![?C8Q =4F34;78
Lieutenant General
Gurmit Singh, who
retired as the Deputy Chief
of Army, was on Thursday
appointed the Governor of
Uttarakhand, a post which
fell vacant after Baby Rani
Maurya tendered her resig-
nation.
Tamil Nadu Governor
Banwarilal Purohit has been
shifted as Punjab Governor,
while Centre’s interlocutor
and retired IPS officer RN
Ravi has been shifted from
Nagaland to Tamil Nadu as
its new Governor.
Jagdish Mukhi, Assam
Governor, has been given
additional charge of the gov-
ernor of Nagaland till a fresh
appointment is made.
According to a
Rashtrapati Bhavan com-
munique, President Ram
Nath Kovind accepted the
resignation of Uttarakhand
Governor Maurya and
appointed Singh as the
Governor of the State.
?=BQ =4F34;78
India on Thursday outlined its
priority at the BRICS summit
with Prime Minister Narendra
Modi saying that the forum
adopted a counter-terrorism
plan. Russia specifically
brought in Afghanistan issue
saying the situation there is “a
threat to peace” and should not
become “a threat to its neigh-
bouring countries, a source of
terrorism and drug trafficking.”
Participating in the 13th
BRICS summit chaired by
Prime Minister Narendra
Modi, Chinese President Xi
Jinping chose not to mention
Afghanistan in his remarks.
Barring Russia, none of
the attending top leaders men-
tioned the alarming situation in
Afghanistan following the
Taliban takeover with an active
support of Pakistan.
Russian President Vladimir
Putin said the Afghan crisis is
“a threat to peace”.
A statement released later
by Ministry of External Affairs
titled “XIII BRICS Summit:
New Delhi Declaration”, said,
“We call for refraining from
violence and settling the situ-
ation by peaceful means. We
stress the need to contribute to
fostering an inclusive intra-
Afghan dialogue so as to
ensure stability, civil peace,
law and order in the country.”
“We condemn in the
strongest terms the terrorist
attacks near the Hamid Karzai
Kabul International Airport
that resulted in a large number
of deaths and injuries. We
underscore the priority of
fighting terrorism, including
preventing attempts by ter-
rorist organisations to use
Afghan territory as terrorist
sanctuary and to carry out
attacks against other coun-
tries, as well as drug trade
within Afghanistan”, said the
statement.
?=BQ =4F34;78
Asingle dose of Covid vac-
cine is 96.6 per cent effec-
tive in preventing death and
two Covid shots 97.5 per cent
effective in checking fatality, the
Health Ministry said on
Thursday underscoring the
need for vaccination of every
individual in the country.
Presently, 58 per cent of the
country’s adult population has
received at least one dose of
coronavirus vaccine, while 18
per cent have got both the
shots, the total number of jabs
administered in India has
crossed 72 crore.
“The vaccines are disease-
modifying in that they prevent
serious disease and death. They
are not disease-preventing,”
Balram Bhargava, director gen-
eral, Indian Council of Medical
Research said at a Press con-
ference here.
The data analysed is for the
period between April and
August and did not distin-
guish between the different
Covid vaccines currently being
administered in the country,
said Dr Bhargava.
This information, along
with more data on break-
through infections, is expected
to be made available on the
India Covid-19 vaccine track-
er, which will be launched on
the Health Ministry’s website
soon, he said.
The tracker combines data
from CoWIN, the national
Covid-19 testing database and
the Covid-19 India portal of the
Health Ministry to understand
the trends in vaccination.
“The data so far has shown
the same effectiveness across all
age groups in preventing mor-
tality,” Dr Bhargava added.
While the data shows only
just about one per cent increase
in effectiveness after the second
dose, the Government has also
appealed to people to ensure
that they take the second dose
of the vaccine.
Rajesh Bhushan, Union
Health Secretary, added that
the pace of vaccination has
picked up in September, with
an average of 7.8 million doses
administered daily so far.
“The total number of doses
given in the last nine days is
more than 60 million, which
was higher than the total doses
given in the entire month of
May,” he said.
On the timelines of avail-
ability of vaccines such as
Moderna and Johnson
Johnson which have been given
the emergency use authorisa-
tion, VK Paul, chairman,
National Covid Task Force and
member-health Niti Aayog
said, “There are issues around
on we have to find common
ground with manufacturers.”
BC055A4?AC4AQ =4F34;78
National Conference leader
and former member of
the Jammu Kashmir
Legislative Council Trilochan
Singh Wazir, 67, was found
dead in a flat in West Delhi’s
Moti Nagar on Thursday.
Wazir’s body was found in a
decomposed state. The police
said they are investigating the
death from all angles, includ-
ing murder.
Initial investigation sug-
gests that Wazir arrived at the
Basai Darapur flat around 7-8
days ago. The flat was rented
by his acquaintance Harpreet
Singh, who is absconding and
the police are searching for
him. Tirlochan Singh was to
leave on September 2 for
Canada to join his family..
A senior police official said
Wazir’s family alerted the
Jammu Police after they could
not establish any contact with
him for days. The Jammu
Police in turn approached the
Delhi Police.
“On Thursday, the Delhi
Police received a call com-
plaining about a foul smell
from a flat in Moti Nagar. A
police team was rushed to the
spot,” a senior police official
said, adding, “On reaching the
spot, the police broke open the
door and found a partially
decomposed body in the wash-
room.”
Meanwhile, a local resident
said Harpreet Singh was last
seen on Sunday when he came
with a truck and left with his
belongings.
“We got to know about the
incident when the police came
here around 7.30 am today,”
said local residents.
?=BQ =4F34;78
The Indian Institute of
Technology, Madras, (IIT-
M), has retained the top spot
among institutes all over India
for the third consecutive year,
whereas the Indian Institute of
Science (IISc), Bengaluru, has
secured the top spot among the
research institutions, according
to the Ministry of Education’s
National Institutional Ranking
Framework (NIRF).
In the universities catego-
ry, IISc Bengaluru bagged the
top spot followed by JNU and
BHU at second and third rank.
While seven IITs — IIT
Madras, IIT Delhi, IIT Bombay,
IIT Kharagpur, IIT Kanpur, IIT
Guwahati and IIT Roorkee —
figured in the top 10 in the
overall rankings, Jawaharlal
Nehru University (JNU) and
Banaras Hindu University
(BHU) were ranked ninth and
tenth in the overall rankings.
Among colleges, Miranda
House of Delhi University has
been ranked the best college in
the country.
Lady Sri Ram College for
Women also from DU, and
Loyola College, Chennai, are
placed at
second and third ranks respec-
tively.
Delhi University’s St
Stephen’s College, Hindu
College and Shri Ram College
of Commerce, have been
ranked eighth, ninth and tenth.
?A44C0BA8E0BC0E0Q ;D2:=F
The Congress is all set to join
the race to woo Brahmins
in the run up to the Uttar
Pradesh Assembly elections
early next year.
Congress general secretary
and Uttar Pradesh in-charge
Priyanka Gandhi Vadra
reached Lucknow on
Thursday afternoon to take
first-hand account of the
ground situation before kick-
ing off the campaign for 2022
Assembly elections.
Speculation is rife that she is
likely to remove the present
State president Ajay Kumar
Lallu and replace him with
some “Brahmin face”.
According to a senior
party leader, Priyanka’s UP-
based close lieutenants were
not comfortable with Lallu
and want him to be replaced
by a “Brahmin face” as State
President.
All major political parties,
including Bharatiya Janata
Party, Samajwadi Party,
Bahujan Samaj Party, have
already launched programmes
to attract the “Brahmin vote”.
?=BQ =4F34;78
AHercules C-130J plane of
the Indian Air Force (IAF)
carrying Defence Minister
Rajnath Singh, Road Transport
and Highways Minister Nitin
Gadkari, Jal Shakti Minister
Gajendra Singh Shekhawat,
and Chief of Defence Staff
Bipin Rawat, conducted a mock
emergency landing on the
national highway on Thursday.
NH-925, which connects
Barmer and Jalore towns, is
India’s first national highway to
be used for emergency landing
of IAF aircraft.
Gadkari and Rajnath
Singh on Thursday inaugurat-
ed a three-km-long emergency
landing strip for the IAF air-
craft.
Gadkari assured the IAF
that the emergency landing
strips for the armed force’s
planes will be developed with-
in 15 days instead of 1.5 years.
The National Highways
Authority of India (NHAI)
took about 19 months to con-
struct the emergency landing
strip on Satta-Gandhav stretch
on NH-925 in Barmer.
2W^fde_¶eSVcVXZ`_R]eYcVRe+3C:4D
0RGLFKDLUVPHHW
VDV%5,6KDV
DGRSWHGSODQIRU
FRXQWHUWHUURULVP
?aXTX]XbcTa=PaT]SaP^SXPSSaTbbTbcWT1A82BBdXceXPeXST^R^]UTaT]RX]VX]=Tf3T[WX^]CWdabSPh ?C8
A0:4B7:B8=67Q =4F34;78
The Supreme spiritual leader
of Taliban, Shaikh
Haibatullah, late on Wednesday
released the policies of the
Islamic Emirate of Afghanistan
following the announcement of
the interim “Cabinet of the
New Islamic Sharia
Government in Kabul.”
His assertions are expect-
ed to be the long-term policy
priorities for the Taliban
regime, experts said.
“We want to have a peace-
ful, prosperous and self-reliant
Afghanistan, for which we will
strive to eliminate all causes of
war and strife in the country,
and our countrymen to live in
complete security and happi-
ness,” said Haibatullah outlin-
ing the Afghan national prior-
ity under the new regime.
On the relations with
neighbours, he said, “We want
strong and healthy relations
with our neighbors and all
other countries based on mutu-
al respect and interaction. Our
relations with those countries
will be based on Afghanistan’s
highest interests and commit-
ments that do not contradict
Islamic Sharia and national
values of the country, we urge
the countries of the world to
value strong and good political
relations, diplomatic relations
and good relations with us.”
80=BQ :01D;
The interim Government of
the Islamic Emirates of
Afghanistan (IEA) is likey to
take oath of office on
September 11, a day which
also marks the 20th anniver-
sary of the 9/11 attacks in the
US in 2001.
As per reports, the newly-
formed Taliban government
has rolled out invitations to var-
ious countries to be part of the
oath-taking ceremony, includ-
ing China, Turkey, Pakistan,
Iran, Qatar, India and interest-
ingly, the US.
Taliban announced the
names of their interim govern-
ment officials, emphasising that
the formation in Afghanistan
will be under a caretaker setup.
The Taliban are seeking inter-
national recognition and have
called on the countries to
reopen their embassies in the
war-torn nation.
“We recognise that peace
and stability are must for
investments. We want good
relations with all the neigh-
bours, including China,” said
Zabiullah Mujahid, spokesper-
son for the Taliban.
“The war has ended, the
country is getting out of the cri-
sis. It is now the time for peace
and reconstruction. We need
people to support us.
Afghanistan has the right to be
recognised. The international
community should open their
embassies in Kabul,” he added.
However, the internation-
al community is still not ready
to recognise the announced
interim Government of the
Taliban and has raised ques-
tions over non-inclusivity of
various other ethnic groups.
?C8Q 0;;070103
The Allahabad High Court
on Thursday stayed a
Varanasi court order for an
“archaeological survey” of the
Kashi Vishwanath Temple-
Gyanvapi Mosque complex for
determining if any temple ever
existed in place of the mosque.
Justice Prakash Padia also
stayed all further proceedings
before the Varanasi fast-track
civil court on the plea seeking
the archaeological survey of the
temple-mosque complex.
Justice Padia stayed the
Varanasi civil court order, rul-
ing that the subordinate court
passed its order ignoring the
fact that the high court had
reserved its verdict on the plea
challenging the maintainabili-
ty of the suit which had been
filed earlier in the lower court
for the survey.
The High Court gave its
order on two pleas, filed respec-
tively by the Uttar Pradesh
Sunni Central Waqf Board and
Anjuman Intazamia Masazid,
Varanasi, challenging the April
8 order of the Varanasi fast-
track court.
“From the perusal of the
record, it is clear that the judg-
ment was reserved in all pend-
ing petitions by this court after
hearing the learned counsel for
the parties at length on March
15 this year,” Justice Padia
pointed out.
“The court below has the
full knowledge of the fact that
the judgement has already been
reserved on March 15,” he
said.
“In this view of the matter,
the court below should not
have proceeded and decided
the application filed by the
plaintiffs in the Original Suit
for the survey by
Archaeological Survey of
India,” Justice Padia added.
“In the opinion of this
court, the court below should
have waited for the verdict on
the petitions pending before
the High Court and not pro-
ceeded further in the matter till
a judgement was delivered,” he
said.
The High Court also
directed that till the next date
of hearing all further proceed-
ings on the suit pending before
the lower court for the survey
of the twin shrine complex
shall remain stayed.
RYLGMDEHIIHFWLYH
LQSUHYHQWLQJGHDWK ,05
6WWZTRTj`W#
dY`ed*(
ER]ZSR_a]R_`ReYTVcV^`_j
`_#!eYR__ZgVcdRcj`W*
:HZDQWDSURVSHURXV
SHDFHIXOVHOIUHOLDQW$I
7DOLEDQVXSUHPHOHDGHU ?4]VRUVcHRkZc¶dS`Uj
W`f_UZ_5V]YZW]Re
72bcPhbbdaeTh^U³_^bbXQ[T´cT_[T
d]STa6hP]eP_X^b`dTX]EPaP]PbX
::DT3V_XR]fcf
dVTfcVde`ada`e
R^`_XcVdVRcTY
Z_deZefeZ`_dZ_
:_UZR+?:C7
88CaTcPX]bc^_ePabXch
b_^cU^aaShTPaX]a^f
4`_X]ZV]je`XVe
3cRY^Z_FATYZVW
+HUFXOHVFDUULQJ5DMQDWK*DGNDUL
FRQGXFWVPRFNODQGLQJRQ1+
?9*#:_UZR¶d
de?9e`SVfdVU
W`cV^VcXV_Tj
]R_UZ_X`WRZcTcRWe
0TSXRPSX]XbcTab2^eXS (ePRRX]TS^bTc^Pf^P]Pc2XeX[7^b_XcP[X]
;dRZ]^f^]CWdabSPh ?C8
?aXhP]ZP6P]SWXPaaXeTbPccWT
2W^dSWPah2WPaP]BX]VWPXa_^acX]
;dRZ]^f^]CWdabSPh ?C8
D]X^]3TUT]RTX]XbcTaAPY]PcWBX]VWD]X^]X]XbcTa=XcX]6PSZPaXP]S0Xa2WXTU
PabWP[A:B1WPSPdaXPSdaX]VcWTX]PdVdaPcX^]^U4TaVT]Rh;P]SX]V5PRX[Xch
4;5Pc6P]SWPe1WPZPbPabTRcX^]^]=7(!$X]1PaTaSXbcaXRc^]CWdabSPh ?C8
E?Af_[RS
F¶YR_UXVe
_Vh8fgd
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !#'
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=5A830HB4?C414A !! *?064B !C!
DA@CED#
=E0:CFF8=B0F0H
5A20;4=30AB;0
m
m
H@C=5)
278=01D8;38=608A?ACB
8=C814CG8=980=6)A4?AC
69=CC8?E4
31EC538175*
@545;1B
! F9F139DI
@A:?:@?'
8=CADB8=5;0F
8=143A8B103](https://image.slidesharecdn.com/pioneer-dehradun-english-edition-2021-09-10-210910021924/85/pioneer-dehradunenglishedition20210910-1-320.jpg)
![]PcX^]!
347A03D=k5A830H kB4?C414A !!
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
Neeraj Kumar Pande
Once a victim of British
policy of economic drain,
the Indian economy is now the
seventh largest across the globe
despite the challenges posed by
the Covid-19 pandemic. From
a feeble post partition econo-
my to one among the global
giants , the journey has been far
from smooth. However even
before any accolades can be
awarded to contemporary pol-
icy makers, administrators or
the citizenry, it would be an
unforgivable bias to not
acknowledge the role played by
Indian freedom fighters. The
entire course of the nineteenth
as well as twentieth century is
replete with stories of valour
and legends of sacrifice made
by stalwarts of Indian nation-
al movement. September 10
marks the birth anniversary of
one such eminent and illustri-
ous personality. He fought
tooth and nail against colonial
oppression while also working
tirelessly in various positions in
the newly minted political
landscape of the nation.
Govind Ballabh Pant was
not only a key figure in the
independence struggle but also
one of the architects of modern
India. Alongside leaders like
Jawaharlal Nehru and Vallabh
Bhai Patel, he was a pivotal fig-
ure in the Indian government.
He hailed from an erudite and
traditional family from Khoont
village near Almora. After
graduating from the coveted
Allahabad University, he chose
to pursue law. However those
were also the heydays of the
national movement in the
country. As early as 1914, he
raised his voice against the
inhuman practice of Coolie
Beggar that was popular in the
Kumaon region of the erstwhile
United Provinces. The local vil-
lagers would be compelled to
carry luggage of visiting British
officers and run other sub
human errands for them with-
out being paid. Hence a move-
ment broke out against the Raj,
where GB Pant assisted a local
group in their successful chal-
lenge to the practice. The suc-
cess of the initiative caught the
attention of MK Gandhi as
well. When in 1921 he entered
the political domain officially,
he was elected to the Legislative
Assembly of the erstwhile
United Provinces of Agra and
Oudh. Being a brilliant lawyer,
the Congress party had
appointed him to initially rep-
resent Ram Prasad Bismil,
Ashfaqulla Khan and other
revolutionaries who were
involved in the Kakori case in
the mid 1920s. When there was
an indignation caused to the
people of the country owing to
the racial overtones of British
appointed Simon commission
in 1928, GB Pant along with
other fellow nationalists
expressed his resentment open-
ly. In fact Jawaharlal Nehru in
his autobiography has lauded
the courage with which Pant
participated in the anti Simon
protests. He had sustained an
agonising spine injury as the
British soldiers lashed out at the
protesters. While it had left him
physically incapacitated for the
remaining part of his life this
blow could not diminish his
unrelenting spirit or patriotism.
He attempted organising salt
March on the lines of Gandhi’s
model and with his wisdom
even meditated between the
ideologically opposite factions
led by Subhas Chandra Bose
and Gandhi. In 1940 he faced
the British government’s wrath
once again as he was put
behind bars for supporting
Gandhi’s Satyagraha. However
these threats only saw him
become more voraciously
involved in the freedom move-
ment. When the entire country
was bubbling with the fervour
of Quit India Movement in
1942, Pant became one of the
leaders at forefront of signing
the Quit India resolution. This
yielded another opportunity to
the draconian colonial Raj to
arrest him. With declining
health yet stoic passion he
spent three years in
Ahmednagar Fort prison along
with other members of the then
Congress working committee
until March 1945. Nehru had
at that point pleaded success-
fully for his release from there
on grounds of ill health.
Although earlier as well he
had made a stint as the first
chief minister of United
Provinces, he assumed this
position once again in 1946. He
not only successfully abolished
the exploitative Zamindari sys-
tem here but also revolu-
tionised laws pertaining to
women’s inheritance and mar-
riage. He was appointed
Minister of Home Affairs in the
Union Cabinet on 10 January
1955 in New Delhi by Nehru.
In this position he not only
contributed in the mammoth
reorganisation of Indian states
on a linguistic basis but also
pushed for Hindi being made
the official language of the
government.
For the distinguished con-
tributions which he made to
the nation, he was awarded the
Bharat Ratna in 1957. This has
been a matter of great pride for
everyone in his home state. For,
although Uttarakhand took
shape as a separate state only in
2000, with his foresight Pant
had already begun contem-
plating multidimensional
development for the moun-
tainous regions long before
1947. He laid emphasis on
establishment of schools, hos-
pitals and banks to ensure eco-
nomic and social growth in the
hill towns of the erstwhile
Uttar Pradesh. At the time
when formal education for
most women was still a remote
dream, he insisted on permit-
ting girls to attend schools. He
also spoke against regressive
customs of early marriage of
girls and child labour. He him-
self once said, “Let us remem-
ber that it is the citizen that
must count. It is the citizen that
forms the base as well as the
summit of the social pyramid.”
No wonder today his name
resonates in many education-
al, environmental and medical
institutions, particularly in
Delhi, Uttar Pradesh and
Uttarakhand.The GB Pant
University of Agriculture and
Technology at Pantnagar is
considered to have played a
vital role in India’s green revo-
lution. Nehru while inaugu-
rating the university in 1960,
recollected Pant’s contributions
with teary eyes. The Birla Vidya
Mandir in Nainital which con-
tinues to rank among the best
Indian residential schools, was
also a brainchild of Pant. In fact
there is so much more which
Uttarakhand owes to him. The
legacy of the state is only a
reflection of his great legacy.
Indeed leaders with such vision
of social welfare and Mukti sec-
toral development are rare. It
was nothing short of utter
good fortune for the people of
Uttarakhand as well as entire
country to have had such a dis-
tinguished leader, who has
etched a luminous past for
them.
In the words of historians,
he was a man with an iron will,
a sobriquet which he lived
until he breathed his last in
1961. Today he is a testimony
of how, by a strong vision and
philanthropist outlook one can
change the world around him-
self/ herself.
(The writer is a retired
civil servant. Views expressed
are personal)
*8(672/801
2ecZSfeVe`Z]]fdecZ`fd]VXRTj`W8`gZ_U3R]]RSYAR_e ?=BQ 347A03D=
The District Legal Services
Authority (DLSA) of
Dehradun is all set to organise
National Lok Adalat on
Saturday as per the directions
of the State Legal Services
Authority (SLSA). The district
judge and DLSA head, Pradeep
Pant informed in a Press meet-
ing in the civil court hall that
Lok Adalats will be organised in
all courts of the district on
Saturday from 10 AM to 4 PM
and 17 benches have already
been formed to settle the cases.
Informing about Lok Adalats,
he said that it is a forum where
cases that are pending in the
courts or at the pre-litigation
stage are tried to settle amica-
bly. He said that the cases relat-
ed to banks and debt recovery,
motor accidents, electricity and
water bills, land acquisitions
and family disputes among
others which can be settled
through amicable settlements
are entertained in Lok Adalats.
He said that about 3,500 cases
have already been referred to
the benches and he appealed to
the public to approach the
courts to get their matter
resolved through Lok Adalats.
'/6$WRRUJDQLVH
1DWLRQDO/RN$GDODW
?=BQ 347A03D=
The State Government has
issued checks to all district
magistrates for an amount of
over Rs 23 crore payable to the
beneficiaries registered on the
web portal of the transport
department. The registered
eligible beneficiaries working
in public transportation will
receive Rs 2,000 each as
monthly monetary aid by the
government for the next six
months.
The deputy transport
commissioner Sanat Kumar
Singh informed that it is pro-
posed that chief minister
Pushkar Singh Dhami will
inaugurate the programme
on September 15 after which,
the DMs will issue Rs 2,000 to
each beneficiary through
direct bank transfer.
Considering this, Singh has
directed all the regional trans-
port officers to provide the list
of all the eligible beneficiaries
registered in the portal to
their respective DMs by
Monday.
?=BQ AA:44
The Indian Institute of
Technology (IIT) Roorkee,
is going to conduct its 21st
annual convocation virtually on
September 11. Chancellor of
the University of California,
San Diego Pradeep K Khosla
will be the chief guest while the
institute’s board of governor’s
chairman BVR Mohan Reddy
will be presiding over the func-
tion. A total of 1,804 degrees
will be awarded this year
including 912 undergraduate,
685 post graduate and 207
doctorate degrees.
The institute director AK
Chaturvedi said, We exhort
the graduating students to ded-
icate themselves to the profes-
sion they choose and to the
society. We are happy to award
degrees to 1,804 students this
year.”
?=BQ 347A03D=
The Municipal Corporation
of Dehradun (MCD) is
planning to start an anti-plas-
tic campaign next week. Despite
the reinstatement of the plastic
ban by the State Government,
there is no considerable decline
in the use of single-use plastics
in the city. Considering this, the
corporation is planning to start
an anti-plastic campaign by
next week. We are very well
aware of the increasing use of
single-use plastics in the city but
rather than imposing penalties
on vendors and consumers, we
will first conduct public aware-
ness campaigns against plastic
use. We are planning to start it
next week, stated the munici-
pal commissioner Abhishek
Ruhela.
He said that if the people
are made aware of the reasons
why plastic should not be used,
it will motivate them more to
restrict its use. However, he
added that action will be taken
against the offenders if they will
continue to use plastics against
the rules even after the aware-
ness campaign.
=34`Q^cd_cdQbd
Q^dY`QcdYSSQ]`QYW^
88CAc^W^[S! bc
R^]e^RPcX^]^]
BPcdaSPh
BcPcT6^ec
XbbdTb^eTa
C!Ra^aTU^a
QT]TUXRXPaXTb
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Thursday said that Universities
should not become institutions
only for awarding degrees, but
they should also worry about
placements.
“Along with providing qual-
ity education, moral education
should also be imparted to the
students so that the feeling of
patriotismisinculcatedinthem,”
the Chief Minister said while
addressing the one-day work-
shop of Vice Chancellors and
Registrars of private universities
across the state, chaired by
GovernorBandaruDattatrayaat
Haryana Raj Bhavan here.
The Chief Minister said
that Haryana Government is
taking several steps to improve
the quality of education. The
online transfer policy of teach-
ers is also a big step taken in this
direction. Teachers have got lot
of benefits from this policy, he
said. Khattar said that the Super
100 programme is proving to be
a boon for many aspiring can-
didates appearing for competi-
tive exams. The programme
wasinitiallystartedattwoplaces
in which 72 and 23 students of
poor families successfully got
admission in medical and IITs
respectively after getting coach-
ing. Now, expanding this pro-
gramme further, it has been
decided to start the Super 100
programme at four more places,
he said. The Chief Minister
said that the State Government
is leaving no stone unturned in
the field of education.
Establishing new University in
every district is the utmost pri-
ority of the State Government,
so as to ensure that students do
not have to travel long dis-
tances for higher education, he
said. He said that the State
Government is continuously
working to open new institutes
for higher education. Under the
new education policy, two uni-
versities have started work of
imparting education under the
KG-to-PG programme. This
programme will be further
expanded in future,
he said. The Chief
Minister also called
upon the education-
ists present in the
workshop to empha-
size on imparting
moral education as
inculcating moral
values in children
can certainly play a
pivotal role in curb-
ing crime and cor-
ruption.
D]XeTabXchbW^d[Sf^aahPQ^dcbcdST]cbcX[[cWTXa_[PRTT]cbPhb7PahP]P2
?=B Q 270=3860A7
Farmer bodies protesting the
Centre’s agriculture laws
have called a meeting of polit-
ical parties on Friday to press
them not to carry out elec-
tioneering till the Punjab
Assembly polls are announced.
The BJP has not been
called for the meeting. The
Punjab Assembly polls are due
early next year. Confirming it,
Jamhoori Kisan Sabha general
secretary Kulwant Singh
Sandhu on Thursday said
farmer bodies have convened a
meeting of all political parties
here on Friday. He said the
BJP, which supported the three
farm laws, has not been invit-
ed to the meeting. He said rep-
resentatives of political parties
will be asked not to indulge in
electioneering or hold political
rallies till the elections are
announced as it could hurt the
ongoing farmer struggle.
The Shiromani Akali Dal
on Thursday said party presi-
dent Sukhbir Singh Badal has
deputed Balwinder Singh
Bhundar, Prem Singh
Chandumajra, Mahesh Inder
Singh Grewal and Daljit Singh
Cheema to participate in the
meeting. Aam Aadmi Party
MLA Kultar Singh Sandhwan
said party representatives will
participate in the meeting
called by farmer bodies on
Friday.
Bc^_T[TRcX^]TTaX]VU^a]^fUPa
Q^SXTbc^PbZ_^[XcXRP[_PacXTb^U?d]YPQ
?=BQ 270=3860A7
Haryana Home Minister
Anil Vij on Thursday
offered to conduct an
“impartial inquiry” into the
August 28 lathi charge on
farmers in Karnal as the
farmers’ unions continued
their protest outside Karnal
mini-secretariat for the third
consecutive day over their
demands.
Vij said that the State
Government is ready to
accept the genuine demands
of farmers. We are ready to
get an “impartial inquiry”
conducted in the entire
Karnal incident on August 28
and not only into the allega-
tions against an IAS officer,
he said.
After conducting the
inquiry, whosoever is found
guilty, action will be taken
against them. Whether it’s an
IAS officer or the farmers,
the government will take
strict action against the
guilty, Vij said.
On farmers’ demand of
taking action against the
then Karnal SDM Ayush
Sinha, the Minister made it
clear that nobody can be
hanged without a probe just
because someone demands it.
“We cannot hang anyone
because someone says so. Is
the country's IPC (Indian
Penal Code) different and the
farmers' IPC different? It
cannot be like this and pun-
ishment is always given as
per the offence committed.
To find out the offence, a
probe has to be conducted,”
he added.
The Samyukt Kisan
Morcha has however con-
demned Vij’s statement for
allegedly threatening to take
action against farmers.
In a statement issued,
the SKM said, “The Haryana
government has been
exposed for its anti-farmer
agenda. It tried to disrupt the
farm movement from the
very beginning and has filed
numerous cases against farm-
ers and farm leaders. Yet, it
promotes and supports the
officer who ordered the
breaking heads of farmers
and refuses to take action
against him.”
The SKM will be holding
a meeting on September 11
in Karnal to decide the future
course of action. Farmers’
leader Gurnam Singh
Chaduni said that the protest
will continue at Karnal till
their demands are accepted
by the government.
5PaTabR^]cX]dT_a^cTbcU^acWXaSSPh*EXY^UUTab
³X_PacXP[_a^QT´X]c^0dVdbc!':Pa]P[T_Xb^ST
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO$UHD'HKUDGXQ
8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)
6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7)
Recommended
Recommended
More Related Content
What's hot
What's hot (20)
Similar to Pioneer dehradun-english-edition-2021-09-10
Similar to Pioneer dehradun-english-edition-2021-09-10 (20)
More from DunEditorial
More from DunEditorial (20)
Recently uploaded
Recently uploaded (16)
Pioneer dehradun-english-edition-2021-09-10
- 1. ?C8Q =4F34;78 Lieutenant General Gurmit Singh, who retired as the Deputy Chief of Army, was on Thursday appointed the Governor of Uttarakhand, a post which fell vacant after Baby Rani Maurya tendered her resig- nation. Tamil Nadu Governor Banwarilal Purohit has been shifted as Punjab Governor, while Centre’s interlocutor and retired IPS officer RN Ravi has been shifted from Nagaland to Tamil Nadu as its new Governor. Jagdish Mukhi, Assam Governor, has been given additional charge of the gov- ernor of Nagaland till a fresh appointment is made. According to a Rashtrapati Bhavan com- munique, President Ram Nath Kovind accepted the resignation of Uttarakhand Governor Maurya and appointed Singh as the Governor of the State. ?=BQ =4F34;78 India on Thursday outlined its priority at the BRICS summit with Prime Minister Narendra Modi saying that the forum adopted a counter-terrorism plan. Russia specifically brought in Afghanistan issue saying the situation there is “a threat to peace” and should not become “a threat to its neigh- bouring countries, a source of terrorism and drug trafficking.” Participating in the 13th BRICS summit chaired by Prime Minister Narendra Modi, Chinese President Xi Jinping chose not to mention Afghanistan in his remarks. Barring Russia, none of the attending top leaders men- tioned the alarming situation in Afghanistan following the Taliban takeover with an active support of Pakistan. Russian President Vladimir Putin said the Afghan crisis is “a threat to peace”. A statement released later by Ministry of External Affairs titled “XIII BRICS Summit: New Delhi Declaration”, said, “We call for refraining from violence and settling the situ- ation by peaceful means. We stress the need to contribute to fostering an inclusive intra- Afghan dialogue so as to ensure stability, civil peace, law and order in the country.” “We condemn in the strongest terms the terrorist attacks near the Hamid Karzai Kabul International Airport that resulted in a large number of deaths and injuries. We underscore the priority of fighting terrorism, including preventing attempts by ter- rorist organisations to use Afghan territory as terrorist sanctuary and to carry out attacks against other coun- tries, as well as drug trade within Afghanistan”, said the statement. ?=BQ =4F34;78 Asingle dose of Covid vac- cine is 96.6 per cent effec- tive in preventing death and two Covid shots 97.5 per cent effective in checking fatality, the Health Ministry said on Thursday underscoring the need for vaccination of every individual in the country. Presently, 58 per cent of the country’s adult population has received at least one dose of coronavirus vaccine, while 18 per cent have got both the shots, the total number of jabs administered in India has crossed 72 crore. “The vaccines are disease- modifying in that they prevent serious disease and death. They are not disease-preventing,” Balram Bhargava, director gen- eral, Indian Council of Medical Research said at a Press con- ference here. The data analysed is for the period between April and August and did not distin- guish between the different Covid vaccines currently being administered in the country, said Dr Bhargava. This information, along with more data on break- through infections, is expected to be made available on the India Covid-19 vaccine track- er, which will be launched on the Health Ministry’s website soon, he said. The tracker combines data from CoWIN, the national Covid-19 testing database and the Covid-19 India portal of the Health Ministry to understand the trends in vaccination. “The data so far has shown the same effectiveness across all age groups in preventing mor- tality,” Dr Bhargava added. While the data shows only just about one per cent increase in effectiveness after the second dose, the Government has also appealed to people to ensure that they take the second dose of the vaccine. Rajesh Bhushan, Union Health Secretary, added that the pace of vaccination has picked up in September, with an average of 7.8 million doses administered daily so far. “The total number of doses given in the last nine days is more than 60 million, which was higher than the total doses given in the entire month of May,” he said. On the timelines of avail- ability of vaccines such as Moderna and Johnson Johnson which have been given the emergency use authorisa- tion, VK Paul, chairman, National Covid Task Force and member-health Niti Aayog said, “There are issues around on we have to find common ground with manufacturers.” BC055A4?AC4AQ =4F34;78 National Conference leader and former member of the Jammu Kashmir Legislative Council Trilochan Singh Wazir, 67, was found dead in a flat in West Delhi’s Moti Nagar on Thursday. Wazir’s body was found in a decomposed state. The police said they are investigating the death from all angles, includ- ing murder. Initial investigation sug- gests that Wazir arrived at the Basai Darapur flat around 7-8 days ago. The flat was rented by his acquaintance Harpreet Singh, who is absconding and the police are searching for him. Tirlochan Singh was to leave on September 2 for Canada to join his family.. A senior police official said Wazir’s family alerted the Jammu Police after they could not establish any contact with him for days. The Jammu Police in turn approached the Delhi Police. “On Thursday, the Delhi Police received a call com- plaining about a foul smell from a flat in Moti Nagar. A police team was rushed to the spot,” a senior police official said, adding, “On reaching the spot, the police broke open the door and found a partially decomposed body in the wash- room.” Meanwhile, a local resident said Harpreet Singh was last seen on Sunday when he came with a truck and left with his belongings. “We got to know about the incident when the police came here around 7.30 am today,” said local residents. ?=BQ =4F34;78 The Indian Institute of Technology, Madras, (IIT- M), has retained the top spot among institutes all over India for the third consecutive year, whereas the Indian Institute of Science (IISc), Bengaluru, has secured the top spot among the research institutions, according to the Ministry of Education’s National Institutional Ranking Framework (NIRF). In the universities catego- ry, IISc Bengaluru bagged the top spot followed by JNU and BHU at second and third rank. While seven IITs — IIT Madras, IIT Delhi, IIT Bombay, IIT Kharagpur, IIT Kanpur, IIT Guwahati and IIT Roorkee — figured in the top 10 in the overall rankings, Jawaharlal Nehru University (JNU) and Banaras Hindu University (BHU) were ranked ninth and tenth in the overall rankings. Among colleges, Miranda House of Delhi University has been ranked the best college in the country. Lady Sri Ram College for Women also from DU, and Loyola College, Chennai, are placed at second and third ranks respec- tively. Delhi University’s St Stephen’s College, Hindu College and Shri Ram College of Commerce, have been ranked eighth, ninth and tenth. ?A44C0BA8E0BC0E0Q ;D2:=F The Congress is all set to join the race to woo Brahmins in the run up to the Uttar Pradesh Assembly elections early next year. Congress general secretary and Uttar Pradesh in-charge Priyanka Gandhi Vadra reached Lucknow on Thursday afternoon to take first-hand account of the ground situation before kick- ing off the campaign for 2022 Assembly elections. Speculation is rife that she is likely to remove the present State president Ajay Kumar Lallu and replace him with some “Brahmin face”. According to a senior party leader, Priyanka’s UP- based close lieutenants were not comfortable with Lallu and want him to be replaced by a “Brahmin face” as State President. All major political parties, including Bharatiya Janata Party, Samajwadi Party, Bahujan Samaj Party, have already launched programmes to attract the “Brahmin vote”. ?=BQ =4F34;78 AHercules C-130J plane of the Indian Air Force (IAF) carrying Defence Minister Rajnath Singh, Road Transport and Highways Minister Nitin Gadkari, Jal Shakti Minister Gajendra Singh Shekhawat, and Chief of Defence Staff Bipin Rawat, conducted a mock emergency landing on the national highway on Thursday. NH-925, which connects Barmer and Jalore towns, is India’s first national highway to be used for emergency landing of IAF aircraft. Gadkari and Rajnath Singh on Thursday inaugurat- ed a three-km-long emergency landing strip for the IAF air- craft. Gadkari assured the IAF that the emergency landing strips for the armed force’s planes will be developed with- in 15 days instead of 1.5 years. The National Highways Authority of India (NHAI) took about 19 months to con- struct the emergency landing strip on Satta-Gandhav stretch on NH-925 in Barmer. 2W^fde_¶eSVcVXZ`_R]eYcVRe+3C:4D 0RGLFKDLUVPHHW VDV%5,6KDV DGRSWHGSODQIRU FRXQWHUWHUURULVP ?aXTX]XbcTa=PaT]SaP^SXPSSaTbbTbcWT1A82BBdXceXPeXST^R^]UTaT]RX]VX]=Tf3T[WX^]CWdabSPh ?C8 A0:4B7:B8=67Q =4F34;78 The Supreme spiritual leader of Taliban, Shaikh Haibatullah, late on Wednesday released the policies of the Islamic Emirate of Afghanistan following the announcement of the interim “Cabinet of the New Islamic Sharia Government in Kabul.” His assertions are expect- ed to be the long-term policy priorities for the Taliban regime, experts said. “We want to have a peace- ful, prosperous and self-reliant Afghanistan, for which we will strive to eliminate all causes of war and strife in the country, and our countrymen to live in complete security and happi- ness,” said Haibatullah outlin- ing the Afghan national prior- ity under the new regime. On the relations with neighbours, he said, “We want strong and healthy relations with our neighbors and all other countries based on mutu- al respect and interaction. Our relations with those countries will be based on Afghanistan’s highest interests and commit- ments that do not contradict Islamic Sharia and national values of the country, we urge the countries of the world to value strong and good political relations, diplomatic relations and good relations with us.” 80=BQ :01D; The interim Government of the Islamic Emirates of Afghanistan (IEA) is likey to take oath of office on September 11, a day which also marks the 20th anniver- sary of the 9/11 attacks in the US in 2001. As per reports, the newly- formed Taliban government has rolled out invitations to var- ious countries to be part of the oath-taking ceremony, includ- ing China, Turkey, Pakistan, Iran, Qatar, India and interest- ingly, the US. Taliban announced the names of their interim govern- ment officials, emphasising that the formation in Afghanistan will be under a caretaker setup. The Taliban are seeking inter- national recognition and have called on the countries to reopen their embassies in the war-torn nation. “We recognise that peace and stability are must for investments. We want good relations with all the neigh- bours, including China,” said Zabiullah Mujahid, spokesper- son for the Taliban. “The war has ended, the country is getting out of the cri- sis. It is now the time for peace and reconstruction. We need people to support us. Afghanistan has the right to be recognised. The international community should open their embassies in Kabul,” he added. However, the internation- al community is still not ready to recognise the announced interim Government of the Taliban and has raised ques- tions over non-inclusivity of various other ethnic groups. ?C8Q 0;;070103 The Allahabad High Court on Thursday stayed a Varanasi court order for an “archaeological survey” of the Kashi Vishwanath Temple- Gyanvapi Mosque complex for determining if any temple ever existed in place of the mosque. Justice Prakash Padia also stayed all further proceedings before the Varanasi fast-track civil court on the plea seeking the archaeological survey of the temple-mosque complex. Justice Padia stayed the Varanasi civil court order, rul- ing that the subordinate court passed its order ignoring the fact that the high court had reserved its verdict on the plea challenging the maintainabili- ty of the suit which had been filed earlier in the lower court for the survey. The High Court gave its order on two pleas, filed respec- tively by the Uttar Pradesh Sunni Central Waqf Board and Anjuman Intazamia Masazid, Varanasi, challenging the April 8 order of the Varanasi fast- track court. “From the perusal of the record, it is clear that the judg- ment was reserved in all pend- ing petitions by this court after hearing the learned counsel for the parties at length on March 15 this year,” Justice Padia pointed out. “The court below has the full knowledge of the fact that the judgement has already been reserved on March 15,” he said. “In this view of the matter, the court below should not have proceeded and decided the application filed by the plaintiffs in the Original Suit for the survey by Archaeological Survey of India,” Justice Padia added. “In the opinion of this court, the court below should have waited for the verdict on the petitions pending before the High Court and not pro- ceeded further in the matter till a judgement was delivered,” he said. The High Court also directed that till the next date of hearing all further proceed- ings on the suit pending before the lower court for the survey of the twin shrine complex shall remain stayed. RYLGMDEHIIHFWLYH LQSUHYHQWLQJGHDWK ,05 6WWZTRTj`W# dY`ed*( ER]ZSR_a]R_`ReYTVcV^`_j `_#!eYR__ZgVcdRcj`W* :HZDQWDSURVSHURXV SHDFHIXOVHOIUHOLDQW$I 7DOLEDQVXSUHPHOHDGHU ?4]VRUVcHRkZc¶dS`Uj W`f_UZ_5V]YZW]Re 72bcPhbbdaeTh^U³_^bbXQ[T´cT_[T d]STa6hP]eP_X^b`dTX]EPaP]PbX ::DT3V_XR]fcf dVTfcVde`ada`e R^`_XcVdVRcTY Z_deZefeZ`_dZ_ :_UZR+?:C7 88CaTcPX]bc^_ePabXch b_^cU^aaShTPaX]a^f 4`_X]ZV]je`XVe 3cRY^Z_FATYZVW +HUFXOHVFDUULQJ5DMQDWK*DGNDUL FRQGXFWVPRFNODQGLQJRQ1+ ?9*#:_UZR¶d de?9e`SVfdVU W`cV^VcXV_Tj ]R_UZ_X`WRZcTcRWe 0TSXRPSX]XbcTab2^eXS (ePRRX]TS^bTc^Pf^P]Pc2XeX[7^b_XcP[X] ;dRZ]^f^]CWdabSPh ?C8 ?aXhP]ZP6P]SWXPaaXeTbPccWT 2W^dSWPah2WPaP]BX]VWPXa_^acX] ;dRZ]^f^]CWdabSPh ?C8 D]X^]3TUT]RTX]XbcTaAPY]PcWBX]VWD]X^]X]XbcTa=XcX]6PSZPaXP]S0Xa2WXTU PabWP[A:B1WPSPdaXPSdaX]VcWTX]PdVdaPcX^]^U4TaVT]Rh;P]SX]V5PRX[Xch 4;5Pc6P]SWPe1WPZPbPabTRcX^]^]=7(!$X]1PaTaSXbcaXRc^]CWdabSPh ?C8 E?Af_[RS F¶YR_UXVe _Vh8fgd /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $ 8bbdT !#' 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D=5A830HB4?C414A !! *?064B !C! DA@CED# =E0:CFF8=B0F0H 5A20;4=30AB;0 m m H@C=5) 278=01D8;38=608A?ACB 8=C814CG8=980=6)A4?AC 69=CC8?E4 31EC538175* @545;1B ! F9F139DI @A:?:@?' 8=CADB8=5;0F 8=143A8B103
- 2. ]PcX^]! 347A03D=k5A830H kB4?C414A !! $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV Neeraj Kumar Pande Once a victim of British policy of economic drain, the Indian economy is now the seventh largest across the globe despite the challenges posed by the Covid-19 pandemic. From a feeble post partition econo- my to one among the global giants , the journey has been far from smooth. However even before any accolades can be awarded to contemporary pol- icy makers, administrators or the citizenry, it would be an unforgivable bias to not acknowledge the role played by Indian freedom fighters. The entire course of the nineteenth as well as twentieth century is replete with stories of valour and legends of sacrifice made by stalwarts of Indian nation- al movement. September 10 marks the birth anniversary of one such eminent and illustri- ous personality. He fought tooth and nail against colonial oppression while also working tirelessly in various positions in the newly minted political landscape of the nation. Govind Ballabh Pant was not only a key figure in the independence struggle but also one of the architects of modern India. Alongside leaders like Jawaharlal Nehru and Vallabh Bhai Patel, he was a pivotal fig- ure in the Indian government. He hailed from an erudite and traditional family from Khoont village near Almora. After graduating from the coveted Allahabad University, he chose to pursue law. However those were also the heydays of the national movement in the country. As early as 1914, he raised his voice against the inhuman practice of Coolie Beggar that was popular in the Kumaon region of the erstwhile United Provinces. The local vil- lagers would be compelled to carry luggage of visiting British officers and run other sub human errands for them with- out being paid. Hence a move- ment broke out against the Raj, where GB Pant assisted a local group in their successful chal- lenge to the practice. The suc- cess of the initiative caught the attention of MK Gandhi as well. When in 1921 he entered the political domain officially, he was elected to the Legislative Assembly of the erstwhile United Provinces of Agra and Oudh. Being a brilliant lawyer, the Congress party had appointed him to initially rep- resent Ram Prasad Bismil, Ashfaqulla Khan and other revolutionaries who were involved in the Kakori case in the mid 1920s. When there was an indignation caused to the people of the country owing to the racial overtones of British appointed Simon commission in 1928, GB Pant along with other fellow nationalists expressed his resentment open- ly. In fact Jawaharlal Nehru in his autobiography has lauded the courage with which Pant participated in the anti Simon protests. He had sustained an agonising spine injury as the British soldiers lashed out at the protesters. While it had left him physically incapacitated for the remaining part of his life this blow could not diminish his unrelenting spirit or patriotism. He attempted organising salt March on the lines of Gandhi’s model and with his wisdom even meditated between the ideologically opposite factions led by Subhas Chandra Bose and Gandhi. In 1940 he faced the British government’s wrath once again as he was put behind bars for supporting Gandhi’s Satyagraha. However these threats only saw him become more voraciously involved in the freedom move- ment. When the entire country was bubbling with the fervour of Quit India Movement in 1942, Pant became one of the leaders at forefront of signing the Quit India resolution. This yielded another opportunity to the draconian colonial Raj to arrest him. With declining health yet stoic passion he spent three years in Ahmednagar Fort prison along with other members of the then Congress working committee until March 1945. Nehru had at that point pleaded success- fully for his release from there on grounds of ill health. Although earlier as well he had made a stint as the first chief minister of United Provinces, he assumed this position once again in 1946. He not only successfully abolished the exploitative Zamindari sys- tem here but also revolu- tionised laws pertaining to women’s inheritance and mar- riage. He was appointed Minister of Home Affairs in the Union Cabinet on 10 January 1955 in New Delhi by Nehru. In this position he not only contributed in the mammoth reorganisation of Indian states on a linguistic basis but also pushed for Hindi being made the official language of the government. For the distinguished con- tributions which he made to the nation, he was awarded the Bharat Ratna in 1957. This has been a matter of great pride for everyone in his home state. For, although Uttarakhand took shape as a separate state only in 2000, with his foresight Pant had already begun contem- plating multidimensional development for the moun- tainous regions long before 1947. He laid emphasis on establishment of schools, hos- pitals and banks to ensure eco- nomic and social growth in the hill towns of the erstwhile Uttar Pradesh. At the time when formal education for most women was still a remote dream, he insisted on permit- ting girls to attend schools. He also spoke against regressive customs of early marriage of girls and child labour. He him- self once said, “Let us remem- ber that it is the citizen that must count. It is the citizen that forms the base as well as the summit of the social pyramid.” No wonder today his name resonates in many education- al, environmental and medical institutions, particularly in Delhi, Uttar Pradesh and Uttarakhand.The GB Pant University of Agriculture and Technology at Pantnagar is considered to have played a vital role in India’s green revo- lution. Nehru while inaugu- rating the university in 1960, recollected Pant’s contributions with teary eyes. The Birla Vidya Mandir in Nainital which con- tinues to rank among the best Indian residential schools, was also a brainchild of Pant. In fact there is so much more which Uttarakhand owes to him. The legacy of the state is only a reflection of his great legacy. Indeed leaders with such vision of social welfare and Mukti sec- toral development are rare. It was nothing short of utter good fortune for the people of Uttarakhand as well as entire country to have had such a dis- tinguished leader, who has etched a luminous past for them. In the words of historians, he was a man with an iron will, a sobriquet which he lived until he breathed his last in 1961. Today he is a testimony of how, by a strong vision and philanthropist outlook one can change the world around him- self/ herself. (The writer is a retired civil servant. Views expressed are personal) *8(672/801 2ecZSfeVe`Z]]fdecZ`fd]VXRTj`W8`gZ_U3R]]RSYAR_e ?=BQ 347A03D= The District Legal Services Authority (DLSA) of Dehradun is all set to organise National Lok Adalat on Saturday as per the directions of the State Legal Services Authority (SLSA). The district judge and DLSA head, Pradeep Pant informed in a Press meet- ing in the civil court hall that Lok Adalats will be organised in all courts of the district on Saturday from 10 AM to 4 PM and 17 benches have already been formed to settle the cases. Informing about Lok Adalats, he said that it is a forum where cases that are pending in the courts or at the pre-litigation stage are tried to settle amica- bly. He said that the cases relat- ed to banks and debt recovery, motor accidents, electricity and water bills, land acquisitions and family disputes among others which can be settled through amicable settlements are entertained in Lok Adalats. He said that about 3,500 cases have already been referred to the benches and he appealed to the public to approach the courts to get their matter resolved through Lok Adalats. '/6$WRRUJDQLVH 1DWLRQDO/RN$GDODW ?=BQ 347A03D= The State Government has issued checks to all district magistrates for an amount of over Rs 23 crore payable to the beneficiaries registered on the web portal of the transport department. The registered eligible beneficiaries working in public transportation will receive Rs 2,000 each as monthly monetary aid by the government for the next six months. The deputy transport commissioner Sanat Kumar Singh informed that it is pro- posed that chief minister Pushkar Singh Dhami will inaugurate the programme on September 15 after which, the DMs will issue Rs 2,000 to each beneficiary through direct bank transfer. Considering this, Singh has directed all the regional trans- port officers to provide the list of all the eligible beneficiaries registered in the portal to their respective DMs by Monday. ?=BQ AA:44 The Indian Institute of Technology (IIT) Roorkee, is going to conduct its 21st annual convocation virtually on September 11. Chancellor of the University of California, San Diego Pradeep K Khosla will be the chief guest while the institute’s board of governor’s chairman BVR Mohan Reddy will be presiding over the func- tion. A total of 1,804 degrees will be awarded this year including 912 undergraduate, 685 post graduate and 207 doctorate degrees. The institute director AK Chaturvedi said, We exhort the graduating students to ded- icate themselves to the profes- sion they choose and to the society. We are happy to award degrees to 1,804 students this year.” ?=BQ 347A03D= The Municipal Corporation of Dehradun (MCD) is planning to start an anti-plas- tic campaign next week. Despite the reinstatement of the plastic ban by the State Government, there is no considerable decline in the use of single-use plastics in the city. Considering this, the corporation is planning to start an anti-plastic campaign by next week. We are very well aware of the increasing use of single-use plastics in the city but rather than imposing penalties on vendors and consumers, we will first conduct public aware- ness campaigns against plastic use. We are planning to start it next week, stated the munici- pal commissioner Abhishek Ruhela. He said that if the people are made aware of the reasons why plastic should not be used, it will motivate them more to restrict its use. However, he added that action will be taken against the offenders if they will continue to use plastics against the rules even after the aware- ness campaign. =34`Q^cd_cdQbd Q^dY`QcdYSSQ]`QYW^ 88CAc^W^[S! bc R^]e^RPcX^]^] BPcdaSPh BcPcT6^ec XbbdTb^eTa C!Ra^aTU^a QT]TUXRXPaXTb ?=BQ 270=3860A7 Haryana Chief Minister Manohar Lal Khattar on Thursday said that Universities should not become institutions only for awarding degrees, but they should also worry about placements. “Along with providing qual- ity education, moral education should also be imparted to the students so that the feeling of patriotismisinculcatedinthem,” the Chief Minister said while addressing the one-day work- shop of Vice Chancellors and Registrars of private universities across the state, chaired by GovernorBandaruDattatrayaat Haryana Raj Bhavan here. The Chief Minister said that Haryana Government is taking several steps to improve the quality of education. The online transfer policy of teach- ers is also a big step taken in this direction. Teachers have got lot of benefits from this policy, he said. Khattar said that the Super 100 programme is proving to be a boon for many aspiring can- didates appearing for competi- tive exams. The programme wasinitiallystartedattwoplaces in which 72 and 23 students of poor families successfully got admission in medical and IITs respectively after getting coach- ing. Now, expanding this pro- gramme further, it has been decided to start the Super 100 programme at four more places, he said. The Chief Minister said that the State Government is leaving no stone unturned in the field of education. Establishing new University in every district is the utmost pri- ority of the State Government, so as to ensure that students do not have to travel long dis- tances for higher education, he said. He said that the State Government is continuously working to open new institutes for higher education. Under the new education policy, two uni- versities have started work of imparting education under the KG-to-PG programme. This programme will be further expanded in future, he said. The Chief Minister also called upon the education- ists present in the workshop to empha- size on imparting moral education as inculcating moral values in children can certainly play a pivotal role in curb- ing crime and cor- ruption. D]XeTabXchbW^d[Sf^aahPQ^dcbcdST]cbcX[[cWTXa_[PRTT]cbPhb7PahP]P2 ?=B Q 270=3860A7 Farmer bodies protesting the Centre’s agriculture laws have called a meeting of polit- ical parties on Friday to press them not to carry out elec- tioneering till the Punjab Assembly polls are announced. The BJP has not been called for the meeting. The Punjab Assembly polls are due early next year. Confirming it, Jamhoori Kisan Sabha general secretary Kulwant Singh Sandhu on Thursday said farmer bodies have convened a meeting of all political parties here on Friday. He said the BJP, which supported the three farm laws, has not been invit- ed to the meeting. He said rep- resentatives of political parties will be asked not to indulge in electioneering or hold political rallies till the elections are announced as it could hurt the ongoing farmer struggle. The Shiromani Akali Dal on Thursday said party presi- dent Sukhbir Singh Badal has deputed Balwinder Singh Bhundar, Prem Singh Chandumajra, Mahesh Inder Singh Grewal and Daljit Singh Cheema to participate in the meeting. Aam Aadmi Party MLA Kultar Singh Sandhwan said party representatives will participate in the meeting called by farmer bodies on Friday. Bc^_T[TRcX^]TTaX]VU^a]^fUPa Q^SXTbc^PbZ_^[XcXRP[_PacXTb^U?d]YPQ ?=BQ 270=3860A7 Haryana Home Minister Anil Vij on Thursday offered to conduct an “impartial inquiry” into the August 28 lathi charge on farmers in Karnal as the farmers’ unions continued their protest outside Karnal mini-secretariat for the third consecutive day over their demands. Vij said that the State Government is ready to accept the genuine demands of farmers. We are ready to get an “impartial inquiry” conducted in the entire Karnal incident on August 28 and not only into the allega- tions against an IAS officer, he said. After conducting the inquiry, whosoever is found guilty, action will be taken against them. Whether it’s an IAS officer or the farmers, the government will take strict action against the guilty, Vij said. On farmers’ demand of taking action against the then Karnal SDM Ayush Sinha, the Minister made it clear that nobody can be hanged without a probe just because someone demands it. “We cannot hang anyone because someone says so. Is the country's IPC (Indian Penal Code) different and the farmers' IPC different? It cannot be like this and pun- ishment is always given as per the offence committed. To find out the offence, a probe has to be conducted,” he added. The Samyukt Kisan Morcha has however con- demned Vij’s statement for allegedly threatening to take action against farmers. In a statement issued, the SKM said, “The Haryana government has been exposed for its anti-farmer agenda. It tried to disrupt the farm movement from the very beginning and has filed numerous cases against farm- ers and farm leaders. Yet, it promotes and supports the officer who ordered the breaking heads of farmers and refuses to take action against him.” The SKM will be holding a meeting on September 11 in Karnal to decide the future course of action. Farmers’ leader Gurnam Singh Chaduni said that the protest will continue at Karnal till their demands are accepted by the government. 5PaTabR^]cX]dT_a^cTbcU^acWXaSSPh*EXY^UUTab ³X_PacXP[_a^QT´X]c^0dVdbc!':Pa]P[T_Xb^ST 3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO$UHD'HKUDGXQ 8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH) 6HFWRU12,'$*DXWDP%XGK1DJDU83 3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
- 3. dccPaPZWP]S 347A03D=k5A830H kB4?C414A !! DQGLG1RWHV 1h6PYT]SaPBX]VW=TVX ?A8B4B60;A4 FXcW2WXTUX]XbcTa?dbWZPaBX]VW3WPXb[^VVX]VXc^dcc^PZTcWT ^bc^dc^UcWT[XXcTScXTWT fPbVXeT]c^_[PhPccWT_^[XcXRP[ RaTPbT^UDccPaPZWP]Sb^_bPaT aPX]X]VX]cWT7XP[PhP]bcPcT SdaX]VcWT^]V^X]V^]b^^] _TaX^S8UX_[TT]cTSX]f^aS P]Sb_XaXccWTbT_aTT[TRcX^] _a^XbTbP]S_PRZPVTbSXaTRcTSc^ ZTT_SXUUTaT]cbTRcX^]bX]V^^S Wd^daPaTQ^d]Sc^RaTPcTP VP_X]VW^[TX]P]P[aTPShcPccTaTS _^RZTc^UcWTbcPcT0XS d][TPbWX]V^UcWTbTb^_bQhcWT V^eTa]T]cP]S_[TcW^aP^U_^_d[Xbc_a^XbTbfWXRWX]R[dSTUaTT T[TRcaXRXchP]S^cWTabPSTQhcWT^__^bXcX^]]^^]TXbVXeX]VP]X^cP^U cW^dVWcc^cWTUPRccWPccWTbcPcTf^d[SQTST_aXeTS^UcWTP[[X_^acP]c 6BCR^_T]bPcX^]VXeT]QhcWTd]X^]V^eTa]T]cUa^]TgchTPa0UXeT hTPacXTb[^cfPbVXeT]QhcWTd]X^]V^eTa]T]cc^cWTbcPcTbc^ VT]TaPcTcWTXa^f]aTb^daRTbP]SXcWPSPSTcWT_a^eXbX^]^U R^_T]bPcX]VcWT[^bbX]RdaaTSQhcWTbcPcTbU^aX_[TT]cX]VcWT6BC aTVXT5^aDccPaPZWP]ScWXbR^_T]bPcX^]R^]bcXcdcTbP[X^]bbWPaT^U XcbaTeT]dTQ[XeX^db^UcWXbV[PaX]VUPRccWT[TPSTab^UcWTbcPcTPaTQdbh _[PhX]VcWTVPT^U_^[XcXRP[QaX]ZP]bWX_P]ScahX]VWPaSc^^dcbPac ^]TP]^cWTaX]PZX]V_a^XbTb ?0C4A=0;20A4 CWTb^]bP]SSPdVWcTab^UcWTWXVWP]SXVWchWPeTc^_PhP_aXRTU^a cWTXaVT]TbPbcWTXaPRcX^]bPaTP[fPhbd]STa_dQ[XRbRadcX]hP]hcXTb cWXbbRadcX]hXbb^X]cT]bTcWPcXcXbSXUUXRd[cU^acWTXaWXVW_a^UX[T_PaT]cbc^ dbTcWTXaX]U[dT]RTU^acWTQT]TUXc^UcWTXafPaSb8]^]TbdRWRPbTP] X]U[dT]cXP[[TPSTa^UcWTbPUUa^]_PachW^[SX]VPR^]bcXcdcX^]P[_^bXcX^]X] cWT7XP[PhP]bcPcTXbUX]SX]VXcSXUUXRd[cc^bTcc[TWXbb^]fW^RdaX^db[h W^[SbPb_TRXP[PUUX]XchU^aPY^QPbb^RXPcTSfXcWcWTV^eTa]T]c7TfPb UXabcaTRadXcTSX]PV^eTa]T]cST_PacT]ccWa^dVWcWT^UUXRXP[P]_^fTa bd__[hX]VPVT]Rhbd__^bTS[hTP]cc^RaTPcTY^Q^__^acd]XcXTbU^acWTTg bTaeXRTT]P]ScWTXafPaSbQdcfWT]cWX]VbQTRPT_dQ[XRPWPbch aTcaTPcfPbPST=^ffWT]cWT]PT^UcWXbQ^hU^d]SP_[PRTX]cWT [Xbc^UPSeXb^abc^cWT2®cW^dVWcWT]PT^UcWTUPcWTafPb[TUcQ[P]Z X]cWT[Xbc^QYTRcX^]bPVPX]fTaTaPXbTSP]ScWT^aSTaU^acWTP__^X]cT]c ^UcWT_^^ab^]^U=TcPYXfPbfXcWSaPf];XUTXbb^TcXTbSXUUXRd[cTeT] U^aT]cXc[TSZXSb CAD42;DAB FXcWcWTRadRXP[PbbTQ[hT[TRcX^]bSaPfX]V]TPaTaX]DccPaPZWP]ScWT _^[XcXRP[RWPT[T^]bX]DccPaPZWP]SWPeTbcPacTSbW^fX]VcWTXacadT R^[^dabCWa^fX]VcWTXaXST^[^VXTbc^cWTfX]ScWTbT_^[XcXRXP]bPaT]^f fTXVWX]VcWTXa^_cX^]beTahRPaTUd[[hP]ScWTVPT^UcWaTPcT]X]V R^TaRX^]VP]VX]Vd_P]SbWPZX]VWP]SbfXcW]Tf_Pac]TabWPbbcPacTS FWX[T7PaXbWAPfPcbdRRTTSTSX]]TccX]VX]P_a^X]T]c[TPSTafXcWABB QPRZVa^d]SU^acWT2^]VaTbb_PachcWTad[X]V19?WPSP_aXiTSRPcRWX] U^a^UWTPehfTXVWc?aXcPBX]VW?P]fPaCWT[TPSTab^UcWT2^]VaTbb QPRZVa^d]SfXcWX]cWTbPUUa^]_Pachc^^WPeTbcPacTSbX]VX]VX]aTQT[[X^db c^]TbfXcWAPX_da;0DTbWBWPaP:Pd^_T][hPbbTacX]VcWPcXUWTXb R^]cX]dTSc^QT]XVV[TSUdacWTaWTf^d[ScPZTPSTRXbX^]PUcTaR^]bd[cX]V cWX]VbfXcWWXbVa^d_aTPSU^aTa2^]VaTbbT]X]bXST19?FXcW:Pd UX]SX]V^_T]bd__^ac^U2PQX]TcX]XbcTab7PaPZBX]VWAPfPcP]SBPc_P[ PWPaPPicWT_^[XcXRP[RPd[Sa^]X]cWTbcPcTR^]cX]dTbc^bXTa ?=BQ 347A03D= The Uttarakhand Government has decided to provide an incentive for the electric vehicles in the State. Making a declaration regarding this during a webinar organised on the occasion of the Himalaya Day on Thursday the Chief Minister Pushkar Singh Dhami said that the incentive would be provided to first one thousand four wheelers and five thousand two wheelers by the pollution control board for reducing the air pollution. He said that for two wheelers an incentive of 10 per cent of the vehicle price or Rs 7500 whichever is less would be provided. Similarly for four wheelers this incentive would be the lower of Rs 50,000 or five per cent of the vehicle price. The incentive would be trans- ferred into the account of either the dealer or bank in form of the back ended subsidy. The CM also announced that electric surcharge would be waived off for a period of two years for setting up the charg- ing stations for the electric vehicles. However this benefit would be given to the first 250 charging stations only and for it they should have approval of the local urban body. Speaking on the occasion, the CM said that everyone should take responsibility for protecting the Himalaya and environment. He added that the government is planning to organise a convention of Himalayan states for the pur- pose. Emphasising on the need for maintaining a balance between development and environment, Dhami said that Himalaya is both our her- itage and the future. He added that emphasis on sustainable development should be made for our future generations. Dhami added that the Uttarakhand Government would give ‘Sundar Lal Bahuguna environment pro- tection award in the memory of the famous environmental- ist. Cabinet Minister Ganesh Joshi said that the Himalaya is the sentinel of India and it also provides valuable herbs. He said that conservation of Himalayas should be included in the school syllabus. Environmentalist Anil Joshi said that awareness has increased in the society for protecting the Himalayas. He suggested that a state plan should be formulated linking ecology and economics. The additional chief sec- retary Anand Bardhan said work on setting up an envi- ronment plan at state and dis- trict level is being done. The CM also released a book com- piled by Himalaya United Mission (HUM) on Himalaya Day on the occasion. 9Z^R]RjR5Rj+4UVT]RcVdZ_TV_eZgVW`cVgVYZT]Vd 4[TRcaXRXchbdaRWPaVT c^QTfPXeTS^UUU^a cf^hTPabU^a X]bcP[[X]VRWPaVX]V bcPcX^]U^aT[TRcaXR eTWXR[Tb ?=BQ 347A03D= In order to prevent any loss in recovering taxes from trans- port corporations of other states and to avoid any tech- nical anomalies in the data, the transport department will adopt a new working plan. After the stringent directions of transport secretary Ranjit Sinha last week, the officials of transport offices have been calculating collected tax rev- enue and tax arrears on the buses of other transport cor- porations. The regional trans- port officer (administration) Dinesh Chandra Pathoi dis- closed that various reports and figures are being analysed by the officials to determine the tax situation of the depart- ment. He said that on the basis of data provided by the transport corporation, the offi- cials found out that many cor- porations from other states are yet to pay taxes to the department here. He said that the department is working to recover the tax arrears in other states. He also revealed that some vehicles are also operat- ing from multiple depots instead of only one and many are entering into the state through different routes which is also affecting tax collection records. Besides this, many vehicles listed in the corporation's record are registered as bikes, trucks, ambulances among other vehicles rather than buses possibly due to a tech- nical error, informed Pathoi. He said that the department will soon adopt a new working plan to prevent such discrep- ancies and revenue loss to the state. 7UDQVSRUWGHSDUWPHQW WRDGRSWQHZSODQWR SUHYHQWGLVFUHSDQFLHV ?=BQ 347A03D= The State health department reported only 16 new cases of the novel Coronavirus (Covid-19) and 26 recoveries from the disease on Thursday. No death from the disease was reported on the day in the state. The cumulative count of Covid-19 patients in the state is now at 3,43,167 while a total of 3,29,387 patients have recovered from the disease so far. In the state, 7389 people have lost their lives to Covid -19 till date. The recovery per- centage from the disease is at 95.98 while the sample posi- tivity rate on Wednesday was 0.08 per cent. The state health depart- ment reported four new patients of Covid -19 from Champawat and Haridwar, two each from Chamoli and Nainital and one each from Bageshwar, Dehradun, Pauri and Udham Singh Nagar on Thursday. No new cases were report- ed from Almora, Pithoragarh, Rudraprayag, Tehri and Uttarkashi districts on the day. The state now has 331 active cases of Covid-19. Dehradun with 157 cases is at the top of the table of active cases while Chamoli has 29 active cases. Tehri district has only one active case of the dis- ease. In the ongoing vaccina- tion drive, 68,636 people were vaccinated in 1149 sessions in the state held on Thursday. As per the data of the state health department 69,12,695 people in the state have received the first dose of vac- cine while 22,80,450 have received both doses of the vac- cine. 2^eXS () % ]TfRPbTb!% aTR^eTaXTbX] D³ZWP]S
- 4. ]PcX^]# 347A03D=k5A830H kB4?C414A !! ?=BQ =4F34;78 Union Civil Aviation Minister Jyotiraditya Scindia on Thursday announced a 100-day (from August 30 to November 30) ambitious roadmap to improve the aviation infrastructure in India. Under the plan, four new airports at Agartala, Kushinagar, Jewar in Greater Noida, and a second terminal building at Dehradun — will be constructed in the next 100 days. Six heliports and com- missioning of 50 new com- mercial routes under the Udan scheme too are part of the plan. Addressing a press confer- ence, Scindia said the Centre has allocated C255 crore to make Kushinagar airport in Uttar Pradesh operational and landing and take-off of Airbus 321 Boeing 737 flights. “Kushinagar will become the focal point of Buddhist tourism circuit,” he said. Once this airport begins operating international flights, it will become third function- al international facility in the state. At present, two interna- tional airports — Chaudhary Charan Singh International Airport at Lucknow and Lal Bahadur Shastri International Airport at Varanasi — are operational in the state while another one is coming up at Jewar in Gautambudh Nagar. The minister said a new terminal will come up at Dehradun airport in Uttarakhand, to facilitate pas- senger capacity from the exist- ing 250 to 1,800 after the Centre pumped in C457 crore for its upgradation. He also said that Agartala airport will also be upgraded to increase its capacity from 500 passengers per hour to 1,200 per hour at an estimated cost of Rs 490 crore. He said a new airport at Jewar in Uttar Pradesh will come up and the government has earmaked C30,000 crore for it. The airport is expected to have a capacity of two crore passengers every year. Out of the 50 new routes under UDAN, 30 new routes will be launched by October, the minister said. Of the 30 new routes, Alliance Air will launch six new routes, IndiGo and SpiceJet will launch four new routes each. In addition, Big Charter and Star Air will launch eight new routes each. The minister said he has set infrastructure and policy tar- gets which will be implement- ed by November 30. Scindia confirmed that 50 new routes will be launched under the cen- tre’s regional connectivity scheme Udan. The minister also said that the probe report on the plane crash at Kozhikode airport last year will be made public in the next couple of days. As the Government moves ahead with Air India disin- vestment, Scindia said the deadline for submission of financial bids will be September 15, indicating that there will be no extension for submitting the bids. While he announced a new policy for Maintenance, Repair and Overhaul (MRO) activities, he asked for VAT on ATF (Air Turbine Fuel) to be rationalised within the range of 1-4%. ATF price is a key component that has a bearing on the operating cost of airlines Scindia also said the probe report of the plane crash at Kozhikode airport last year has been submitted to the civil aviation ministry. The Aircraft Accident Investigation Bureau (AAIB) probed the accident. D]X^]X]XbcTaU^a2XeX[0eXPcX^]9h^cXaPSXchPBRX]SXPPSSaTbbTbP?aTbb R^]UTaT]RT^]PX]cT]P]RTAT_PXaP]S_TaPcX^]bA´b5[hX]VCaPX]X]V aVP]XbPcX^]5CP]S SPhbcPaVTc^UcWTX]XbcahX]=Tf3T[WX^]CWdabSPh A0=90=38A8C74?8=44A ?=BQ =4F34;78 Strengthening security and achieving self-reliance is a necessity in the face of uncer- tainty across the globe includ- ing Afghanistan, Defence Minister Rajnath Singh said on Thursday. He made these observa- tions after presiding over the induction ceremony of indige- nously designed and devel- oped medium range surface to air missile(MRSAM)into the IAF at Jaisalmer, Rajasthan. Underlining the need for self-reliance, Rajnath said, “Whether it is South China Sea, Indian Ocean region, Indo- Pacific region or Central Asia, we can see uncertainty every- where. The current develop- ments in Afghanistan are one such example,” he said. Cautioning that the global scenario is changing very quickly and in an unexpected way, the minister said the equa- tions between the nations are also changing quickly as per their interests. He said the changing geopolitics is affect- ing trade, economy, as well as the current security scenario. “In such a situation, the strength of our security and our self-reliance is not an achievement, but a necessity.” As regards manufacturing weapon systems, Rajnath said from being tagged as number one defence importer in the world, India today is supplying defence systems and sub-sys- tems to foreign countries and it is something worth to be proud of. The MRSAM (IAF) is an advanced network centric com- bat Air Defence System devel- oped jointly by Defence Research and Development Organisation (DRDO) and Israel Aerospace Industries (IAI) in collaboration with the Indian industry comprising of private and public sectors including MSMEs. Terming the production of the MRSAM as a “game changer in the air-defence- system,” Rajnath reiterated the government’s resolve to strengthen the security infra- structure of the country to deal with any challenges aris- ing out of the rapidly changing global strategic scenario. Rajnath also reaffirmed the government’s commitment to bolster the technological base through indigenous research, design and develop- ment, with focus on ‘Make in India, ‘Make for the world’. The minister described the development of MRSAM sys- tem as a shining example of the close partnership between India and Israel, adding that handing over of the system to IAF has taken this decades-old friendship to greater heights. It has played an important role in strengthening the defence industrial base of India and Israel, he added. ?=BQ =4F34;78 Signifying the growing defence and strategic ties between India and Australia, the two countries will hold the first 2+2 dialogue here for two days starting Friday. Defence Minister Rajnath Singh and External Affairs Minister S Jaishankar will hold parleys with their Australian counter- parts Peter Dutton and Marise Payne. The dialogue comes at a time when the navies of the two countries are involved in a highly complex naval drill off the Australian coast. Moreover, the two navies, along with the US and Japanese navies some weeks back, took part in the Malabar series of exercises in the Western Pacific. Australian Navy also took part in the Malabar series of exercise off the Indian coast last year underlining the growing rela- tions between the Quad nations comprising these four nations. Giving details of the forth- coming dialogue, the external affairs ministry(MEA) said here on Thursday, the parleys on September 11 will cover a range of bilateral, regional and global issues of mutual interest. People familiar with the preparations for the dialogue said the two sides are expect- ed to focus extensively on fur- ther ramping up the overall defence and security ties and boost strategic cooperation in the Indo-Pacific region. China has all along opposed the Quad exercises claiming this will lead to militarization of the area. China is flexing its mar- itime muscle there. “The inaugural 2+2 min- isterial dialogue is being held pursuant to the elevation of India-Australia bilateral rela- tions to comprehensive strate- gic partnership during the India-Australia leaders’ virtu- al summit on June 4, 2020,” the MEA said in a statement. “The agenda for the Dialogue will cover a range of bilateral, regional and global issues of mutual interest,” it said. The focus of the talks at the two-plus-two dialogue is expected to be on boosting overall cooperation in the Indo-Pacific in the face of China’s growing military assertiveness in the region, the people cited above said. Expanding bilateral coop- eration in areas of maritime security is expected to be another area of focus at the two-plus-two dialogue, sources said here. The two-plus-two dialogue between the foreign and defence ministers was institut- ed as part of an overall goal to expand strategic cooperation between the two countries. The defence and military cooperation between India and Australia is on an upswing in the last few years. In June last year, India and Australia ele- vated their ties to a compre- hensive strategic partnership and signed a landmark deal for reciprocal access to military bases for logistics support dur- ing the online summit between Prime Minister Narendra Modi and his Australian counterpart Scott Morrison. %ROVWHULQJVHFXULW QHHGRIKRXULQIDFHRI $IXQFHUWDLQW5DMQDWK CWTcf^_[dbcf^ SXP[^VdTQTcfTT] cWTU^aTXV]P]S STUT]RT X]XbcTabfPb X]bcXcdcTSPb_Pac ^UP]^eTaP[[V^P[ c^Tg_P]S bcaPcTVXR R^^_TaPcX^] QTcfTT]cWTcf^ R^d]caXTb ?=BQ =4F34;78 The Election Commission (EC) on Thursday announced bypolls for six Rajya Sabha seats that have fall- en vacant due to various rea- sons. Except for Puducherry, four Rajya Sabha seats fell vacant after the resignation of members due to various rea- sons while the representative from Maharashtra, Rajeev Satav, passed away in May due to post-Covid complications. According to the EC, two seats from Tamil Nadu and one each from West Bengal, Assam, Madhya Pradesh and Maharashtra will go to the polls on October 4. In addition, bypoll for a Bihar legislative council seat has also been scheduled for the same day. According to the EC, the counting of votes will take place on the same day. The Madhya Pradesh Rajya Sabha (RS) seat got vacant after BJP leader and former Union cabinet minister Thawar Chand Gehlot was elevated as the Karnataka Governor in July. The two seats in Tamil Nadu fell vacant due to the res- ignation of AIADMK leaders K P Munusamy and R Vaithilingam who are now members of the Tamil Nadu legislative assembly.The West Bengal Rajya Sabha seat fell vacant after resignation of TMC leader and cabinet min- ister in West Bengal govern- ment Manas Ranjan Bhunia. In Assam, the seat held by assembly speaker Biswajit Daimary fell vacant after he resigned from the membership of the upper house of Parliament and his earlier party, the Bodoland People’s Front, and joined the BJP before the recent polls in the state. The BJP may field Union minister Sarbananda Sonowal from the Assam seat as he is yet to become a member of either house of Parliament. The Maharashtra seat got vacant due to the death of Congress leader Rajeev Satav in May this year due to Covid-19 infection. In Puducherry, the RS seat will fall vacant soon as the term of incumbent member N Gokulakrishnan ends on October 6. The EC said in its order that all “broad guidelines of Covid- 19” have to be followed during the election process that is from the time of issue of notification to the counting of votes. “The chief secretaries of states con- cerned are being directed to depute a senior officer from the state to ensure that the extant instructions regarding Covid-19 containment measures are com- plied with while making arrangements for conducting the election,” the EC said. CWTPWPaPbWcaP bTPcV^cePRP]c SdTc^cWTSTPcW^U 2^]VaTbb[TPSTa APYTTeBPcPe ?=BQ =4F34;78 Seeking to expedite the con- struction of the ambitious Mumbai-Ahmedabad Bullet Train project, Railway Minister Ashwini Vaishnaw on Thursday launched major heavy and modern mechanical equipments like Straddle car- rier and the Girder transporter to help the faster casting of the viaduct. This will expedite con- struction of high speed railway, as it is the proven technology in metro and similar projects. Work has already begun on 325 km (in Gujarat state) out of 508 km corridor between Mumbai and Ahmedabad undertaken by the National High Speed Rail Corridor, a unit of Indian Railways. Vaishnaw said if the nation has to achieve results of 21st century then we have to adopt a mindset of 21st century. “This Straddle carrier and the Girder transporter is a very good example of 21st century mindset...” he said dur- ing the launch event and men- tioned India is now coming in the select group of country like Italy, Norway, Korea, and China which have been design- ing and manufacturing such equipment. Straddle carrier equipment is designed to handle the Full Span Precast girders from cast- ing bed to stacking yard and further feeding them to Bridge Gantry for further erection. This is a tyre mounted self- propelled gantry crane having lifting capacity of 1100MT. Girder Transporter is designed to transport the Full Span precast girders fed by Bridge Gantry to erection loca- tion.This is 27 axle tyre mount- ed self-propelled trolley of car- rying capacity of 1100MT. The other key dignitaries present at the launch ceremo- ny were Miyamoto Shingo, Minister, Embassy of Japan, Suneet Sharma, Chairman CEO, Railway Board, Satish Agnihotri, MD, NHSRCL and others. Addressing the gathering, Vaishnaw stated that to encour- age Aatma Nirbhar Bharat Abhiyan initiative, full span launching equipment of 1100MT capacity is indige- nously designed. More than 97 percent land has been acquired for the pro- ject in Gujarat and Dadra Nagar Haveli and 30 percent land in Maharashtra. This pro- ject will improve skillset in var- ious rail construction tech- nologies. Japanese counter- parts will provide training to National High Speed Rail Corporation Limited employ- ees and also to contractors. More than 6,000 workers are already working at various construction sites for the pro- ject, thus creating employment opportunities for the local youth, informed the Rail Minister. He further stated that the Mumbai Ahmedabad High Speed Rail project expected to create more than 90,000 jobs in this area including 51,000 jobs for technicians, skilled and unskilled workers.This project will boost the overall economy of the area by deploy- ing 1000s of trucks, dumpers, excavators, batching plants, tunneling equipment and so on. For the construction of viaduct superstructures of 508 km long, Mumbai-Ahmedabad High-Speed Rail Project (MAHSR), the State-of-the- Art construction methodolo- gies like Full Span Launching Methodology (FSLM) will be adopted. This technology will expedite the process of launch- ing girders as the precast gird- ers of full span length will be erected as a single piece for double track viaduct. BcaPSS[TRPaaXTa6XaSTacaP]b_^acTac^WT[_UPbcTa TgTRdcX^]^UdQPX0WTSPQPS1d[[TcCaPX]_a^YTRc ?C8Q =4F34;78 The Supreme Court on Thursday dis- missed a plea seeking directions to fill vacant posts at the National Human Rights Commission (NHRC). A bench headed by Justice L Nageswara Rao noted that former apex court judge Justice Arun Mishra has been appointed as the chairperson of the National Human Rights Commission. “In view of subse- quent events of appointment of chair- man and members this petition has become infructuous,” the bench also comprising Justice B R Gavai said. During the brief hearing, the petitioner told the bench that chairperson and mem- bers have been appoint- ed and only two posts are lying vacant. The apex court then asked, “Chairperson has been appointed, why should we keep it pending. The matter has become infructuous.” The top court was hearing a plea filed by lawyer Radhakant Tripathi seeking a direction to fill vacant posts at the National Human Rights Commission. Justice Mishra is also the first non-CJI to be appointed to the NHRC chief post since the amendment of the Protection of Human Rights Act in 2019. The post of NHRC chairperson was lying vacant after Justice H L Dattu, a former Chief Justice of India (CJI), completed his tenure in December last year. Rajiv Jain, former director of the Intelligence Bureau, and justice M M Kumar, former chief justice of the Jammu and Kashmir High Court have also joined as members of the commission. 3OHDVHHNLQJ ILOOLQJRI YDFDQW1+5 SRVWVMXQNHG ?=BQ =4F34;78 Amidskyrocketingedibleoils prices, the Centre has asked States to take disclosures of stock of edible oilseeds and oils withthemillersandstockistsand review weekly monitoring of pricestocheckhoardingsandto ensuretransparencyintheavail- abilityofedibleoilsandoilseeds. A high level meeting of the ministry of food is expected on Friday.Officialssaidthatdespite reduction in the import duty, a sudden surge in the prices have been observed, which may be duetohoardingsbythestockist. Inalettertochiefsecretaries, Principal Secretaries and Commissioners Food and Civil Supplies of states and union territories, Ministry of Food and Consumer Affairs’ eco- nomic advisor Manisha Sen Sarma has asked states govern- ment to direct stockholders- millers, traders, refiners and wholesalers to declare stocks of edible oils and oilseeds and the same should be verified by the states to keep prices under con- trol. “This is not a stock limita- tion order of any kind,” officials added. Asperthedatasharedbythe ministry of consumer affairs a few days back, the average monthly retail prices ofground- nut oil increased by 19.24 % in July over the same month last year. BcPcTbc^[Sc^ SXbR[^bTbc^RZ^U TSXQ[T^X[bTTSb ?=BQ =4F34;78 Amid demands to ensure vaccination of children before the reopening of schools in the country, the Government on Thursday said there is nei- ther any scientific validation for such conditions nor any WHO recommendation for it. But, it said, it is actively working for the scientific validation of vac- cines for potential use in chil- dren. Niti Aayog Member (Health) Dr. VK Paul said this criterion (vaccinating children for reopening schools) was not acceptable anywhere in the world. “Vaccinating children is not a condition for reopening schools. This criterion is not acceptable anywhere in the world, no scientific body, epi- demiological evidence suggests it as a condition...However, vaccination of staff is desirable,” Dr. Paul said at a press confer- ence of the Union Health Ministry on Thursday. Dr. Paul said the govern- ment is “actively working” in the direction of scientific vali- dation of the vaccines for potential use in children. Only a few nations have introduced vaccination for chil- dren, no WHO recommenda- tion for it...Govt is working actively in direction of scientific validation of our vaccines for potential use in children. =^bRXT]cXUXR bd__^acc^ X]^Rd[PcTP[[ZXSb ?=BQ =4F34;78 Union Home Minister Amit Shah on Thursday chaired a high level review meeting on the security situation in Jammu and Kashmir and development projects being implemented. Lieutenant Governor of Jammu and Kashmir Manoj Sinha, NSA Ajit Doval, Army Chief General M M Naravane, Union Home Secretary Ajay Bhalla, Director of Intelligence Bureau Arvinda Kumar, RAW chief Samant Goel, BSF DG Pankaj Singh and CRPF chief Kuldip Singh attended the meeting. The meeting is believed to have discussed about the polit- ical and security implications in the Kashmir valley following the death of hardline Hurriyat Conference chairman Syed Ali Shah Geelani and latest situation in Afghanistan. There have been reports that Pakistan- based terror groups Jaish-e- Mohammad and Lashkar-e- Taiba -- both active in Jammu and Kashmir and involved in a large number of terror attacks in the past — have shifted their bases to Afghanistan with a friendly Taliban regime in place. The Home Minister reviewed the security situation in Jammu and Kashmir and steps being taken to check infil- tration from across the border and maintain peace in the union territory, official sources said. BTRdaXch^U 9:bRP]]TS ?=BQ =4F34;78 With the Covid caseload crossing over 40,000 and country’s 35 districts still report- ing weekly positivity rate of over 10 percent and 30 districts between 5-10 per cent, the Government on Thursday asserted that the second wave is not yet over in many regions and people should observe a low key celebration of the upcom- ing festivals, that too, at homes. The Centre asked the States to increase the pace of vaccination with special focus on vaccinat- ing the vulnerable population. The warning comes as Kerala witnesses a surge of infections from its recent cele- bration of its biggest festival, Onam, which also marks the unofficial beginning of India’s festive season that lasts till the end of the year “People should not let their guards down as the second wave of the pandemic is yet to end. Low key celebrations of festivals should be encour- aged to avoid the spread. Responsible travel rather than revenge travel should be prac- ticed.” “People should be following all the Covid appropriate guide- lines from maintaining social and physical distance to wear- ing masks,” Union Health Secretary Rajesh Bhushan said. !]SfPeT ]^chTc^eTa bPhb6^ec !!URja]R_e`S``de RgZReZ`_dVTe`cf_gVZ]VU 8]SXPic^W^[S!!SXP[^VdT Ua^c^SPhc^bcaT]VcWT]STUcXTb 42P]]^d]RTbQh_^[[b U^a%APYhPBPQWPbTPcb
- 5. ]PcX^]$ 347A03D=k5A830H kB4?C414A !! ?8=44A=4FBB4AE824 Q 90D Six months after the vacci- nation drive began on a war footing, District Administration Samba Thursday achieved a major milestone in the journey of uni- versal Covid-19 vaccination by administering atleast one dose to 100% Adult vaccination (18+ age group) making it first in the UT of Jammu Kashmir. Lieutenant Governor of Jammu Kashmir, while con- gratulating the team Samba, including health care workers and their covid management, through official twitter account, said “Samba has achieved 100% vaccination of above 18 years of age and becomes the first dis- trict of JK to achieve this milestone and I am sure other district will catch up soon”. Deputy Commissioner Samba, Anuradha Gupta said that 320780 Covid-19 doses including 243013 as first dose have been administered to 18+ age category, Front Line work- ers and health Care workers as first covid 19 doses”. The DC Samba hailed the efforts of frontline workers and healthcare workers for putting relentless efforts in ensuring 100% coverage of 18+ age category in the district. Our next goal is to vacci- nate people with the second dose as well for their complete protection” said the DC. “We have established a covid control room in the dis- trict and are calling people a day in advance before their vac- cination becomes due. Today we held special sessions to administer the second dose to teachers, Students, Pregnant and Lactating mothers across the district” informed the DC Samba adding a camp was also held at the court Complex. Jammu: Former Congress President and Lok Sabha MP from Wayanad Rahul Gandhi Thursday offered special prayers inside the cave shrine of Mata Vaishno Devi, nestled in Trikuta hills of Reasi district. Before reaching the cave shrine, Rahul trekked 13 km long serpentine track under tight security arrangements. Rahul attracted lot of atten- tion of fellow pilgrims as he trekked uninterruptedly with- out taking too many breaks. He also interacted with fellow pilgrims during small breaks. On reaching Jammu early in the morning, Rahul Gandhi was given rousing reception at the airport by the local leaders of JK unit. From inside the airport he drove straight to the Katra base camp along with a battery of senior Congress leaders including JK unit incharge Rajani Patil and JKPCC Chief Ghulam Ahmad Mir. Along the entire route, Rahul Gandhi was greeted by upbeat party workers and local leaders. Several media teams fol- lowed him along the route and sought his comments after BJP questioned his temple politics. I have come here to offer prayers to the Mata. I don't want to make any political com- ments here, Rahul responded before embarking on a yatra near Ban Ganga, the starting point of the yatra. Rahul is scheduled to stay back at the cave shrine where he attended evening aarti. B0D60AB4=6D?C0Q :;:0C0 Aday after the Election Commission of India demanded a detailed report from the State Home Department regarding announcement of grants to different Durga Puja committees of Bengal at a time when model code of conduct was in force in the State in view of the forthcoming by-election for Bhawanipore Assembly seat the State Government on Thursday told the poll panel that it had committed no breach of model code as it was not applicable to the entire State. Chief Minister Mamata Banerjee who had lost to Opposition Leader Suvendu Adhikari in Nandigram is con- testing a by-election from the Bhawanipore seat as she has to get the elected to the House before November 6 to remain on the top seat. Instead of the Chief Minister who declares grants to the Puja committees every year, Chief Secretary HK Dwivedi had on Wednesday announced grants of C50,000 to the Puja committees leading the BJP to write a com- plaint to the ECI alleging violation of MCC. Replying to the EC query Home Secretary BP Gopalika said that there was no violation of the model code as it was not applicable to the entire State and was limited to only three con- stituencies of Rezinagar, Jangipur — both in Murshidabad district — and Bhawanipore in Kolkata where elections were being held. Besides, the Home Secretary also said that government announced the monetary grants from Netaji Indoor Stadium which was not within the Bhawanipore constituency. Meanwhile in an unrelated development the Trinamool Congress on Thursday stood by arch rival CPI(M) after its work- ers were attacked in Tripura and its party offices were torched in that State by alleged BJP workers. “It is highly condemnable … all the parties irrespective of their ideology should condemn the attacks on the CPI(M) offices … this is the kind of attack we have been referring to for the past cou- ple of months … our leaders, our workers and our offices were being attacked by the BJP. Now they are targeting the Left too … This is the culture of the BJP … we condemn this attack,” said senior Trinamool leader and Bengal Minister Partho Chatterjee. :D0A274;;0??0= Q :278 26,200 new persons were diagnosed with Covid-19 out of the 1.56 lakh samples tested in Kerala during the last 24 hours, according to Veena George, Minister for Health. In a release on Thursday, the minister said 125 persons died during the last 24 hours and this took the death toll till date in Kerala to 22,126. The Test Positivity Rate 16.69 per cent. There are 2.36 lakh patients undergoing Covid-19 treatment across the State. 114 health workers were infected with the pandemic during the last 24 hours. The Nipah virus threat that was haunting the State seems to be blowing over as 68 persons under surveil- lance tested negative on Thursday, said George. Meanwhile, the Kerala High Court came down on the State Government and the Police for the alleged indiffer- ence towards assaults on doc- tors in Government Hospitals. The court while hearing a petition filed by doctors against the callous attitude of the Police expressed shock over the reply given by the latter that 228 cases of physical assaults on doctors have been registered while only 25 cases were being probed. Judge Devan Ramachandran asked the police to take strict action against such attacks and arrange police security for the doctors. :D0A274;;0??0=Q :278 Kerala’s political skyline is in for a change though it is too early to predict when it would happen. Ice has started melting in the ties between the CPI(M) and the Muslim League. K T Jaleel, former Minister for higher education in the CPI(M)-led Government (2016-2021) has become a per- sona non grata in the party, if the comments from the top leadership are any indication. Reactions by Chief Minister Pinarayi Vijayan and party’s Kerala secretary A Vijayaraghavan expressing unhappiness over Jaleel’s com- ments against P K Kunhalikutty, the League strongman, are being seen as the party’s willingness to play ball with the Muslim League. On Monday, Jaleel, a for- mer SIMI chief, alleged that Kunhalikutty had used the A R Nagar Cooperative Bank in Malappuram district for money laundering. Jaleel charged that Kunhalikutty, a former Minister of industries in the Oommen Chandi-led UDF Government (2011 to 2016) had made use of the Cooperative Bank branch for laundering C1,100 crore which he had received as kick-backs and commissions for deals involving some of the public sector units in the State. He fur- ther stated that Kunhalikutty had also used the accounts of Chandrika (the daily owned by Muslim League) to convert unaccounted money to white . “I have handed over all rel- evant documents to the Enforcement Directorate and it is sure that they would sum- mon Kunhalikutty for grilling,” Jaleel told media persons on Thursday at Kochi after his meeting with the ED officials. He had called on Vijayan on Thursday morning for an unscheduled meeting. Jaleel said after the meeting that he had told Vijayan about the details which he would be handing over to the ED. But the stance of former SIMI leader was repudiated by Chief Minister Vijayan when the latter briefed the media on Tuesday . “There is no need for the ED to investigate transactions in Cooperative Banks. It comes under the jurisdiction of the State Government. Jaleel may have been charmed by the ED,” said Vijayan which is being seen as a snubbing to Jaleel. Jaleel had been interrogat- ed by the ED officials twice in 2020 in connection with the illegal import of Qurans, dates and other materials from UAE under the Ramadan Relief Package. It was reported that the import of Quran and other materials were a façade for smuggling gold from the UAE with the connivance of diplo- mats from the oil kingdom posted in Thiruvananthapuram. On Wednesday, V N Vasavan, minister for cooper- ation and Vijayaraghavan told reporters that Jaleel was mis- using his position to settle personal score with Kunhalikutty. “We do not sub- scribe to the views expressed by Jaleel,” said Vasavan. Chroniclers of Kerala’s political history, like P Sujathan, told this newspaper that they were not at all amused by the thaw in CPI(M)-Muslim League ties. “The Muslim League was an important ally of two CPI (M) led govrnments in the past. They were in alliance during 1967-69 when E M S Namboodirippadu was the chief minister. The CPI(M) had formed the E K Nayanar- led government in 1980 with All India Muslim League, a fac- tion of the parent party,” said Sujathan. 4A:f_YRaaj`gVc ;R]VV]dT`^^V_ed 0UPaTaWPaeTbcbQ^cc[TV^daSUa^PUPa^]cWT^dcbZXacb^U9Pd^] CWdabSPh ?C8 C=A067D=0C70Q D108 Two years after he was arrested for the first time for allegedly grabbing a plot of land belonging to the late renowned writer Mulk Raj Anand in the hill station of Khandala, incarcerated Bollywood financer-turned builder Yusuf Lakdawala died at the Arthur Road Central Jail here on Thursday, following complications arising out of cancer that he was suffering from. Seventy six-year-old Lakdawala— who had been arrested by the Economic Offences Wing (EOW) of the Mumbai police in 2019 and later taken into custody by the Enforcement Directorate (ED) early this year–had been admit- ted to jail hospital on September 6 but was declared dead immediately after his admission to the state-run J J Hospital. Confirming Ladawala’s death, DIG Prison Yogesh Desai said: “He (Lakdawala) was suffering from Cancer. On September 6, he was admitted to the prison hospital located inside the Arthur Road Central Jail. After his condition deteri- orated, he was rushed to the JJ Hospital. He died on Thursday afternoon. No foul play has been reported”. Meanwhile, the police have registered an Accidental Death Report (ADR). The cause of death has not been ascertained yet. The ED had arrested Lakdawala in May this year in a money laundering case reg- istered against him for alleged- ly forging documents to pur- chase a land worth Rs 50 crore at Khandala hill station locat- ed in Pune district. He was in judicial custody when he died. In August this year, Lakdawala’s lawyer Abhinav Chandrachud had moved the court seeking bail for his client on medical grounds to enable him to get proper treatment in a hospital. He had submitted Lakdawala’s latest medical report to the court confirming the cancer had spread to other parts of his body. On their part, Arthur Road jail authorities had in the past taken him to the Tata Memorial Cancer Hospital for a check-up on the relapse of cancer which had been cured around 12 years ago. ED counsel Hiten Venegaonkar, opposing Lakdawala’s bail, had argued that instead of granting bail, the court should direct the prison authorities to provide the necessary medical treat- ment to the accused while in custody. The prison authorities had given an undertaking to the court that they would arrange for all necessary treatment required by Lakdawala. Lakdawala, who was arrest- ed first by the EOW of the Mumbai police while trying to flee to London from Ahmedabad International Airport. He was granted bail but was rearrested in a money- laundering case registered by the ED in the same case and has been in the Arthur Road Central Jail since then. The EOW's allegation was that Lakdawala had forged documents to help him grab the huge Khandala plot of Anand, the Indian author English who passed away on September 28, 2004 for alleged- ly forging signatures on the papers dating back to 1949. Earlier in 2010, he had allegedly been booked for encroaching upon the proper- ties belonging to the late actress Sadhana at Santacruz in north- west Mumbai, but was later acquitted in the case. *UDQWVJLYHQWR3XMDFRPPLWWHHV QRYLRODWLRQRI070*RYW Lucknow: All India Majlis-e-Ittehad-ul-Muslimeen (AIMIM) president Asaduddin Owaisi charged the Bharatiya Janata Party and the Yogi Adityanath Government with persecution of Muslims, including demolition of mosque in Barabanki, and said that the Muslims would give a befitting reply to this anti-Muslim Government. “Since 2014, only Muslims have been killed in UP. It is on record that only mosques and Muslims are being targeted in UP but no political party has so far opposed it,” he said while addressing a rally in Katra locality of Barabanki on Thursday. Owaisi also raised the issue of razing of a mosque in Barabanki. Can Yogi Adityanath answer why it vio- lated the Constitution by demolishing the mosque? Muslims pleaded with folded hands that their place of worship should be spared but the administration, under the direction of Chief Minister Yogi Adityanath, razed the mosque. Not only this, the journalists who highlighted the issue were booked and an FIR was lodged against them,” the AIMIM chief said. PNS -DOHHODOOHJHGWKDW.XQKDOLNXWWKDGXVHG$51DJDU RRSHUDWLYH%DQNLQ0DODSSXUDPIRUPRQHODXQGHULQJ C=A067D=0C70Q D108 Union MSME Minister and BJP leader Narayan Rane found himself in an embarrass- ingsituationonThursday,asthe Pune Police Crime Branch issued a ‘Look Out Circular’ (LOC) against his wife Nilam Narayan Rane and MLA-son Nitesh Rane in an alleged C65 crore loan default case. The development came closeontheheelsofRane’sarrest and subsequent bail over his controversial remarks against chief minister Uddhav Thackeray. The LOC has been issued based on a complaint lodged by the DHFL with the Pune police. The LOC mentions Nilam Rane as a co-borrower of a loan amountof C25croreinthename of Artline Properties Pvt. Ltd, while MLA Nitesh N. Rane has been named as a co-borrower of aloanofRs.40croretakeninthe nameofNeelamHotelsPvt.Ltd., both companies are based in Mumbai. Both these loan accounts stand with the DHFL Mumbai.Theywereclassifiedas ‘non performing assets’ (NPAs), as per the norms of National Housing Bank and Reserve Bank of India. NilamRaneandNiteshowe an outstanding of C27,13,18,931 andC34,09,61,771respectivelyto the DHFL. The Pune Crime Branch has issued the LOCs against the mother-son Nilam andNiteshRane,totheAssistant Director, Look Out Cell, at Chhatrapati Shivaji Maharaj International Airport (CSMIA). “In the aforesaid circum- stances,thereisanapprehension and fear that the said Co-bor- rower may leave the country anytime with a malafide inten- tion to evade repayment of the loan granted by DHFL and escapethe legal actions thatmay be taken against (them) civil/criminal by the DHFL,” the LOCs stated. The LOC directed the Mumbai Airport authorities to open the LOCs, and whenever the Co-borrowers are inter- cepted at the airport, their arrival/departure it should be intimated to the Pune Police Crime Branch. Reacting to the development, Nitesh wondered as to how the Pune police issued LOCsagainsthimandhismoth- er considering that their loans and DHFL were in Mumbai. “The LOCs should also be seen in the light of the fact that we hadagreedtosettletheloans taken from the DHFL,”Nitesh said. 2ZDLVLVSDUNV IUHVKPRVTXH FRQWURYHUVLQ83 .HUDODORJV QHZRYLGFDVHV BPQP bc9: SXbcaXRcc^VXeT bc S^bTc^ 'PVTVa^d_ ;^^Zdc2XaRd[PaPVPX]bcAP]T³bfXUTb^] ;0=3450D;C20B4 5DKXO*DQGKLRIIHUSUDHUV DW9DLVKQR'HYLVKULQH %ROOZRRGILQDQFLHUWXUQHG EXLOGHUGLHVLQFXVWRG 0Ra^fSTSPaZTcPWTPS^U6P]TbW2WPcdacWXUTbcXeP[X]2WT]]PX^]CWdabSPh ?C8 0eTVTcPQ[TbT[[Taa^fbWXbQ^PcPcPU[^PcX]VfW^[TbP[TPaZTcPc3P[;PZTX]BaX]PVPa^]CWdabSPh ?C8 Aizawl: The Mizoram Government has devised strate- gies and making massive efforts to resolve the long-standing border dispute with neighbour- ingAssam,StateHomeMinister Lalchamliana told the assembly on Thursday. The State Government had in 2018 constituted a core com- mittee to study and assess the state boundary. It was re-con- stituted with chief secretary Lalnunmawia Chuaunog as the chairman in 2019, he said. The core committee is cur- rently doing research and analy- sis on the state border by col- lecting topo-sheets and impor- tant documents related to the state boundary with Assam, Lalchamliana said, replying to a queryfromCongressLegislature PartyleaderZodintluangaRalte. The State Government has already appointed a nodal offi- cer on the border issue and sub- mitted a report to the Centre as pertheUnionMinistryofHome Affairs instruction, he said. According to the home minister, the state government has also constituted a team to compile important documents, supportive of Mizoram's stand on the border issue and it will be tabled before experts from Manohar Parrikar Institute of Defence Studies when they visit the state. A boundary committee involving all political parties and NGOs, headed by Deputy Chief Minister Tawnluia, has alsobeenformedrecentlytodeal with the issue, Lalchamliana said. PTI 4UU^acb^]c^aTb^[eT Q^aSTaSXb_dcTfXcW 0bbPbPhb Xi^aPX]XbcTa
- 6. Hale, the 17th century Chief Justice of England, wrote in the ‘History of the Pleas of the Crown’: “The husband cannot be guilty of rape committed by himself upon his lawful wife, for by their mutual consent and contract, the wife hath given up herself this kind unto her husband which she cannot retract.” Upholding the traditional and cultural history, matrimo- nial jurisprudence has approved that solemnisation of marriage shall mean the unconditional and lifetime consent to sexual acts by the wife. The 15th Law Commission headed by Justice BP Jeevan Reddy, in its 172nd Report captioned ‘Review of Rape Laws’ submitted in March 2000, denied to crimi- nalise marital rape on the ground that it will be an exces- sive interference of law in marital lives of people. Further, the Parliamentary Standing Committee of Home Affairs, which examined the Criminal Law (Amendment) Bill, 2012, in the aftermath of the Delhi gang rape case, in its 167th Report in March 2013 did not recommend criminalisation of marital rape on the ground that it would have the “poten- tial of destroying the sacred institution of marriage, which is based on mutual love and trust”. In 2019, the Delhi High Court had turned down a petition seeking a declaration of marital rape as grounds for divorce. The Supreme Court, too, in the past refused to take up the issue, saying it is the domain of Parliament. However, despite the above facts, the Kerala High Court gave a new twist to this issue which will have a signif- icant impact on this sensitive matter. The Bench said: “Autonomy is now considered part of privacy and ennobled as a fundamental right.” If bodily integrity is a violation of individual autonomy, then it contradicts the provisions of Section 375 of the IPC. In contrast, the Chhattisgarh High Court on August 23, 2021, on a revision petition, discharged a 37- year-old man from the charge of matrimonial rape, saying that sex with a legally wedded wife is not rape under the IPC. The court, however, retained the charges of Section 377 for ‘unnatural sex’ and Section 498A for dowry demands. In his order, Justice NK Chandravanshi said: “In this case, the com- plainant is legally wedded wife of applicant no.1 (hus- band); therefore, sexual inter- course or any sexual act with her by the husband would not constitute an offence of rape, even if it was by force or against her wish.” The flip side of this ver- sion is that it is not only the nuptial duty of the wife to pro- vide sex to her husband but, on the contrary, it is the pri- mary duty of the husband also to provide the desired level of concupiscence to wife besides meeting her other needs such as protection, provisions, home and other domestic facilities. In many statutes applicable in India, ‘impo- tence’ of the husband is one of the major grounds for divorce sought by the wife. But frigid- ity, barrenness and adulterous ways of wives are not grounds for divorce by men. There do exist promiscuous women who say, “Yeh dil maange more”. Will there be any law to prevent such acts? (The writer is a legal journalist and author. The views expressed are personal.) ?9554E31D9?C55=C?66 Sir — A survey called School Children’s Online and Offline Learning (SCHOOL), conductedrecently,observedthatonlyeight per cent children in rural households in India attended regular online classes. The surveyonlearninggapswasconductedafter schoolsinthecountryremainedcloseddue to the COVID-19 pandemic. The survey, conductedonschoolchildreninunderpriv- ileged households in 15 States and UTs, shows that 37 per cent of children are not studyingatallandaboutonehalfareunable to read more than a few words. The report paints a dismal picture of theconditionofschooleducationafterthe pandemicinruralareasinthecountry.The surveyfoundthataschildrendidnotattend schoolsforaprolongedperiodoftime,their learningandcognitiveabilitiesweregreat- ly hampered. The report proves that pan- demic and extended lockdowns have caused enormous harm to school educa- tion, especially in rural areas. A great deal ofsustainedeffortisrequiredtorepairthis damage. Given that most of the schools in the country are still closed, setting the schooleducationrightisindeedahardtask. Unlesstheschools,especiallyprimaryand middleschools,arenotresumed,itmaybe difficult to reverse the learning gaps. Venu GS | Kollam @B9F95754@1CC575BC Sir — There are reports that certain peo- ple who are entitled to a free ‘two-passen- ger rail pass’, misuse the facility by selling the remaining one to others at a discount- edprice.TheRailwayBoardshoulddevise mechanismstopreventsuchmisuse.Itcan be made compulsory to submit ID proofs of the entitled one and the accompanying companion with signatures while getting freerailpasses.OriginalIDproofsbyboth theentitledpersonandtheaccompanying companionshouldbemadecompulsoryto be carried while travelling. Facility of free railpassshouldbewithdrawnimmediate- ly, if found being misused. Additionally, the parliamentarians should be reimbursed for rail travels only onsubmittingproofofactualrailtravelver- ified by the TTEs to avoid multiple reser- vationsindifferenttrainsforasinglejour- ney. The cost of unavailed reserved rail- berths or seats should be deducted from their salaries or pensions, if found at fault. Freeentitlementofrailtravel,includingfor the parliamentarians and those travelling atGovernmentexpense,includingforthose inpublicsectorundertakings,shouldonly be for two-tier airconditioned rail travel rather than for first-class airconditioned class or above. Madhu Agrawal | Delhi ´299?9DB5µ=9;=1?69491 Sir — Operation Flood, also known as the White Revolution, made India self-suffi- cient in milk production and it was achieved entirely through the cooperative structure. Dr Verghese Kurien is known as the ‘Father of the White Revolution’ in India. The revolution is associated with a sharp increase in milk production. Today, around 12 million farmers in more than 22 States across the country own around 250 dairy plants, handling around 20 mil- lion litres of milk a day. This is a remark- able achievement. While we in India tend to take our achievements for granted, this feat elicited high praise and admiration throughout the world. In 1955, our but- terimportswere500tonneperyear;today, ourcooperativesaloneproducemorethan 12,000 tonne of butter. By 1975, all imports of milk and milk products stopped. The import permitted wasthatoffoodaidunderOperationFlood. A separate agency called the Indian Dairy Corporation (IDC) was created to receive grants of food aid and use it in the Operation Flood; this agency was headed by Verghese Kurien. Any conversation around milk cannot ignore the contribu- tions of Verghese Kurien, famously called ‘theMilkmanofIndia’aswellasthe‘Father of White Revolution’. Every year on the World Milk Day, Indians fondly remem- ber Kurien for his contribution. Jayanthy Subramaniam | Trichur A 2 A 6 C H : E 9 A 2 D D : @ ? gggTQYi`Y_^UUbS_] UPRTQ^^ZR^SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaPR^SPX[h_X^]TTa 347A03D=k5A830H kB4?C414A !! % BT]Sh h^daU UTTSQPRZc c^) [TccTabc^_X^]TTa/VPX[R^ 8cS^Tb]cPZTV^^SbT]bTc^U^aRXQ[hPZTP]SX_^bT[Pfb_d]XbWX]V ²PaXcP[aP_TfWT]cWT]TTS^UcWTW^dabW^d[SQTc^TSdRPcTb^RXTch C74A48B0BCA=6 ?BB818;8CH5 E4BC438=C4A4BCB ?AC8=6BD27 ==8BBD4B8C70B 144=1B4AE43 C70C0B38554A4=C F0C274B2;2:B 68E4B;867C;H 38554A4=CC88=6B =C74B04 B20;438554A4=C 2DACB68E4 E0A84338E4A64=C 0=30CC84B 2=CA0382CAH 9D364=CB ;4CC4AB CC C74438CA 81C1:7DAB783 8 ]SXP]RaXRZTcUP]bfTaTX]U^aPVaTPcbda _aXbT Pb U^aTa 8]SXP RP_cPX] PWT]SaP BX]VW3W^]XfPb^]FTS]TbSPhP__^X]c TS cWT T]c^a ^U 8]SXPb $TQTa C! F^a[S2d_b`dPSQhcWT1^PaS^U2^]ca^[U^a 2aXRZTcX]8]SXP12280]]^d]RX]VcWT^eT 1228bPXScWPccWThb_^ZTc^3W^]XX]3dQPX P]SWTPVaTTSc^T]c^acWTcTPU^acWTc^da ]PT]cCWTTeT]cXbbRWTSd[TSc^bcPac^] Rc^QTa X]cWTD04P]SP]CWT# hTPa^[S3W^]XaTcXaTSUa^X]cTa]PcX^]P[RaXRZ Tc[PbchTPa3W^]XbT]R[^bdaTfX[[RTacPX][h WT[_cWTEXaPc:^W[X[TScTPX]U^ad[PcX]V fWXcTQP[[bcaPcTVh3W^]XbePbcTg_TaXT]RT X]fX]]X]VRadRXP[822c^da]PT]cbfX[[RTa cPX][hR^TX]WP]Sh 3W^]XXb^]T^UcWT^bcbdRRTbbUd[RP_ cPX]bX]cWTWXbc^ah^U8]SXP]RaXRZTcCWTXR^] XR fXRZTcZTT_TaQPcbP] [TS 8]SXP c^ cf^ f^a[ScXc[Tb¯cWT!C!F^a[S2d_X] B^dcW0UaXRPP]ScWT! 38F^a[S2d_X] 8]SXP TP]fWX[T APeXRWP]SaP] 0bWfX] aTcda]TSc^8]SXPbfWXcTQP[[^dcUXcPUcTaU^da hTPabP[^]VbXSTcWTUPbcaXbX]VcaX^^U8bWP] :XbWP]0gPa?PcT[P]SEPad]2WPZaPePacWh 0[b^PZX]VXcc^cWTb`dPSfPbBdahPZdPa HPSPecWThTPa^[SdQPXQPcbP]fW^ WPbQTT]PZX]VP]PTU^aWXb_^fTaWXc cX]VCWTQXV]PTbc^_[d]VTfTaT^_T]Ta BWXZWPa3WPfP]P]S[TVb_X]]TaHdieT]SaP 2WPWP[APWd[2WPWPaWPbQTT]_aTUTaaTS^eTa 2WPWP[fW^fPbPRTacPX]chX]8]SXPb[XXc TS^eTab`dPSbd]cX[]^f 9PXeP]cW?PaXcP[P| :^cWPVdST =QXY bUdeb^cY^Q^UgQfQdQb ,QWUXVLRQRIODZ LQEHGURRPLVEDG T here has been a cacoph- ony from various quar- ters, especially from fem- inine activists, that the concept of ‘marital rape’ should be recognised and the men forc- ing their wives to be intimate against their willingness should be tried under the law of rape. What an irony that instead of governing society through lessons of morality, ethics and compas- sion or using the tools of coun- selling, on each issue of the slightest importance we start emphasising on making laws. What else will you crimi- nalise in a domestic relationship? You have already started sneak- ing into bedrooms like a voyeur. There is a strong possibility of vested interests promoting such non-issues. It has been frequent- ly observed that as different watches and clocks give slightly different timings on the same scale of the Standard Time, dif- ferent courts give varied, diver- gent and, at times, contradicto- ry judgments on the same mat- ter of law. The reason behind this can be attributed to judicial overreach crossing the barri- cades of the separation of power norms. Where is the need for individual observations all the time? This phenomenon will surely give rise to divergent judgments from Bench to Bench. A Division Bench of the Kerala High Court comprising Justices Mohammad Mushtaq and Kausar Edappagath on August 6, 2021, dismissed the appeal of a man who had chal- lenged a family court order allow- ing his wife’s plea for divorce on grounds of cruelty in the name of forced copulation, besides unnat- ural sex and dowry demands. However, Section 375 of the IPC provides no space for mari- tal rape. Its Exception 2 states: “Sexual intercourse or sexual acts by a man with his wife, the wife not being under 15 years of age, is not rape.” It implies that sex with a wife who is over 15 is not rape, even if it is without her con- sent. However, in October 2017, in the Independent Thought vs Union of India, the Supreme Court ruled that sex with one’s minor wife, who is below 18 years of age, would amount to rape despite her consent. Lord Mathew SOUNDBITE CWT19?[TS 6^eTa]T]c^U 8]SXPWPb_[PhTSP RadT[Y^ZT^]cWT P]]PSPPcPbfXcWcWT RdaaT]cB?WXZT ?d]YPQ2WXTUX]XbcTa ¯2P_c0PaX]STaBX]VW 2P[XU^a]XP H^d³eTV^cPQXV RW^XRTc^PZT QhBT_cTQTa # H^dae^cTR^d[SQT cWTSXUUTaT]RTe^cT°]^±^]cWT AT_dQ[XRP]aTRP[[ 5^aTaDB?aTbXST]c ¯ 1PaPRZQPP 8cfX[[QTf^]STaUd[ c^R^[[PQ^aPcTfXcW 0AAPWP]PVPX] 7TXbPf^]STaUd[ PacXbcP]SdbXRXP] P]S8[^^ZU^afPaSc^cWXb R^[[PQ^aPcX^] ;haXRXbc ¯6d[iPa 0ca^RXcXTb^]db[Xb WPeTQTT]S^]TPc cWT19?³bQTWTbc fWX[T^cWTa_PacXTb ZT_c`dXTc]^c b_TPZX]V^]200caX_[TcP[P` 088RWXTU ¯0bPSdSSX]fPXbX B3W^]Xb P__^X]cT]cPb CTP8]SXPT]c^a XbV^^S]TfbU^a 8]SXPQdc8PYdbc _aPhX]VcWPccWTaTXb]^R[PbW 5^aTa8]SXPRP_cPX] ¯Bd]X[6PePbZPa , IDQVRUWRIHOHFWLRQVDUHDQQRXQFHGLQ:HVW%HQJDOFDQPXGVOLQJLQJDQGQDPH FDOOLQJEHIDUEHKLQG%DUHOKDGWKH(OHFWLRQRPPLVVLRQRI,QGLDDQQRXQFHGWKH EHOHFWLRQ WR WKUHH $VVHPEO VHDWV %KDEDQLSXU -DQJLSXU DQG 6DPVHUJDQM