-INTRODUCTION.pdf
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
NDCT Rules, 2019: An Overview | New Drugs and Clinical Trial Rules 2019
Report Back from SGO: What’s the Latest in Ovarian Cancer?
Report Back from SGO: What’s the Latest in Ovarian Cancer?
Overview on the Automatic pill identifier
Overview on the Automatic pill identifier
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
ANAPHYLAXIS BY DR.SOHAN BISWAS,MBBS,DNB(INTERNAL MEDICINE) RESIDENT.pptx
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
Charbagh { ℂall Girls Serviℂe Lucknow ₹7.5k Pick Up & Drop With Cash Payment ...
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Unveiling Alcohol Withdrawal Syndrome: exploring it's hidden depths
Drug development life cycle indepth overview.pptx
Drug development life cycle indepth overview.pptx
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
Connective Tissue II - Dr Muhammad Ali Rabbani - Medicose Academics
Tips and tricks to pass the cardiovascular station for PACES exam
Tips and tricks to pass the cardiovascular station for PACES exam
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
Vesu + ℂall Girls Serviℂe Surat (Adult Only) 8849756361 Esℂort Serviℂe 24x7 C...
duus neurology.pdf anatomy. phisiology///
duus neurology.pdf anatomy. phisiology///
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Unlocking Holistic Wellness: Addressing Depression, Mental Well-Being, and St...
Video capsule endoscopy (VCE ) in children
Video capsule endoscopy (VCE ) in children
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Renal Replacement Therapy in Acute Kidney Injury -time modality -Dr Ayman Se...
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Best medicine 100% Effective&Safe Mifepristion ௵+918133066128௹Abortion pills ...
Featured
How our culture helps to save energy.
Skeleton Culture Code
Skeleton Culture Code
Skeleton Technologies
Materials from Pepsico for their presentation at the 2024 CAGNY conference. Made 2/21/24
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024
Neil Kimberley
The deck from Contently’s popular Content Methodology webinar with Rebecca Lieb, Joe Lazauskas, and Ari Kepnes.
Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)
contently
Presented 1/4/2024 Visit Albert's List: https://bit.ly/findyournextjob
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024
Albert Qian
A report by thenetworkone and Kurio. The contributing experts and agencies are (in an alphabetical order): Sylwia Rytel, Social Media Supervisor, 180heartbeats + JUNG v MATT (PL), Sharlene Jenner, Vice President - Director of Engagement Strategy, Abelson Taylor (USA), Alex Casanovas, Digital Director, Atrevia (ES), Dora Beilin, Senior Social Strategist, Barrett Hoffher (USA), Min Seo, Campaign Director, Brand New Agency (KR), Deshé M. Gully, Associate Strategist, Day One Agency (USA), Francesca Trevisan, Strategist, Different (IT), Trevor Crossman, CX and Digital Transformation Director; Olivia Hussey, Strategic Planner; Simi Srinarula, Social Media Manager, The Hallway (AUS), James Hebbert, Managing Director, Hylink (CN / UK), Mundy Álvarez, Planning Director; Pedro Rojas, Social Media Manager; Pancho González, CCO, Inbrax (CH), Oana Oprea, Head of Digital Planning, Jam Session Agency (RO), Amy Bottrill, Social Account Director, Launch (UK), Gaby Arriaga, Founder, Leonardo1452 (MX), Shantesh S Row, Creative Director, Liwa (UAE), Rajesh Mehta, Chief Strategy Officer; Dhruv Gaur, Digital Planning Lead; Leonie Mergulhao, Account Supervisor - Social Media & PR, Medulla (IN), Aurelija Plioplytė, Head of Digital & Social, Not Perfect (LI), Daiana Khaidargaliyeva, Account Manager, Osaka Labs (UK / USA), Stefanie Söhnchen, Vice President Digital, PIABO Communications (DE), Elisabeth Winiartati, Managing Consultant, Head of Global Integrated Communications; Lydia Aprina, Account Manager, Integrated Marketing and Communications; Nita Prabowo, Account Manager, Integrated Marketing and Communications; Okhi, Web Developer, PNTR Group (ID), Kei Obusan, Insights Director; Daffi Ranandi, Insights Manager, Radarr (SG), Gautam Reghunath, Co-founder & CEO, Talented (IN), Donagh Humphreys, Head of Social and Digital Innovation, THINKHOUSE (IRE), Sarah Yim, Strategy Director, Zulu Alpha Kilo (CA).
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie Insights
Kurio // The Social Media Age(ncy)
The search marketing landscape is evolving rapidly with new technologies, and professionals, like you, rely on innovative paid search strategies to meet changing demands. It’s important that you’re ready to implement new strategies in 2024. Check this out and learn the top trends in paid search advertising that are expected to gain traction, so you can drive higher ROI more efficiently in 2024. You’ll learn: - The latest trends in AI and automation, and what this means for an evolving paid search ecosystem. - New developments in privacy and data regulation. - Emerging ad formats that are expected to make an impact next year. Watch Sreekant Lanka from iQuanti and Irina Klein from OneMain Financial as they dive into the future of paid search and explore the trends, strategies, and technologies that will shape the search marketing landscape. If you’re looking to assess your paid search strategy and design an industry-aligned plan for 2024, then this webinar is for you.
Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024
Search Engine Journal
From their humble beginnings in 1984, TED has grown into the world’s most powerful amplifier for speakers and thought-leaders to share their ideas. They have over 2,400 filmed talks (not including the 30,000+ TEDx videos) freely available online, and have hosted over 17,500 events around the world. With over one billion views in a year, it’s no wonder that so many speakers are looking to TED for ideas on how to share their message more effectively. The article “5 Public-Speaking Tips TED Gives Its Speakers”, by Carmine Gallo for Forbes, gives speakers five practical ways to connect with their audience, and effectively share their ideas on stage. Whether you are gearing up to get on a TED stage yourself, or just want to master the skills that so many of their speakers possess, these tips and quotes from Chris Anderson, the TED Talks Curator, will encourage you to make the most impactful impression on your audience. See the full article and more summaries like this on SpeakerHub here: https://speakerhub.com/blog/5-presentation-tips-ted-gives-its-speakers See the original article on Forbes here: http://www.forbes.com/forbes/welcome/?toURL=http://www.forbes.com/sites/carminegallo/2016/05/06/5-public-speaking-tips-ted-gives-its-speakers/&refURL=&referrer=#5c07a8221d9b
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary
SpeakerHub
Everyone is in agreement that ChatGPT (and other generative AI tools) will shape the future of work. Yet there is little consensus on exactly how, when, and to what extent this technology will change our world. Businesses that extract maximum value from ChatGPT will use it as a collaborative tool for everything from brainstorming to technical maintenance. For individuals, now is the time to pinpoint the skills the future professional will need to thrive in the AI age. Check out this presentation to understand what ChatGPT is, how it will shape the future of work, and how you can prepare to take advantage.
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd
Clark Boyd
a presentation to give to a programming class on how to land a 6 figure job right out of college, and how to prepare during and after school
Getting into the tech field. what next
Getting into the tech field. what next
Tessa Mero
Lily Ray's MozCon talk from 2023 about how core updates work and how search intent plays a role.
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Lily Ray
Stop putting off having difficult conversations. Seven practical tips to ensure your next difficult conversation go smoothly.
How to have difficult conversations
How to have difficult conversations
Rajiv Jayarajah, MAppComm, ACC
A brief introduction to DataScience with explaining of the concepts, algorithms, machine learning, supervised and unsupervised learning, clustering, statistics, data preprocessing, real-world applications etc. It's part of a Data Science Corner Campaign where I will be discussing the fundamentals of DataScience, AIML, Statistics etc.
Introduction to Data Science
Introduction to Data Science
Christy Abraham Joy
Here's my presentation on by proven best practices how to manage your work time effectively and how to improve your productivity. It includes practical tips and how to use tools such as Slack, Google Apps, Hubspot, Google Calendar, Gmail and others.
Time Management & Productivity - Best Practices
Time Management & Productivity - Best Practices
Vit Horky
The six step guide to practical project management If you think managing projects is too difficult, think again. We’ve stripped back project management processes to the basics – to make it quicker and easier, without sacrificing the vital ingredients for success. “If you’re looking for some real-world guidance, then The Six Step Guide to Practical Project Management will help.” Dr Andrew Makar, Tactical Project Management
The six step guide to practical project management
The six step guide to practical project management
MindGenius
A presentation for absolute beginners who have never touched TikTok and may be a bit scared of it!
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
RachelPearson36
During this webinar, Anand Bagmar demonstrates how AI tools such as ChatGPT can be applied to various stages of the software development life cycle (SDLC) using an eCommerce application case study. Find the on-demand recording and more info at https://applitools.info/b59 Key takeaways: • Learn how to use ChatGPT to add AI power to your testing and test automation • Understand the limitations of the technology and where human expertise is crucial • Gain insight into different AI-based tools • Adopt AI-based tools to stay relevant and optimize work for developers and testers * ChatGPT and OpenAI belong to OpenAI, L.L.C.
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Applitools
To succeed in your career, you need a strategy for sending out ripples of influence. Here are 12 ways you can start doing just that.
12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at Work
GetSmarter
ChatGPT webinar slides
ChatGPT webinar slides
Alireza Esmikhani
More than Just Lines on a Map: Best Practices for U.S Bike Routes This session highlights best practices and lessons learned for U.S. Bike Route System designation, as well as how and why these routes should be integrated into bicycle planning at the local and regional level. Presenters: Presenter: Kevin Luecke Toole Design Group Co-Presenter: Virginia Sullivan Adventure Cycling Association
More than Just Lines on a Map: Best Practices for U.S Bike Routes
More than Just Lines on a Map: Best Practices for U.S Bike Routes
Project for Public Spaces & National Center for Biking and Walking
Has your project been caught in a storm of deadlines, clashing requirements, and the need to change course halfway through? If yes, then check out how the administration team navigated through all of this, relocating 160 people from 3 countries and opening 2 offices during the most turbulent time in the last 20 years. Belka Games’ Chief Administrative Officer, Katerina Rudko, will share universal approaches and life hacks that can help your project survive unstable periods when there seem to be too many tasks and a lack of time and people.
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
DevGAMM Conference
Featured
(20)
Skeleton Culture Code
Skeleton Culture Code
PEPSICO Presentation to CAGNY Conference Feb 2024
PEPSICO Presentation to CAGNY Conference Feb 2024
Content Methodology: A Best Practices Report (Webinar)
Content Methodology: A Best Practices Report (Webinar)
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie Insights
Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd
Getting into the tech field. what next
Getting into the tech field. what next
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search Intent
How to have difficult conversations
How to have difficult conversations
Introduction to Data Science
Introduction to Data Science
Time Management & Productivity - Best Practices
Time Management & Productivity - Best Practices
The six step guide to practical project management
The six step guide to practical project management
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at Work
ChatGPT webinar slides
ChatGPT webinar slides
More than Just Lines on a Map: Best Practices for U.S Bike Routes
More than Just Lines on a Map: Best Practices for U.S Bike Routes
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
insulina.fasta.docx
1.
>[Homo sapiens] MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN >[Ovis aries] MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAG GPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN >[Cavia
porcellus] MALWMHLLTVLALLALWGPNTNQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQTELGM GLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN >[Oryctolagus cuniculus] MASLAALLPLLALLVLCRLDPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKSRREVEELQVGQAELGG GPGAGGLQPSALELALQKRGIVEQCCTSICSLYQLENYCN >[Gallus gallus] MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSSPLRGE AGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN >[Peromyscus leucopus] MALWMRLLPLLALLVLWEPKPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKSRRGVEDPQVAQLELGG GPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
Download now