![14=60;E8;4=24)218
34C08=BB8G?4AB=B
:^[ZPcP) CWT218Pb_Pac^UXcb
_a^QTX]c^RPbTb^U_^bc_^[[
eX^[T]RTX]FTbc1T]VP[
STcPX]TSbXg_Tab^]b^]^]SPh
U^acWTXaP[[TVTSX]e^[eTT]cX]
RaXX]P[^UUT]RTbPVT]Rh
b^daRTbbPXS0RR^aSX]Vc^cWT
b^daRTbPcTP^U218^UUXRXP[b
eXbXcTS7^faPWSXbcaXRcX]cWT
^a]X]VP]SSTcPX]TSP[[bXg^U
cWTUa^3^YdaPaTP
20?BD;4
0?Q :01D;
The Taliban said on Monday
they have seized the last
province, Panjshir, not in their
control after their blitz through
Afghanistan last month, appar-
ently overrunning the National
Resistance Front (NRF) forces
who had opposed their
takeover.
Thousands of Taliban
fighters charged into eight dis-
tricts of Panjshir province
overnight, according to wit-
nesses from the area who spoke
on condition of anonymity
because they feared for their
safety.
Taliban spokesman
Zabihullah Mujahid confirmed
that the province, which is
north of the capital, was now
held by their fighters.
“We tried our best to solve
the problem through negotia-
tions, and they rejected talks
and then we had to send our
forces to fight,” Mujahid told a
news conference in Kabul later
Monday.
The resisting forces were
led by the former vice presi-
dent, Amrullah Saleh, and also
the son of the iconic anti-
Taliban fighter Ahmad Shah
Massoud. Experts had doubt-
ed that the holdout efforts
could succeed long-term
against the Taliban, whose
rapid advance through
Afghanistan met little resis-
tance in the final days of
America’s 20-year war in the
country.
Nestled in the towering
Hindu Kush mountains, the
Panjshir Valley has a single nar-
row entrance. Local fighters
held off the Soviets there in the
1980s and also, for a brief
time, the Taliban a decade
later under the leadership of
Ahmad Shah Massoud.
Massoud’s son Ahmad
called for an end to the fight-
ing on Sunday. The young
British-schooled Massoud said
his forces were ready to lay
down their weapons but only if
the Taliban agreed to end their
assault. Late on Sunday dozens
of vehicles loaded with Taliban
fighters were seen swarming
into the Panjshir Valley.
In a second statement
Monday, a now-defiant
Massoud accused the Taliban
of attacking even as they were
ready to agree to a cease-fire.
He vowed to fight on, urged
Afghans to join in their battle
against the Taliban and chas-
tised the international com-
munity for giving the Taliban
a platform by opening negoti-
ations with them.
There has been no state-
ment from Saleh, who had
declared himself the acting
president after President
Ashraf Ghani fled the
country on August 15 as the
Taliban reached the gates of the
capital.
The whereabouts of Saleh
and the young Massoud were
not immediately known
Monday.
The US withdrew its last
troops a week ago and ended a
harrowing airlift to evacuate
Western citizens and their
Afghan allies that was marred
by scenes of desperation and
horrific violence.
?=BQ :2788
The Kerala High Court on
Monday ruled that the sec-
ond dose of Covishield vaccine
could be administered after 28
days and the stance of the
Union Government that the
same could be given only after
84 days was discriminatory.
Justice PB Suresh Kumar
who heard a petition filed by
Kitex Limited seeking a direc-
tive to the authorities to allow
its employees to get the second
jab after 28 days against the
order by the Ministry of Health
and Family Welfare that the
same could be given only after
84 days said that there were dis-
criminations in the law.
“The decision of the
Government in providing
relaxation in the protocol
regarding administration of
second dose of vaccine to cer-
tain classes of persons alone
amounts to discrimination,”
said the judge in his order.
The judge pointed out that
the Union Government had
relaxed the interval between
the vaccinations for Indian
Government officials with
commitments abroad, persons
needing to travel abroad for
studies or employment, those
participating at the Olympic
Games, etc.
“If the Government can
permit persons who are intend-
ing to travel abroad to exercise
a choice between early protec-
tion and better protection from
Covid-19 infection, there is
absolutely no reason why the
same privilege shall not be
extended to others who want
early protection in connection
with their employment, edu-
cation, etc,” the judge said in his
order.
He said it was discrimina-
tion and should be rectified.
The petitioner was willing to
pay for the vaccines and hence
he should have the freedom to
get the second jab like the oth-
ers, said the judge.
“The fact that the vaccina-
tion is voluntary and there is no
compulsion on anyone to
accept the same is declared by
the Government of India in the
website of the Ministry of
Health and Family Welfare. If
that be so, the requirement to
administer two doses of the
vaccine and the time interval
between the two doses for bet-
ter protection from infection
can only be considered as advi-
sory,” said judge Suresh Kumar
in his verdict.
The court asked the Union
Government to immediately
make necessary provisions in
the CoWIN portal, so as to
enable scheduling of second
dose of Covishield vaccine
after four weeks of the first dose
for those who want it.
?=BQ =4F34;78
The Supreme Court on
Monday refused to enter-
tain a plea filed by residents of
Sonipat seeking opening of
the roads connecting Delhi
and Haryana at Singhu border,
which has been blocked by
farmers protesting against three
farm laws.
A bench of Justices DY
Chandrachud, Vikram Nath
and Hima Kohli said the peti-
tioners have the freedom to
approach the High Court.
The top court said the
invitation to interfere is very
tempting, but there are High
Courts, which can deal with the
local issues. “Suppose tomor-
row there is a border dispute
between Karnataka and Kerala
or some other States. There will
be no end to this. This court
shall not be the first recourse.
High Courts are there to deal
with local problems. We have
a robust system in place,” the
bench said.
At the outset, advocate
Abhimanyu Bhandari, appear-
ing for petitioners Jai Bhagwan
and Jagbir Singh Chhikara,
both residents of Sonipat, said
that Singhu border is like an
“umbilical cord” for people of
the city as it connects Delhi and
Haryana but due to blockade
this is hampering their right to
movement. He said that peti-
tioners are not against the
peaceful protest by farmers
and they have nothing to do
with three farm laws against
which they are protesting.
B0D60AB4=6D?C0Q :;:0C0
Months after PCC president
Adhir Chowdhury
expressed his “goodwill ges-
ture” saying the Congress
would not field any candidate
against Bengal Chief Minister
Mamata Banerjee in the
Assembly by-election, the
Congress leader in the Lok
Sabha on Monday said the
State unit of the party had
decided to contest against the
Chief Minister with the support
of the Left Front.
By-election for the
Bhawanipore seat will take
place on September 30.
“In the changed circum-
stances the PCC had decided to
field a candidate for the Left-
Congress alliance,” Chowdhury
said, adding, “the party had
extensive discussion in the
State unit and after taking the
views of all the leaders we have
decided to field our candidate
backed by the Left.”
The decision in this regard
had been sent to the All India
Congress Committee for its
approval he said.
“We have sent a proposal to
the AICC for its approval â ¦
after the high command takes
a final decision we shall start
the subsequent process,” he
said.
The CPI(M) too said it was
in favour of continuing the
Front with the Congress. “We
too are of the opinion that the
Left, Congress and all the other
like-minded parties must unite
to fight against the TMC and
the BJP in Bengal whereas
they should come together to
throw out the BJP nationally,”
CPI(M) leader Tanmoy
Bhattacharya said.
?=BQ =4F34;78
The Supreme Court on
Monday slammed the
Centre for testing its “patience”
and “emasculating” Tribunals
by not appointing officials to
the quasi-judicial bodies that
are facing a severe crunch of
presiding officers as well as
judicial and technical mem-
bers. The court sought action
on the matter by September 13.
“There is no respect for the
judgments of this court,” said
Chief Justice NV Ramana at
one point expressing displea-
sure with the Centre.
Reiterating that it did not want
any confrontation with the
Government, the special bench
headed by Chief Justice asked
the Centre to make some
appointments to the tribunals
before next Monday. There are
around 250 posts lying vacant
at various key tribunals and
appellate tribunals such as
NCLT, DRT, TDSAT, and CAT.
“You are emasculating the
Tribunals by not making the
appointments,” said the bench,
also comprising Justices DY
Chandrachud and L Nageswara
Rao. Solicitor General Tushar
Mehta requested the bench to
adjourn the hearing due to
non-availability of Attorney
General KK Venugopal due to
personal issues.
?C8Q ;=3=
Amenacing Jasprit Bumrah
joined forces with a canny
Ravindra Jadeja to decimate
England by 157 runs in the
fourth Test as India took a 2-1
lead in the five-match series,
here on Monday.
The Indian bowling attack
was without two of its senior
pacers Ishant Sharma and
Mohammed Shami but was
still potent enough to bowl out
England for 210 in 92.2 overs.
The hosts were chasing a
tough target of 368.
Bumrah (22-9-27-2) and
Jadeja (30-11-50-2) hit England
with such ferocity that a bats-
man of Joe Root’s (36 off 78
balls) stature looked dumb-
founded at the other end with
the kind of distress that his fel-
low batters were in.
Perhaps that was the reason
that India’s man-of-the-
moment Shardul Thakur’s (8-
1-22-2) off-cutter was dragged
back onto the stumps by Root,
signalling the end of English
resistance.
Umesh Yadav (18.2-2-60-
3) then completed the formal-
ities with the second
new ball as India won two Test
matches in a single
series in England after a gap of
35 years.
Virat Kohli had said after
the third Test that a win at
Lord’s didn’t guarantee a win at
Leeds and a humbling defeat
at Leeds didn’t mean that
tables could not be turned at
the Oval.
The skipper’s thoughts
were vindicated by his team
with an all-round performance
— Rohit Sharma showing
steely temperament, Shardul
Thakur giving it his all know-
ing that chances may be far and
few.
7DOLEDQFRQWURORYHU
$IQRZFRPSOHWH
?=BQ =4F34;78
Evidence of direct involve-
ment of Pakistan’s ISI-Army
combine in Afghanistan has
come to the fore as the father
of a slain ISI operative Hamid
Faiz has revealed that his son
was fighting along with Taliban
till he was killed.
In a video message, Faiz’s
father has also revealed that
Pakistani intelligence opera-
tives are being recruited in the
Army that the Taliban is rais-
ing in Afghanistan post-
takeover of the war-ravaged
country.
Faiz hailed from Chakwal,
Rawalpindi Division of Punjab
province, Pakistan. Chakwal is
located 90 kilometres south-
west of the federal capital,
Islamabad, and 270 kilometres
from the provincial capital,
Lahore to which ISI chief Lt
Gen Faiz Hameed belongs.
“Faiz came to Afghanistan
with Taliban fighters and he
wanted to fight alongside
Taliban fighters in Afghanistan.
And in Afghanistan, Afghan
Special Forces were killed in an
operation in Kunar province.
Faiz’s main job was to spy for
Pakistan’s intelligence network,
but he was killed along with
Taliban fighters in
Afghanistan,” Faiz’s father said
in the video message.
?=BQ =4F34;78
The current fluid situation in
Afghanistan will figure
prominently during the 13th
BRICS summit on September
9. Prime Minister Narendra
Modi, Russian President
Vladimir Putin, Chinese
President Xi Jinping, South
African President Cyril
Ramaphosa, and Brazilian
President Jair Bolsonaro will
virtually take part in the meet.
The theme for this Summit
is ‘BRICS@15: Intra-BRICS
cooperation for continuity,
consolidation and consensus’.
India had outlined four prior-
ity areas for its chairship. These
are reform of the multilateral
system, counter terrorism,
using digital, and technological
tools for achieving Sustainable
Development Goals (SDGs)
and enhancing people-to-peo-
ple exchanges. In addition to
these areas, the leaders will also
exchange views on the impact
of the Covid-19 pandemic and
other current global and
regional issues.
The crucial summit takes
place days ahead of Modi’s
visit to the USA in late
September.
The PM is likely to hold
summit level talks for the first
time with President Joe Biden
since he took charge earlier this
year.
,QGLDRXWOLQHV
SULRULWDUHDV
:LOOQRWOHWHYHQ3DN
LQWHUIHUHVD7DOLEDQ
$OORZQGRYLVKLHOGGRVH
DIWHUGDV.HUDOD+
4`fcedVVdRTeZ`_
`_^ReeVcSjDVae$
8]Dcda]2^]Vc^UXT[S
RP]SXSPcTPVPX]bc3XSX
=VWeSRTVUaZTe`
WZXYe3YRhR_Za`cV
Sja`]]`_DVae$!
D4cVWfdVda]VRe`
`aV_DZ_XYfc`RU
`cUVcdµ^`gV94¶
2We`e`a3C:4D¶df^^ZeRXV_UR
?C8Q 8B;00103
The Taliban on Monday
asserted that it will not
allow any country, including
Pakistan, to interfere in
Afghanistan’s internal affairs as
it confirmed that ISI chief Lt
Gen Faiz Hameed met the
insurgent group’s de-facto
leader Mullah Abdul Ghani
Baradar in Kabul, amid efforts
to finalise a Government in the
war-torn country.
The questions of interfer-
ence in Afghanistan’s internal
affairs were raised after Inter-
Services Intelligence (ISI)
Director General Lt Gen
Hameed dashed to Kabul on an
unannounced visit last week.
Taliban spokesperson
Zabiullah Mujahid said that the
group will not allow any coun-
try, including Pakistan, to inter-
fere in Afghanistan’s affairs,
Afghanistan’s Khaama news
reported.
Earlier, Pakistani media
reported that a delegation of
senior officials led by Lt Gen
Hameed was in Kabul at the
invitation of the Taliban, but
the Taliban said Islamabad had
proposed his visit.
Detailed report on P8
2P_cPX]EXaPc:^W[XRT[TQaPcTbPbBWPaSd[CWPZdaaXVWccPZTbcWTfXRZTc^U4]V[P]S´bA^ah1da]b^]SPhUXeT^UcWTU^dacWCTbc
PcRWPcCWTeP[RaXRZTcVa^d]SX];^]S^]^]^]SPh 0?
8B8a^[TX]CP[XQP]
QPcc[TTg_^bTS
)DWKHURIVODLQ
,6,RSHUDWLYH
UHOHDVHVYLGHR
0a^aTSeTWXR[TbPaTbTT]X]?P]YbWXaEP[[Th]^acW^U:PQd[0UVWP]XbcP] 0?
FTbc1T]VP[2^]VaTbb?aTbXST]c0SWXaAP]YP]2W^fSWdahPSSaTbbTbTSXPPc
_Pach^UUXRTX]:^[ZPcP^]^]SPh ?C8
B2b[Pb6^ecU^aST[Ph
X]caXQd]P[P__^X]cT]cb 8]SXPfX]#cWCTbcQh $ad]b
AR_[dYZc¶dCVdZdeR_TVWR]]de`ER]ZSR_
3f^cRY;RUV[RUVTZ^ReV6_X]R_U
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !#$
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=CD4B30HB4?C414A !! *?064B !C!
?2E:@?
=8?07=A8B48=:4A0;0'
A4BH?C0C82
m
m
H@C=5)
6D8=40B=4F9D=C0;4034AB
B44:CC867C4=6A8?=?F4A
2E=B18
?=91D54
6?B9331G1B4
!C@?BD
@A:?:@?'
B;384AB5=5;06
20AAH=0;;4680=24](https://image.slidesharecdn.com/pioneer-dehradun-english-edition-2021-09-07-210907021306/85/pioneer-dehradunenglishedition20210907-1-320.jpg)
![347A03D=kCD4B30H kB4?C414A!! ?064!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+
6HODTXL,QGXVWULDO$UHD'HKUDGXQ8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL
3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU833KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 270=3860A7
Aday ahead of a protest call
given by farmers’ union on
September 7 in Karnal,
Haryana Government has
decided to suspend mobile
internet services in the district
and impose prohibitory orders.
“The mobile internet ser-
vices will shut down with effect
from September 6 from 12:30
am to 23:59 (midnight) on
September 7. Prohibitory
orders banning gathering of
five or more people have been
imposed in Karnal,” stated the
government's orders.
The farmers’ unions have
announced to hold a maha-
panchayat and to gherao
Karnal mini secretariat on
Tuesday in protest against the
August 28 lathi charge on
farmers in Karnal.
Home Minister Anil Vij
told the mediapersons on
Monday that elaborate securi-
ty arrangements have been
made in Karnal district to
maintain law and order situa-
tion. He has also directed
Additional Director General of
Police (Law and Order)
Navdeep Singh Virk to per-
sonally stay in Karnal and
monitor the whole situation so
that the event ends peacefully.
At least 40 companies of
additional forces, five superin-
tendent rank officials and 25
deputy superintendent rank
officials along with thousands
of cops have been deployed in
Karnal. The Police has also
made arrangements to use
drones to maintain law and
order situation during farmers’
protest.
Vij said that for the conve-
nience of the people, we have
made all the arrangements,
have diverted some of the
routes and have also deployed
sufficient force.
Responding to a question
regarding internet shutdown,
Vij said that to prevent mis-
chievous elements from taking
advantage of such programmes
the administration has to be
careful and internet shutdown
is imposed.
In response to the question
regarding invoking Section
144, the Home Minister said
that wherever the farmers want
to protest, we will allow it in a
peaceful manner.
A government's order
issued stated, “to prevent any
disturbance of peace and pub-
lic order in the jurisdiction of
Karnal district, said mobile
internet services
(2G/3G/4G/CDMA/GPRS),
SMS services, including bulk
SMS (excluding banking and
mobile recharge) and all don-
gle services etc provided on
mobile networks, except voice
calling, will remain
suspended.”
It stated that the suspen-
sion of mobile internet services
was ordered to stop the spread
of misinformation and
rumours through social media
platforms such as WhatsApp,
Facebook, Twitter on mobile
phones and SMS. This could
facilitate mobilisation of mobs
that can cause serious loss of
life and damage to public and
private properties by indulging
in arson, vandalism or other
violent activities, it
added.
Earlier in the day, a meet-
ing held between Karnal
District Administration and
farmers’ unions remained
unsuccessful.
Karnal Deputy
Commissioner Nishant Kumar
Yadav told the mediapersons
that the demands put forth by
the farmers organizations can-
not be fulfilled. They (farmers)
have decided to proceed with
their protest call on Tuesday in
Karnal. We will not allow them
to gherao Karnal mini-secre-
tariat and strict action will be
taken against those violating
law, he said.
No one will be allowed to
block highways and roads, he
added.
Will break barricades if
stopped during protest:
Chaduni
Haryana Bhartiya Kisan
Union (Chaduni) chief
Gurnam Singh Chaduni on
Monday said a mahapanchay-
at will be held in Karnal on
Tuesday, after which farmers
will proceed to gherao the
mini-secretariat.
“Farmers will be gathering
in Karnal’s New Anaj Mandi on
Tuesday morning,” he said,
adding their demands have
not been met and they will go
ahead with their protest.
“We want to hold a peace-
ful protest but if stopped from
proceeding towards the mini-
secretariat, we will be forced to
break the barricades put up by
police,” he said while talking to
the mediapersons after the
meeting in Karnal.
Chaduni said that other
leaders from SKM will also par-
ticipate in the protest.
Notably, Haryana Police
had lathicharged a group of
farmers disrupting traffic
movement on a national high-
way on August 28 while they
were heading towards Karnal to
protest against a BJP meeting
where Chief Minister Manohar
Lal Khattar was also present.
Atleast 15 farmers were injured
during the incident.
The farmers’ unions have
demanded that a murder case
should be registered against
IAS officer Ayush Sinha, who
was caught on tape allegedly
telling policemen to “break
heads” of protesting farmers.
Sinha, who was later trans-
ferred in a reshuffle also involv-
ing some other IAS officers, has
now been posted as the addi-
tional secretary in the Citizen
Resources Information
Department.
The farmers’ unions have
also demanded compensation
of Rs 25 lakh and a job to the
next of kin of a farmers who
died after the lathicharge and
Rs two lakh compensation for
those injured.
Elaborate security
arrangement made, routes to
be diverted: Virk
ADGP (Law and Order)
Navdeep Singh Virk said that
the primary objective of secu-
rity arrangements is to main-
tain public peace and order,
prevent any kind of violence,
facilitate the functioning of
traffic and public transport
system and to safeguard the
public property across the state
in general and Karnal in par-
ticular.
IGP Karnal Range and all
district Superintendents of
Police (Karnal Range) have
been directed to take necessary
preventive and precautionary
measures to maintain law and
order and peace in Karnal and
adjoining districts. All mea-
sures would be taken to contain
any kind of untoward incidents
and safety of citizens, he said.
In addition to making all
arrangements, close coordina-
tion is also being maintained
with civil administration for
handling the law and order sit-
uation, he added.
Virk further said that the
main national highway No 44
(Ambala-Delhi) may see some
traffic disruptions in Karnal
district. Therefore, the gener-
al public using NH 44 are
advised to avoid journey
through Karnal town or oth-
erwise use alternate routes to go
to their destination on
September 7. All citizens are
being informed about these
arrangements in advance so
that they are able to plan and
modify their journey accord-
ingly, to avoid any inconve-
nience, he said.
The police have planned
route diversions on NH-44
between Delhi and Ambala. In
case, the need arises these
diversions will be brought into
effect from around 9 am on
Tuesday.
It is proposed that for
Delhi to Chandigarh route,
vehicles coming from Delhi
side will be allowed to reach
Chandigarh via Pepsi Bridge
(Panipat) via Munak to
Assandh and Munak to
Gagsina, via Ghoghadipur to
Hansi Chowk of Karnal, via
Bypass Western Yamuna Canal
to Karna Lake via GT Road 44.
Apart from this, light vehicles
will be diverted towards
Chandigarh via Madhuban,
Daha, Bajida, Ghogharipur,
Hansi Chowk, Bypass Yamuna
Canal, Karna Lake, GT Road
44.
The vehicles coming from
Chandigarh side is proposed to
be diverted from Pipli Chowk
(Kurukshetra) via Ladwa, Indri,
Bayana, Neval, Kunjpura via
Nangla Megha, Meerut via
Amritpur Khurd, Kairavali and
Gharaunda via GT Road 44.
The light vehicles will be
allowed from Ramba Cut
Tarawadi via Ramba Chowk
Indri Road via Sangoha, Ghid,
Baragaon, Neval, Kunjpura via
Nangla Megha, Meerut Road
via Amrutpanur Khurd,
Kairavali and Gharaunda via
GT Road-44.
`SZ]VZ_eVc_VedfdaV_UVUac`YZSZe`cj`cUVcdZ^a`dVUZ_Rc_R]
07403550A4AB?AC4BC20;;
?=BQ B78;0
Prime Minister Narendra
Modi on Monday said that
Himachal Pradesh has emerged
as a champion to have admin-
istered the first dose of COVID
vaccinetoitseligiblepopulation.
He expressed hope that
Himachal would also be the first
state in inoculating a second
dose of the Covid vaccine to its
eligible population. The Prime
Minister virtually interacted
with healthcare workers and
beneficiaries of Covid vaccina-
tion program of Himachal from
New Delhi. Chief Minister Jai
Ram Thakur participated in
the function organised at
Peterhof, Shimla while BJP
national president and MP Jagat
Prakash Nadda and Union
Minister of Information and
Broadcasting Anurag Singh
Thakur participated virtually
from New Delhi.
While congratulating the
StateGovernmentandpeopleof
the hill state, Modi said that the
statewasabletoachievethistar-
get due to effective implemen-
tationoftheCOVIDvaccination
drive by the State Government
andpublicawareness.Himachal
has become the first state in
India to have administered at
leastonedoseofCoronavaccine
to its entire eligible population.
Not only this, in the case of the
second dose, Himachal has
crossed almost one third of the
population. This step of
Himachal Pradesh has made us
realise the importance of self
reliance, he added. Modi appre-
ciated the arrangements made
by the State Government,
despite the hilly terrain of the
state. Himachal has ensured
the fastest vaccination, without
wastage of the vaccine. Mass
communication and public par-
ticipationareahugefactorinthe
success of the vaccination cam-
paign, he said.
He said that today India is
making a record by adminis-
tering 125 crore vaccines in a
day. The credit of the success
goes to doctors, para-medical
staffandwomenofthestate.The
people of Himachal did not
allow any rumour, any misin-
formation to survive.
In view of landslide inci-
dents in the hill state, the Prime
Minister suggested the state to
usedronetechniqueinlandsur-
vey and encourage research
related to early warning system
regarding landslides.
Modi also emphasised on
improving connectivity and
usage of modern techniques in
developmental works. He said
that drone would prove a boon
in far flung areas of the state and
wouldprovebeneficialinhealth,
agricultureandhorticulturesec-
tors. Besides this, it can also be
used in delivering life saving
medicines and essential com-
modities with ease in far flung
areas, he added.
He said that many mean-
ingful results can be obtained by
connecting the village and the
community. Modi also spoke of
successful implementation of
Jal Jeevan Mission in the state
and exploring the potential in
the forests of Himachal espe-
cially for herbs and increasing
the participation of villages and
self-help groups.
On the occasion, he urged
the farmers and horticulturists
of the state to make agriculture
of Himachal Pradesh organic in
the next 25 years. Prime
Minister also appreciated var-
ious welfare and developmen-
tal schemes of the state gov-
ernment.
30VDV+LPDFKDOHPHUJHVDVFKDPSLRQRI
RYLGYDFFLQDWLRQFDPSDLJQLQLQWHUDFWLRQ ?=BQ 270=3860A7
Days after ‘dissident’ Cabinet
Ministers — Tript
Rajinder Singh Bajwa and
Sukhjinder Singh Randhawa —
wrote a letter to Punjab Chief
Minister seeking time to raise
the demand for declaring
Batala a district, Capt
Amarinder Singh on Monday
said that the “demand” was
already under consideration. At
the same time, the Chief
Minister told his Cabinet col-
leagues that he would have told
them so if they had come to
him “before shooting off letter”.
“The demand for declaring
Batala as a district is already
under consideration and a final
decision would be taken after
due consideration of various
issues involved,” said the Chief
Minister, adding that he had
received a similar representa-
tion from another Congress
leader last month and was
looking into the matter.
Further, there have been
some reports in the media
over the past few days indicat-
ing that citizens of Batala have
also publicly raised the demand
for a new district to be carved
out of their region, he pointed
out. The Chief Minister
expressed surprise that neither
Tript nor Sukhjinder had seen
the reports in the public
domain nor deemed it fit to
discuss the issue with him
before shooting off a joint let-
ter in this manner. “Had they
come to me and spoken about
it, I would have told them that
I am already looking into the
matter, and would have even
consulted them in this regard,”
quipped Capt Amarinder, tak-
ing a dig at the two Ministers.
Notably, the two Ministers
have raised a banner of revolt
against the Chief Minister to
the extent that they had open-
ly sought his removal, and
even raised the matter with the
state party affairs’ in-charge
Harish Rawat. Bajwa had even
declared that he would no
longer be working under Capt
Amarinder.
Once known as Capt
Amarinder’s staunch loyalists
and supporters, both Tript and
Randhawa vociferously backed
his bête noire Navjot Singh
Sidhu’s elevation to the party’s
top post.
“Rajya Sabha MP Pratap
Singh Bajwa has already
demanded a district status for
Batala in his letter dated August
11, 2021, and had cited Batala’s
historic importance and its
connection with Sri Guru
Nanak Dev ji, who had married
Mata Sulakhni here in 1487,”
said the Chief Minister.
He said that he was cog-
nisant of Batala’s significance to
Punjab’s history and culture, as
well as the public sentiment. “I
would discuss the issue with
various stakeholders before
taking a decision,” he added.
Capt Amarinder said that
the State Government had
identified as many as 103 places
in 79 villages and 24 towns,
blessed with Guru Sahib’s visit
(charan chhoh) during his life-
time. “Funds have been allo-
cated and efforts are being
made to ensure the develop-
ment of each of them in dif-
ferent ways,” he said, adding
that a lot of thinking and con-
sultation had gone into the
process.
3TP]SU^aSTR[PaX]V1PcP[PPSXbcaXRc
d]STaR^]bXSTaPcX^])2P_c0PaX]STa](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7)
Recommended
Recommended
More Related Content
What's hot
What's hot (20)
Similar to Pioneer dehradun-english-edition-2021-09-07
Similar to Pioneer dehradun-english-edition-2021-09-07 (20)
More from DunEditorial
More from DunEditorial (20)
Recently uploaded
Recently uploaded (15)
Pioneer dehradun-english-edition-2021-09-07
- 1. 14=60;E8;4=24)218 34C08=BB8G?4AB=B :^[ZPcP) CWT218Pb_Pac^UXcb _a^QTX]c^RPbTb^U_^bc_^[[ eX^[T]RTX]FTbc1T]VP[ STcPX]TSbXg_Tab^]b^]^]SPh U^acWTXaP[[TVTSX]e^[eTT]cX] RaXX]P[^UUT]RTbPVT]Rh b^daRTbbPXS0RR^aSX]Vc^cWT b^daRTbPcTP^U218^UUXRXP[b eXbXcTS7^faPWSXbcaXRcX]cWT ^a]X]VP]SSTcPX]TSP[[bXg^U cWTUa^3^YdaPaTP 20?BD;4 0?Q :01D; The Taliban said on Monday they have seized the last province, Panjshir, not in their control after their blitz through Afghanistan last month, appar- ently overrunning the National Resistance Front (NRF) forces who had opposed their takeover. Thousands of Taliban fighters charged into eight dis- tricts of Panjshir province overnight, according to wit- nesses from the area who spoke on condition of anonymity because they feared for their safety. Taliban spokesman Zabihullah Mujahid confirmed that the province, which is north of the capital, was now held by their fighters. “We tried our best to solve the problem through negotia- tions, and they rejected talks and then we had to send our forces to fight,” Mujahid told a news conference in Kabul later Monday. The resisting forces were led by the former vice presi- dent, Amrullah Saleh, and also the son of the iconic anti- Taliban fighter Ahmad Shah Massoud. Experts had doubt- ed that the holdout efforts could succeed long-term against the Taliban, whose rapid advance through Afghanistan met little resis- tance in the final days of America’s 20-year war in the country. Nestled in the towering Hindu Kush mountains, the Panjshir Valley has a single nar- row entrance. Local fighters held off the Soviets there in the 1980s and also, for a brief time, the Taliban a decade later under the leadership of Ahmad Shah Massoud. Massoud’s son Ahmad called for an end to the fight- ing on Sunday. The young British-schooled Massoud said his forces were ready to lay down their weapons but only if the Taliban agreed to end their assault. Late on Sunday dozens of vehicles loaded with Taliban fighters were seen swarming into the Panjshir Valley. In a second statement Monday, a now-defiant Massoud accused the Taliban of attacking even as they were ready to agree to a cease-fire. He vowed to fight on, urged Afghans to join in their battle against the Taliban and chas- tised the international com- munity for giving the Taliban a platform by opening negoti- ations with them. There has been no state- ment from Saleh, who had declared himself the acting president after President Ashraf Ghani fled the country on August 15 as the Taliban reached the gates of the capital. The whereabouts of Saleh and the young Massoud were not immediately known Monday. The US withdrew its last troops a week ago and ended a harrowing airlift to evacuate Western citizens and their Afghan allies that was marred by scenes of desperation and horrific violence. ?=BQ :2788 The Kerala High Court on Monday ruled that the sec- ond dose of Covishield vaccine could be administered after 28 days and the stance of the Union Government that the same could be given only after 84 days was discriminatory. Justice PB Suresh Kumar who heard a petition filed by Kitex Limited seeking a direc- tive to the authorities to allow its employees to get the second jab after 28 days against the order by the Ministry of Health and Family Welfare that the same could be given only after 84 days said that there were dis- criminations in the law. “The decision of the Government in providing relaxation in the protocol regarding administration of second dose of vaccine to cer- tain classes of persons alone amounts to discrimination,” said the judge in his order. The judge pointed out that the Union Government had relaxed the interval between the vaccinations for Indian Government officials with commitments abroad, persons needing to travel abroad for studies or employment, those participating at the Olympic Games, etc. “If the Government can permit persons who are intend- ing to travel abroad to exercise a choice between early protec- tion and better protection from Covid-19 infection, there is absolutely no reason why the same privilege shall not be extended to others who want early protection in connection with their employment, edu- cation, etc,” the judge said in his order. He said it was discrimina- tion and should be rectified. The petitioner was willing to pay for the vaccines and hence he should have the freedom to get the second jab like the oth- ers, said the judge. “The fact that the vaccina- tion is voluntary and there is no compulsion on anyone to accept the same is declared by the Government of India in the website of the Ministry of Health and Family Welfare. If that be so, the requirement to administer two doses of the vaccine and the time interval between the two doses for bet- ter protection from infection can only be considered as advi- sory,” said judge Suresh Kumar in his verdict. The court asked the Union Government to immediately make necessary provisions in the CoWIN portal, so as to enable scheduling of second dose of Covishield vaccine after four weeks of the first dose for those who want it. ?=BQ =4F34;78 The Supreme Court on Monday refused to enter- tain a plea filed by residents of Sonipat seeking opening of the roads connecting Delhi and Haryana at Singhu border, which has been blocked by farmers protesting against three farm laws. A bench of Justices DY Chandrachud, Vikram Nath and Hima Kohli said the peti- tioners have the freedom to approach the High Court. The top court said the invitation to interfere is very tempting, but there are High Courts, which can deal with the local issues. “Suppose tomor- row there is a border dispute between Karnataka and Kerala or some other States. There will be no end to this. This court shall not be the first recourse. High Courts are there to deal with local problems. We have a robust system in place,” the bench said. At the outset, advocate Abhimanyu Bhandari, appear- ing for petitioners Jai Bhagwan and Jagbir Singh Chhikara, both residents of Sonipat, said that Singhu border is like an “umbilical cord” for people of the city as it connects Delhi and Haryana but due to blockade this is hampering their right to movement. He said that peti- tioners are not against the peaceful protest by farmers and they have nothing to do with three farm laws against which they are protesting. B0D60AB4=6D?C0Q :;:0C0 Months after PCC president Adhir Chowdhury expressed his “goodwill ges- ture” saying the Congress would not field any candidate against Bengal Chief Minister Mamata Banerjee in the Assembly by-election, the Congress leader in the Lok Sabha on Monday said the State unit of the party had decided to contest against the Chief Minister with the support of the Left Front. By-election for the Bhawanipore seat will take place on September 30. “In the changed circum- stances the PCC had decided to field a candidate for the Left- Congress alliance,” Chowdhury said, adding, “the party had extensive discussion in the State unit and after taking the views of all the leaders we have decided to field our candidate backed by the Left.” The decision in this regard had been sent to the All India Congress Committee for its approval he said. “We have sent a proposal to the AICC for its approval â ¦ after the high command takes a final decision we shall start the subsequent process,” he said. The CPI(M) too said it was in favour of continuing the Front with the Congress. “We too are of the opinion that the Left, Congress and all the other like-minded parties must unite to fight against the TMC and the BJP in Bengal whereas they should come together to throw out the BJP nationally,” CPI(M) leader Tanmoy Bhattacharya said. ?=BQ =4F34;78 The Supreme Court on Monday slammed the Centre for testing its “patience” and “emasculating” Tribunals by not appointing officials to the quasi-judicial bodies that are facing a severe crunch of presiding officers as well as judicial and technical mem- bers. The court sought action on the matter by September 13. “There is no respect for the judgments of this court,” said Chief Justice NV Ramana at one point expressing displea- sure with the Centre. Reiterating that it did not want any confrontation with the Government, the special bench headed by Chief Justice asked the Centre to make some appointments to the tribunals before next Monday. There are around 250 posts lying vacant at various key tribunals and appellate tribunals such as NCLT, DRT, TDSAT, and CAT. “You are emasculating the Tribunals by not making the appointments,” said the bench, also comprising Justices DY Chandrachud and L Nageswara Rao. Solicitor General Tushar Mehta requested the bench to adjourn the hearing due to non-availability of Attorney General KK Venugopal due to personal issues. ?C8Q ;=3= Amenacing Jasprit Bumrah joined forces with a canny Ravindra Jadeja to decimate England by 157 runs in the fourth Test as India took a 2-1 lead in the five-match series, here on Monday. The Indian bowling attack was without two of its senior pacers Ishant Sharma and Mohammed Shami but was still potent enough to bowl out England for 210 in 92.2 overs. The hosts were chasing a tough target of 368. Bumrah (22-9-27-2) and Jadeja (30-11-50-2) hit England with such ferocity that a bats- man of Joe Root’s (36 off 78 balls) stature looked dumb- founded at the other end with the kind of distress that his fel- low batters were in. Perhaps that was the reason that India’s man-of-the- moment Shardul Thakur’s (8- 1-22-2) off-cutter was dragged back onto the stumps by Root, signalling the end of English resistance. Umesh Yadav (18.2-2-60- 3) then completed the formal- ities with the second new ball as India won two Test matches in a single series in England after a gap of 35 years. Virat Kohli had said after the third Test that a win at Lord’s didn’t guarantee a win at Leeds and a humbling defeat at Leeds didn’t mean that tables could not be turned at the Oval. The skipper’s thoughts were vindicated by his team with an all-round performance — Rohit Sharma showing steely temperament, Shardul Thakur giving it his all know- ing that chances may be far and few. 7DOLEDQFRQWURORYHU $IQRZFRPSOHWH ?=BQ =4F34;78 Evidence of direct involve- ment of Pakistan’s ISI-Army combine in Afghanistan has come to the fore as the father of a slain ISI operative Hamid Faiz has revealed that his son was fighting along with Taliban till he was killed. In a video message, Faiz’s father has also revealed that Pakistani intelligence opera- tives are being recruited in the Army that the Taliban is rais- ing in Afghanistan post- takeover of the war-ravaged country. Faiz hailed from Chakwal, Rawalpindi Division of Punjab province, Pakistan. Chakwal is located 90 kilometres south- west of the federal capital, Islamabad, and 270 kilometres from the provincial capital, Lahore to which ISI chief Lt Gen Faiz Hameed belongs. “Faiz came to Afghanistan with Taliban fighters and he wanted to fight alongside Taliban fighters in Afghanistan. And in Afghanistan, Afghan Special Forces were killed in an operation in Kunar province. Faiz’s main job was to spy for Pakistan’s intelligence network, but he was killed along with Taliban fighters in Afghanistan,” Faiz’s father said in the video message. ?=BQ =4F34;78 The current fluid situation in Afghanistan will figure prominently during the 13th BRICS summit on September 9. Prime Minister Narendra Modi, Russian President Vladimir Putin, Chinese President Xi Jinping, South African President Cyril Ramaphosa, and Brazilian President Jair Bolsonaro will virtually take part in the meet. The theme for this Summit is ‘BRICS@15: Intra-BRICS cooperation for continuity, consolidation and consensus’. India had outlined four prior- ity areas for its chairship. These are reform of the multilateral system, counter terrorism, using digital, and technological tools for achieving Sustainable Development Goals (SDGs) and enhancing people-to-peo- ple exchanges. In addition to these areas, the leaders will also exchange views on the impact of the Covid-19 pandemic and other current global and regional issues. The crucial summit takes place days ahead of Modi’s visit to the USA in late September. The PM is likely to hold summit level talks for the first time with President Joe Biden since he took charge earlier this year. ,QGLDRXWOLQHV SULRULWDUHDV :LOOQRWOHWHYHQ3DN LQWHUIHUHVD7DOLEDQ $OORZQGRYLVKLHOGGRVH DIWHUGDV.HUDOD+ 4`fcedVVdRTeZ`_ `_^ReeVcSjDVae$ 8]Dcda]2^]Vc^UXT[S RP]SXSPcTPVPX]bc3XSX =VWeSRTVUaZTe` WZXYe3YRhR_Za`cV Sja`]]`_DVae$! D4cVWfdVda]VRe` `aV_DZ_XYfc`RU `cUVcdµ^`gV94¶ 2We`e`a3C:4D¶df^^ZeRXV_UR ?C8Q 8B;00103 The Taliban on Monday asserted that it will not allow any country, including Pakistan, to interfere in Afghanistan’s internal affairs as it confirmed that ISI chief Lt Gen Faiz Hameed met the insurgent group’s de-facto leader Mullah Abdul Ghani Baradar in Kabul, amid efforts to finalise a Government in the war-torn country. The questions of interfer- ence in Afghanistan’s internal affairs were raised after Inter- Services Intelligence (ISI) Director General Lt Gen Hameed dashed to Kabul on an unannounced visit last week. Taliban spokesperson Zabiullah Mujahid said that the group will not allow any coun- try, including Pakistan, to inter- fere in Afghanistan’s affairs, Afghanistan’s Khaama news reported. Earlier, Pakistani media reported that a delegation of senior officials led by Lt Gen Hameed was in Kabul at the invitation of the Taliban, but the Taliban said Islamabad had proposed his visit. Detailed report on P8 2P_cPX]EXaPc:^W[XRT[TQaPcTbPbBWPaSd[CWPZdaaXVWccPZTbcWTfXRZTc^U4]V[P]S´bA^ah1da]b^]SPhUXeT^UcWTU^dacWCTbc PcRWPcCWTeP[RaXRZTcVa^d]SX];^]S^]^]^]SPh 0? 8B8a^[TX]CP[XQP] QPcc[TTg_^bTS )DWKHURIVODLQ ,6,RSHUDWLYH UHOHDVHVYLGHR 0a^aTSeTWXR[TbPaTbTT]X]?P]YbWXaEP[[Th]^acW^U:PQd[0UVWP]XbcP] 0? FTbc1T]VP[2^]VaTbb?aTbXST]c0SWXaAP]YP]2W^fSWdahPSSaTbbTbTSXPPc _Pach^UUXRTX]:^[ZPcP^]^]SPh ?C8 B2b[Pb6^ecU^aST[Ph X]caXQd]P[P__^X]cT]cb 8]SXPfX]#cWCTbcQh $ad]b AR_[dYZc¶dCVdZdeR_TVWR]]de`ER]ZSR_ 3f^cRY;RUV[RUVTZ^ReV6_X]R_U /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $ 8bbdT !#$ 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D=CD4B30HB4?C414A !! *?064B !C! ?2E:@? =8?07=A8B48=:4A0;0' A4BH?C0C82 m m H@C=5) 6D8=40B=4F9D=C0;4034AB B44:CC867C4=6A8?=?F4A 2E=B18 ?=91D54 6?B9331G1B4 !C@?BD @A:?:@?' B;384AB5=5;06 20AAH=0;;4680=24
- 2. 347A03D=kCD4B30H kB4?C414A!! ?064! 3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+ 6HODTXL,QGXVWULDO$UHD'HKUDGXQ8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU833KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV ?=BQ 270=3860A7 Aday ahead of a protest call given by farmers’ union on September 7 in Karnal, Haryana Government has decided to suspend mobile internet services in the district and impose prohibitory orders. “The mobile internet ser- vices will shut down with effect from September 6 from 12:30 am to 23:59 (midnight) on September 7. Prohibitory orders banning gathering of five or more people have been imposed in Karnal,” stated the government's orders. The farmers’ unions have announced to hold a maha- panchayat and to gherao Karnal mini secretariat on Tuesday in protest against the August 28 lathi charge on farmers in Karnal. Home Minister Anil Vij told the mediapersons on Monday that elaborate securi- ty arrangements have been made in Karnal district to maintain law and order situa- tion. He has also directed Additional Director General of Police (Law and Order) Navdeep Singh Virk to per- sonally stay in Karnal and monitor the whole situation so that the event ends peacefully. At least 40 companies of additional forces, five superin- tendent rank officials and 25 deputy superintendent rank officials along with thousands of cops have been deployed in Karnal. The Police has also made arrangements to use drones to maintain law and order situation during farmers’ protest. Vij said that for the conve- nience of the people, we have made all the arrangements, have diverted some of the routes and have also deployed sufficient force. Responding to a question regarding internet shutdown, Vij said that to prevent mis- chievous elements from taking advantage of such programmes the administration has to be careful and internet shutdown is imposed. In response to the question regarding invoking Section 144, the Home Minister said that wherever the farmers want to protest, we will allow it in a peaceful manner. A government's order issued stated, “to prevent any disturbance of peace and pub- lic order in the jurisdiction of Karnal district, said mobile internet services (2G/3G/4G/CDMA/GPRS), SMS services, including bulk SMS (excluding banking and mobile recharge) and all don- gle services etc provided on mobile networks, except voice calling, will remain suspended.” It stated that the suspen- sion of mobile internet services was ordered to stop the spread of misinformation and rumours through social media platforms such as WhatsApp, Facebook, Twitter on mobile phones and SMS. This could facilitate mobilisation of mobs that can cause serious loss of life and damage to public and private properties by indulging in arson, vandalism or other violent activities, it added. Earlier in the day, a meet- ing held between Karnal District Administration and farmers’ unions remained unsuccessful. Karnal Deputy Commissioner Nishant Kumar Yadav told the mediapersons that the demands put forth by the farmers organizations can- not be fulfilled. They (farmers) have decided to proceed with their protest call on Tuesday in Karnal. We will not allow them to gherao Karnal mini-secre- tariat and strict action will be taken against those violating law, he said. No one will be allowed to block highways and roads, he added. Will break barricades if stopped during protest: Chaduni Haryana Bhartiya Kisan Union (Chaduni) chief Gurnam Singh Chaduni on Monday said a mahapanchay- at will be held in Karnal on Tuesday, after which farmers will proceed to gherao the mini-secretariat. “Farmers will be gathering in Karnal’s New Anaj Mandi on Tuesday morning,” he said, adding their demands have not been met and they will go ahead with their protest. “We want to hold a peace- ful protest but if stopped from proceeding towards the mini- secretariat, we will be forced to break the barricades put up by police,” he said while talking to the mediapersons after the meeting in Karnal. Chaduni said that other leaders from SKM will also par- ticipate in the protest. Notably, Haryana Police had lathicharged a group of farmers disrupting traffic movement on a national high- way on August 28 while they were heading towards Karnal to protest against a BJP meeting where Chief Minister Manohar Lal Khattar was also present. Atleast 15 farmers were injured during the incident. The farmers’ unions have demanded that a murder case should be registered against IAS officer Ayush Sinha, who was caught on tape allegedly telling policemen to “break heads” of protesting farmers. Sinha, who was later trans- ferred in a reshuffle also involv- ing some other IAS officers, has now been posted as the addi- tional secretary in the Citizen Resources Information Department. The farmers’ unions have also demanded compensation of Rs 25 lakh and a job to the next of kin of a farmers who died after the lathicharge and Rs two lakh compensation for those injured. Elaborate security arrangement made, routes to be diverted: Virk ADGP (Law and Order) Navdeep Singh Virk said that the primary objective of secu- rity arrangements is to main- tain public peace and order, prevent any kind of violence, facilitate the functioning of traffic and public transport system and to safeguard the public property across the state in general and Karnal in par- ticular. IGP Karnal Range and all district Superintendents of Police (Karnal Range) have been directed to take necessary preventive and precautionary measures to maintain law and order and peace in Karnal and adjoining districts. All mea- sures would be taken to contain any kind of untoward incidents and safety of citizens, he said. In addition to making all arrangements, close coordina- tion is also being maintained with civil administration for handling the law and order sit- uation, he added. Virk further said that the main national highway No 44 (Ambala-Delhi) may see some traffic disruptions in Karnal district. Therefore, the gener- al public using NH 44 are advised to avoid journey through Karnal town or oth- erwise use alternate routes to go to their destination on September 7. All citizens are being informed about these arrangements in advance so that they are able to plan and modify their journey accord- ingly, to avoid any inconve- nience, he said. The police have planned route diversions on NH-44 between Delhi and Ambala. In case, the need arises these diversions will be brought into effect from around 9 am on Tuesday. It is proposed that for Delhi to Chandigarh route, vehicles coming from Delhi side will be allowed to reach Chandigarh via Pepsi Bridge (Panipat) via Munak to Assandh and Munak to Gagsina, via Ghoghadipur to Hansi Chowk of Karnal, via Bypass Western Yamuna Canal to Karna Lake via GT Road 44. Apart from this, light vehicles will be diverted towards Chandigarh via Madhuban, Daha, Bajida, Ghogharipur, Hansi Chowk, Bypass Yamuna Canal, Karna Lake, GT Road 44. The vehicles coming from Chandigarh side is proposed to be diverted from Pipli Chowk (Kurukshetra) via Ladwa, Indri, Bayana, Neval, Kunjpura via Nangla Megha, Meerut via Amritpur Khurd, Kairavali and Gharaunda via GT Road 44. The light vehicles will be allowed from Ramba Cut Tarawadi via Ramba Chowk Indri Road via Sangoha, Ghid, Baragaon, Neval, Kunjpura via Nangla Megha, Meerut Road via Amrutpanur Khurd, Kairavali and Gharaunda via GT Road-44. `SZ]VZ_eVc_VedfdaV_UVUac`YZSZe`cj`cUVcdZ^a`dVUZ_Rc_R] 07403550A4AB?AC4BC20;; ?=BQ B78;0 Prime Minister Narendra Modi on Monday said that Himachal Pradesh has emerged as a champion to have admin- istered the first dose of COVID vaccinetoitseligiblepopulation. He expressed hope that Himachal would also be the first state in inoculating a second dose of the Covid vaccine to its eligible population. The Prime Minister virtually interacted with healthcare workers and beneficiaries of Covid vaccina- tion program of Himachal from New Delhi. Chief Minister Jai Ram Thakur participated in the function organised at Peterhof, Shimla while BJP national president and MP Jagat Prakash Nadda and Union Minister of Information and Broadcasting Anurag Singh Thakur participated virtually from New Delhi. While congratulating the StateGovernmentandpeopleof the hill state, Modi said that the statewasabletoachievethistar- get due to effective implemen- tationoftheCOVIDvaccination drive by the State Government andpublicawareness.Himachal has become the first state in India to have administered at leastonedoseofCoronavaccine to its entire eligible population. Not only this, in the case of the second dose, Himachal has crossed almost one third of the population. This step of Himachal Pradesh has made us realise the importance of self reliance, he added. Modi appre- ciated the arrangements made by the State Government, despite the hilly terrain of the state. Himachal has ensured the fastest vaccination, without wastage of the vaccine. Mass communication and public par- ticipationareahugefactorinthe success of the vaccination cam- paign, he said. He said that today India is making a record by adminis- tering 125 crore vaccines in a day. The credit of the success goes to doctors, para-medical staffandwomenofthestate.The people of Himachal did not allow any rumour, any misin- formation to survive. In view of landslide inci- dents in the hill state, the Prime Minister suggested the state to usedronetechniqueinlandsur- vey and encourage research related to early warning system regarding landslides. Modi also emphasised on improving connectivity and usage of modern techniques in developmental works. He said that drone would prove a boon in far flung areas of the state and wouldprovebeneficialinhealth, agricultureandhorticulturesec- tors. Besides this, it can also be used in delivering life saving medicines and essential com- modities with ease in far flung areas, he added. He said that many mean- ingful results can be obtained by connecting the village and the community. Modi also spoke of successful implementation of Jal Jeevan Mission in the state and exploring the potential in the forests of Himachal espe- cially for herbs and increasing the participation of villages and self-help groups. On the occasion, he urged the farmers and horticulturists of the state to make agriculture of Himachal Pradesh organic in the next 25 years. Prime Minister also appreciated var- ious welfare and developmen- tal schemes of the state gov- ernment. 30VDV+LPDFKDOHPHUJHVDVFKDPSLRQRI RYLGYDFFLQDWLRQFDPSDLJQLQLQWHUDFWLRQ ?=BQ 270=3860A7 Days after ‘dissident’ Cabinet Ministers — Tript Rajinder Singh Bajwa and Sukhjinder Singh Randhawa — wrote a letter to Punjab Chief Minister seeking time to raise the demand for declaring Batala a district, Capt Amarinder Singh on Monday said that the “demand” was already under consideration. At the same time, the Chief Minister told his Cabinet col- leagues that he would have told them so if they had come to him “before shooting off letter”. “The demand for declaring Batala as a district is already under consideration and a final decision would be taken after due consideration of various issues involved,” said the Chief Minister, adding that he had received a similar representa- tion from another Congress leader last month and was looking into the matter. Further, there have been some reports in the media over the past few days indicat- ing that citizens of Batala have also publicly raised the demand for a new district to be carved out of their region, he pointed out. The Chief Minister expressed surprise that neither Tript nor Sukhjinder had seen the reports in the public domain nor deemed it fit to discuss the issue with him before shooting off a joint let- ter in this manner. “Had they come to me and spoken about it, I would have told them that I am already looking into the matter, and would have even consulted them in this regard,” quipped Capt Amarinder, tak- ing a dig at the two Ministers. Notably, the two Ministers have raised a banner of revolt against the Chief Minister to the extent that they had open- ly sought his removal, and even raised the matter with the state party affairs’ in-charge Harish Rawat. Bajwa had even declared that he would no longer be working under Capt Amarinder. Once known as Capt Amarinder’s staunch loyalists and supporters, both Tript and Randhawa vociferously backed his bête noire Navjot Singh Sidhu’s elevation to the party’s top post. “Rajya Sabha MP Pratap Singh Bajwa has already demanded a district status for Batala in his letter dated August 11, 2021, and had cited Batala’s historic importance and its connection with Sri Guru Nanak Dev ji, who had married Mata Sulakhni here in 1487,” said the Chief Minister. He said that he was cog- nisant of Batala’s significance to Punjab’s history and culture, as well as the public sentiment. “I would discuss the issue with various stakeholders before taking a decision,” he added. Capt Amarinder said that the State Government had identified as many as 103 places in 79 villages and 24 towns, blessed with Guru Sahib’s visit (charan chhoh) during his life- time. “Funds have been allo- cated and efforts are being made to ensure the develop- ment of each of them in dif- ferent ways,” he said, adding that a lot of thinking and con- sultation had gone into the process. 3TP]SU^aSTR[PaX]V1PcP[PPSXbcaXRc d]STaR^]bXSTaPcX^])2P_c0PaX]STa
- 3. 347A03D=kCD4B30H kB4?C414A!! ]^acW ?=BQ 347A03D= The first phase of the Parivartan Yatra of the Congress in Uttarakhand ended on Monday at Rudrapur in Udham Singh Nagar district. Enthused by the good response of the Yatra, the in-charge of Uttarakhand Congress, Devendra Yadav said that the objective of the Yatra is not merely change in Government but to usher in a radical change in the lives of the people of Uttarakhand. He said that the BJP came to power in the state by mak- ing false promises which it could not fulfil in the last four and half years of its rule. Yadav said that the BJP was only able to give three chief ministers and increase the bur- den on the economy of the state during its tenure so far. He said that the farmers of the country want the govern- ment to take back three dra- conian farm laws but the gov- ernment is not listening to them. Yadav said that the farm- ers are determined to settle scores with BJP in the assem- bly elections of the year 2022. The general secretary of All India Congress Committee (AICC) and former chief min- ister Harish Rawat said that the double engine of BJP has put the values of freedom in peril. He said that during the BJP’s rule 125 crore people have become poorer and only 125 businessmen have prospered. Rawat promised the Congress would fill 22000 vacant posts in different Government depart- ments when it comes to power in the state. He also assured the issue of land ownership in the state would also be solved within three months of assuming power. Taking a dig at the Aam Aadmi Party (AAP), Rawat said that the people who are claiming to provide free power in Uttarakhand should talk about power tariff in Delhi? The Pradesh Congress Committee (PCC) president Ganesh Godiyal said that the people of the state have made up their mind to change gov- ernment in the year 2022. He said that the Congress would focus on removing unemploy- ment when it comes to power in the state. The Leader of Opposition (LoP), Pritam Singh said that the BJP has become frightened by the huge response the Parivartan Yatra is generating among the people. The working presidents of state Congress Bhuwan Kapdi, Tilak Raj Behed, Jeet Ram, Ranjit Rawat and others were present on the occasion. deaYRdV`WARcZgRceR_JRecR`W4`_XTf]^Z_ReVd ?=BQ 347A03D= The district health depart- ment of Dehradun is now focussing on a door to door campaign for Covid-19 vacci- nation. Under this campaign, 2,100 differently-abled people have so far been vaccinated in the district. The department has also removed the compulsion of online registration on Cowin portal for vaccination in Dehradun which implies that anyone can walk in to any gov- ernment vaccination centre and get the vaccine dose. The chief medical officer (CMO) of Dehradun, Dr Manoj Upreti told mediaper- sons here on Monday that in the district 94.24 per cent peo- ple have been vaccinated with the first dose of the vaccine. Elaborating further he said that the department has taken a target to vaccinate 14,27,997 people in Dehradun district and so far 13,45,799 have received the first dose of the vaccine. He said that 4,93,733 ben- eficiaries in the district have received both doses of the vac- cine. The CMO informed that 82,198 beneficiaries in the dis- trict have not received the first dose while 9,34,224 people are needed to be inoculated with the second dose of the vaccine. Dr Upreti said that for the vaccination of differently abled persons, the health depart- ment teams are visiting their homes. He said that one can approach by sending a text or whatsApp message on the phone number 9368530756 for vaccination of any differently abled person. The CMO informed that a total of 547 vaccination centres are being organised in the dis- trict out of which 94 are in pri- vate hospitals. The department has field- ed 109 mobile teams in the dis- trict for vaccination. These teams have so far vaccinated 1,84,000 people in the district. Dr Upreti said that the district has 3,35,720 doses of Covishield and 23,466 doses of Covaxin in its stock ?=BQ 347A03D= The state health department reported 25 new cases of the novel Coronavirus (Covid- 19) and 35 recoveries from the disease on Monday. Death of no patient from the disease was reported on the day. The cumulative count of Covid-19 patients in the state is now at 3,43,125 while a total of 3,29,306 patients have recov- ered from the disease so far. In the state 7388 people have lost their lives to Covid -19 till date. The recovery percentage from the disease is at 95.97 while the sample positivity rate on Monday was 0.15 per cent. The state health depart- ment reported eight new patients of Covid -19 from Dehradun, four from Almora, three from Uttarkashi, two each from Champawat, Pauri and Rudraprayag and one each from Chamoli, Haridwar, Nainital and Udham Singh Nagar district on Monday. No new cases of the disease were reported from the Bageshwar, Pithoragarh and Tehri districts on the day. The state now has 379 active cases of Covid-19. Dehradun with 166 cases is at the top of the table of active cases while Pauri has 49 active cases. On Monday Tehri district became the only district in the state to have no active cases of the disease. In the ongoing vaccination drive 76,060 people were vac- cinated in 1086 sessions in the state held on Monday. As per the data of the state health department 67,91,439 people in the state have received the first dose of vaccine while 21,92,956 have received both doses of the vaccine. ?=BQ 347A03D= Amid the fear of probable third wave of pandemic of Covid- 19, the vector-borne disease dengue has started spreading its wings in the provisional State capital of Dehradun. On Monday two new cases of dengue were reported by the authorities in Dehradun taking up the tally of the affected per- sons to 14 in the district. Both these patients are from the Indira Nagar area of the city. The district vector borne diseases officer Subhash Joshi said that a team of the health department led by him visited the Indira Nagar area and engaged in the fogging and source reduction activities. He informed that a survey of 1,53,803 houses in the district has so far been done in Dehradun and the teams of department found the larvae of dengue causing mosquito in 8548 households. Apart from source reduction exercises the health department has also undertaken an aware- ness drive in which people are explained the ways to prevent the menace of dengue. Joshi said that the Aedes Aezypti, the vector of the disease, strikes during the day time and breeds in clear water. “One should wear full sleeved clothes to prevent exposure to the mosquito bite and don’t allow water to get collected in their vicinity,’’ he said. Dengue is a viral infection spread by the mosquito Aedes Aezypti popularly known as Tiger Mosquito. The symptoms of the disease are persistent high fever, rashes, headache and pain in the joints. (#!#^U3TWaPSd] aTbXST]cbePRRX]PcTS fXcW bcS^bT ! SXUUTaT]c[h PQ[TSePRRX]PcTS X]cWTXaW^Tb) 23TWaPSd] QHZRYLGFDVHV UHFRYHULHVLQ8¶NKDQG 5V_XfV dacVRUZ_XhZ_Xd Z_5VYcRUf_ Cf^]TfRPbTb ^UeTRc^aQ^a]T SXbTPbTaT_^acTS ^]^]SPh ?=BQ 347A03D= In support of their various demands, different employee organisations of Uttarakhand start- ed their agitation on Monday under the banner of Uttarakhand Officers, Employees, Teachers coordination committee. On the first day of the phased agitation, the employees held gate meetings at headquarters of irri- gation and Public Works Department (PWD) on Monday. The spokesperson of the coor- dination committee, Arun Pandey said that various organisations have come under one banner and have included their demands which are pending from years. He said that the officers, employees and teachers have great expecta- tions from the chief minister Pushkar Singh Dhami because is associated with grass roots but there is a fear that the officers hav- ing anti employee mindset can mislead him. The coordination committee is demanding that old pattern of giv- ing higher scales on completion of 10,16 and 26 years of service should be given to the employees. It also wants that the disparities affecting the Golden Health card scheme should be removed and the scheme should be operated on the lines of Central Government Health Scheme (CGHS). The employees are demanding payment of 11 per cent of Dearness Allowance (DA), relaxation in the process of promotions and restora- tion of old pension scheme. The speakers during the gate meetings warned that the if the issues raised by the coordination committee are not solves then things can perpetuate into a major labour unrest in Uttarakhand. They demanded that the govern- ment should convene a meeting of the coordination committee with- out any delay. The employees would hold gate meetings at Vikas Bhawan, offices of social welfare, employ- ment exchange and ITI on Tuesday. ?=BQ 347A03D= The Municipal Corporation of Dehradun (MCD) has collected revenue of Rs 13 lakh through its four property tax collection camps this month in which about 1000 property taxpayers have deposited the tax. In an attempt to maximise the recovery of property tax, the corporation has planned to organise eight camps in eight different locations of the city from September 1 to 15 on the orders of mayor Sunil Uniyal ‘Gama’. The municipal tax super- intendent Dharmesh Painuly said that the corporation col- lected Rs 1,10,000 through its fourth camp this month on Monday in the Dobhalwala area. The total collection through all the four camps is about Rs 12 lakh, said Dharmesh Painuly. He also informed that the corporation has collected total revenue of over Rs four crore in this financial year and this collection will possibly increase by the end of this month. He stated that September 30 will be the last date of the period of 20 per cent rebate and that the corporation is not planning to extend it further this year. The tax superintendent also added that after September 15, the tax section will contin- ue to organise camps as per the requests of the public and the councillors. ?=BQ 347A03D= The Rashtriya Swayamsevak Sangh (RSS) is doing its bit to prepare the public for the possible third wave of Covid- 19 in the state. It is training its workers and members of the public through them in the basics of how to deal with the situation. Addressing the media here on Monday, Sanjay Kumar said that the RSS has already been working on preparing the pub- lic for the possible third wave.Stating the works done by the organisation since Covid hit, he said that it is also facil- itating the training of its vol- unteers by experts including a doctor in every session- to further train the locals to pre- pare them to face the situation. The RSS is expecting to complete this training in 10,000 Gram Sabhas this month. The training will continue further to cover the whole state so that all citizens are in general prepared to tackle the situation in case the third wave arrives. Apart from this, Kumar further informed that even from a small state like Uttarakhand, about Rs 32 crore was collected in the Ram Janma Bhoomi Samarpan campaign. Himanshu Agrawal and others from RSS were also present in the Press conference. BCCT_Y^WYdcRYdd_dQS[U `_ccYRUdXYbT3_fYTgQfU 4_[^hTTPbb^RXPcX^]bbcPac_WPbTS_a^cTbc 0'FROOHFWVCODNKLQIRXUSURSHUWWD[FROOHFWLRQFDPSV Y CWTX]RWPaVT^UDccPaPZWP]S2^]VaTbb3TeT]SaPHPSPebPXScWPc cWT^QYTRcXeT^UcWTHPcaPXb]^cTaT[hRWP]VTX]6^eTa]T]cQdcc^ dbWTaX]PaPSXRP[RWP]VTX]cWT[XeTb^UcWT_T^_[T^UDccPaPZWP]S YAPfPc_a^XbTScWT2^]VaTbbf^d[SUX[[!!ePRP]c_^bcbX] SXUUTaT]c6^eTa]T]cST_PacT]cbfWT]XcR^Tbc^_^fTaX]cWT BcPcT Y7TP[b^PbbdaTScWTXbbdT^U[P]S^f]TabWX_X]cWTBcPcTf^d[SP[b^ QTb^[eTSfXcWX]cWaTT^]cWb^UPbbdX]V_^fTa YCPZX]VPSXVPccWT0P0PSX?Pach00?APfPcbPXScWPccWT _T^_[TfW^PaTR[PXX]Vc^_a^eXSTUaTT_^fTaX]DccPaPZWP]S bW^d[ScP[ZPQ^dc_^fTacPaXUUX]3T[WX. 2WXTUX]XbcTa?dbWZPaBX]VW3WPXX]PdVdaPcTbcWT]TfR^[[TRc^aPcTQdX[SX]VX]0[^aPX]cWT_aTbT]RT^UD]X^]^B0YPh 1WPcc19?bcPcT_aTbXST]cP]S;0PSP]:PdbWXZP]S^cWTab^]^]SPh ?X^]TTa_W^c^
- 4. ]PcX^]# 347A03D=kCD4B30H kB4?C414A!! ?=BQ =4F34;78 India and Australia on Monday commenced a five day naval exercise off the Australian coast as part of the 4th edition of AUSINDEX. This edition of AUSINDEX includes complex surface, sub- surface and air operations between ships, submarines, helicopters and Long Range Maritime Patrol Aircraft of the participating Navies. The Indian Navy Task Group comprises warships Shivalik and Kadmatt while Royal Australian Navy (RAN) Anzac Class Frigate, Warramunga which partici- pated in Exercise MALABAR along with the Indian navy is also part of the exercise. The participating Indian Naval Ships are the latest indigenously designed and built Guided Missile Stealth Frigate and Anti-Submarine Corvette respectively. They form part of the Indian Navy’s Eastern Fleet based at Visakhapatnam under the Eastern Naval Command. Commenced in 2015 as a bilateral maritime exercise, AUSINDEX has grown in complexity over the years and the 3rd edition of the exercise, held in 2019 in the Bay of Bengal, included anti-subma- rine drills for the first time. In the Fourth Edition, the surface units of both the coun- tries will be exercising with Rankin, a Collins Class Australian Submarine, Royal Australian Air Force P-8A and F-18A aircraft, along with inte- gral helicopters of both the Navies. The exercise will provide an opportunity for both Navies to further bolster inter-operability, gain from best practices and develop a common under- standing of procedures for Maritime Security Operations, navy officials said here on Monday.. The exercise is a true rep- resentation of Joint Guidance signed by the Chief of the Naval Staff of India and Chief of Australian Navy on August 18 this year. Thisimportantdocumentis aligned to the ‘2020 C o m p r e h e n s i v e Strategic Partnership’ between the two nations and aims to fur- ther consolidate shared com- mitment to regional and global security challenges promoting peace, security and stability in the Indo-Pacific region. The conduct of this exercise despite Covid restrictions is also a testimony of existing synergy between the participating Navies. ?=BQ =4F34;78 The defence ministry has initiated an internal probe against alleged forgery in records of officers due for promotion in the Coast Guard. A joint secretary will head the investigations into charges involving promotion to the second highest rank in the Coast Guard. The decision to initiate a probe was taken after senior officers of the ministry were sounded, sources said here on Monday adding the promotion board was also disbanded. Giving details of the alleged forgery, they said the issue surfaced in July this year when the promotion board was set up for considering a suitable can- didate for the Additional Director General-rank post. The allegation is that there were anomalies in the marks given to the officers in the doc- uments put up before the pro- motion board and the original documents with the defence ministry. Officials said this discrep- ancy could have led to a junior officer being considered for the second highest rank in the Coast Guard. If the probe finds that charges of forgery are correct, the officers concerned may also be dismissed from service, they said. The Indian Coast Guard is the youngest force and had its own cadre officer heading the service for the first time in 2016. Prior to this, the Coast Guard was headed by Vice Admirals from the Indian Navy. 7`cXVcjZ_4`Rde8fRcU ac`^`eZ`_e`SVac`SVU 8]W^dbTX]eTbcXVPcX^] ?=BQ =4F34;78 Interacting with healthcare workers and beneficiaries of the Covid-19 vaccination pro- gramme in Himachal Pradesh, Prime Minister Narendra Modi on Monday praised their efforts against the pandemic saying the State has become the ‘first State in India’ to have administered at least one dose of corona vaccine to its entire eligible population. This success has under- lined the importance of ‘Aatmvishwas’ and ‘Aatmnirbharta’, Modi said in his address through the video- conferencing. “Himachal Pradesh has emerged as a champion. It became the first State to vacci- nate 100 per cent population of its eligible population with the first dose and one-third of the population with the second dose... Himachal Pradesh has given me an opportunity to be proud. I have seen the State struggling for basic facilities but today we see them doing well. I want to congratulate and thank the Government and teams here,” Modi said in the virtual address. The Prime Minister expressed happiness that even in the remote district of Lahaul- Spiti, Himachal has been a leader in giving 100% first dose. Calling for the need to complete the vaccination drive without leniency of any kind, Prime Minister noted that all the staff members including doctors, nurses and others worked as a team to carry out the vaccination drive in the State. Modi pointed out that besides Himachal Pradesh, Sikkim, Dadra Nagar Haveli have vaccinated 100 per cent of their eligible population with the first dose of Covid-19 vac- cines. More States are about to vaccinate their population with the first dose, he said. The Prime Minister said the success of vaccination in India is the result of the spirit and hard work of its citizens. India has been vaccinating at the record speed of 1.25 crore doses a day. This means, he said that the number of vaccinations in India in one day is more than the population of many coun- tries. Modi praised doctors, ASHA workers, Aanganwadi workers, medical personnel, teachers, and women for their contribution to the vaccination campaign. Referring to recently noti- fied rules for operation of drones, Modi said these will be helpful especially in sectors like health and agriculture, opening doors for new possi- bilities ?=BQ =4F34;78 Thetopdrugregulatorbody, Drugs Controller General of India (DCGI) has approved emergency use of drug firm Hetero’s Tocilizumab for treat- ment of hospitalised adults suffering from Covid-19. Medical practitioners would be able to use the drug for treating Covid-19 in adults who receive systemic corti- costeroids, and even those whorequiresupplementaloxy- gen, non-invasive or invasive mechanical ventilation, or extracorporealmembraneoxy- genation. Tocilizumab, which is a biosimilar version of Roche’s Actemra/RoActemra, would be available in the market by September end under the brand name Tocira. In a statement, Dr P Sarathi Reddy, chairman, Hetero Group, said that the approval was “extremely cru- cial” to ensure supply security in India due to a global short- age of Tocilizumab. “We are pleased with the approval of Hetero’s Toilizumab. This demonstrates our technical capabilities and commitment towards bringing important therapeuticsrelevanttoCovid- 19 care. We will work closely withtheGovernmenttoensure equitable distribution,” Dr Reddy noted. The World Health Organization (WHO), in July, had recommended that the drug can be used for critically ill Covid-19 patients. 7XPRWP[RWP_X^] PSd[cbVXeT] bcS^bT)? C^RX[XidPQ VTcb]^SU^a TTaVT]RhdbT CWT?aXT X]XbcTa Tg_aTbbTS WP__X]TbbcWPc TeT]X]cWT aT^cTSXbcaXRc^U ;PWPd[B_XcX 7XPRWP[WPb QTT]P[TPSTaX] VXeX]V UXabc S^bT ,QGLD$XVWUDOLD VWDUWILYHGD QDYDOH[HUFLVH ?=BQ =4F34;78 An IAF plane with Defence Minister Rajnath Singh and Road Transport and Highways Minister Nitin Gadkari onboard will conduct a mock emergency landing on a national highway in Rajasthan’s Barmer this week. This exercise is part of the two ministers inaugurating the 3.5 km-long strip on the national highway in Barmer, sources said here on Monday. The highway is ready to han- dle emergency landings of the IAF’s fighter jets and other aircraft, they said. It is India’s first national highway to be used for emergency landing of IAF aircraft, they added. In October 2017, fighter jets and transport planes of the IAF had conducted mock landings on the Lucknow- Agra Expressway to show that such highways can be used by the IAF planes for landing in case of an emer- gency. Officials said experts of the National Highways Authority of India (NHAI) worked in coordination with IAF officials to develop the airstrip on the national high- way in Barmer. They said at least 12 national highways across the country besides the Barmer road are in the process of being upgraded so that they can be used as airstrips by the IAF planes in an emergency situation. The parts of the 12 national highways that will be used as airstrips are being identified and prepared, sources added. The use of highways for landing and take offs origi- nated during World War two when Germany upgraded its roads known as autobahn for such purposes to facilitate its fighter jets. Besides Germany, Sweden, South Korea, Taiwan, Switzerland, Singapore, China and some other countries have dedi- cated stretches of their high- ways and expressways to enable aircraft for landing and take-offs. In India, these dedicated stretches will also be used for facilitating relief work during natural disasters besides emergency landings. APY]PcW6PSZPaXc^W^[S ^RZTTaVT]Rh[P]SX]V^] ]PcX^]P[WXVWfPhX]1PaTa New Delhi: A Central team rushed to the viral-hit Western Uttar Pradesh has found that the majority of cases of viral fever and deaths among chil- dren in Firozabad district have been caused by dengue while a few are because of Scrub Typhus and Leptospirosis. It has recommended all fever patients to be screened for the vector-borne diseases and ensure adequate treatment. “The Central team has observed that the majority of cases are due to Dengue while a few are because of Scrub Typhus and Leptospirosis,” Union Health Secretary Rajesh Bhushan said in a letter to his counterpart in the Northern State. “Vector Indices were also found to be high with house index and container index both above50%inFirozabaddistrict,” he added. The Central team has rec- ommendedthatallfeverpatients bescreenedforDengue,Malaria ScrubTyphusandLeptospirosis, ELISA based testing facilities be strengthened,activitiesrelatedto fever survey, vector control and fever camps to continue as per micro plan, surveillance to be strengthened and admission facilities in the district hospital of Firozabad and neighbouring districts to be augmented. The other recommenda- tions include strengthening of entomological activities as per standard guidelines; Isolation beds and admission facilities in District Hospital of Firozabad and neighboring districts to be augmented. “Organise a short reorien- tation of all doctors at PHC, CHC and district hospital cum medicalcollegeofFirozabadand neighbouring districts on recent guidelines for management of dengue, scrub typhus and lep- tospirosis while services of experts on infectious diseases from KGMU and similar insti- tutions may be utilized for this purpose”, said the letter. Dengue and viral fever have claimed 51 lives in over a fort- night in the Firozabad district in Uttar Pradesh. ?=BQ =4F34;78 In a bizarre incident, Air India’s Delhi-London flight, which was to depart from the IGI air- port at 2 pm on Monday, got delayed for more than three hours after a swarm of ants was found in the business class. Interestingly, the London- bound flight (AI-111) was car- rying Jigme Namgyel Wangchuck, the son and heir apparent of King Jigme Khesar Namgyel Wangchuck of Bhutan. According to the sources, ants were found in a section of the business class just before the plane was about to take off. The plane was replaced with anoth- er Boeing 787-8 aircraft from the Delhi airport at around 5.20 pm. Earlier, an Air India Express flight en route Saudi Arabia made an emergency landing at Kerala’s Thiruvananthapuram International airport after a crack in the windshield in July. The precautionary landing was made after about an hour of flight. The flight had no pas- sengers and was only carrying cargo and crew members. In May 2021, a bat was found inside an Air India flight to Newark (EWR) as it depart- ed from Delhi’s IGI Airport. Taking precautionary measures, the AI-105 DEL-EWR flight returned back to IGI airport due to this local standby emergency was declared. ?=BQ =4F34;78 The BJP on Monday described former BJP President Rahul Gandhi as a ‘political cuckoo’ who never makes his own nest and “depends on others” for his political success. Attacking Rahul at a press conference here, BJP spokesperson Sambtit Patra said a constantly tweeting Congress leader doesn’t believe in the hard work and tweets for the wrong reasons. “He is a political cuckoo,” quipped the BJP leader after Rahul posted a picture of an earlier farmers’ rally instead of the mahapan- chayat’s on Sunday. “He attacked the world’s biggest and the fastest vacci- nation drive that the world saw in the country but is not tweet- ing once for it...”, Patra said. ?=BQ =4F34;78 The Centre on Monday said the road infrastructure across Punjab, Haryana and Rajasthan worth C11,000 c r o r e are in a completion stage and the total highway strength of 313 km will be thrown open for the public by March 2022. During a review meeting with Road Ministry officials, central road making agency NHAI and other stakeholders, Union Road Transport and Highways Minister Nitin Gadkari said in most of the projects 80 percent works are completed and is ready for commissioning stages in many parts of the country. The meeting was con- vened to take stock of the var- ious highways, road and expressways projects which also saw participation from the State Public Works Departments (PWD), National Highway Authority of India (NHAI) and National Highway and Infrastructure Development Corporation (NHIDCL) and others. While the Minister decid- ed for a site visit for the ambitious Delhi Mumbai Expressway next week, for the poll bound Punjab, Gadkari said the six lane access controlled Ambala- Kotputli Greenfield Corridor is being constructed at record pace. Minister of State for Road Gen V K Singh was also present on the occasion of review meeting. ?=BQ =4F34;78 In a first in the world, researchers at the Indian Institute of Science Education and Research (IISER), Bhopal, have sequenced the genome of Giloy, a commonly available plant known for its medicinal properties. The genome sequence of Giloy could be a breakthrough as the potential therapeutic agent for diseases like Covid in the future. According to the team, the genome and transcriptome sequencing of Giloy (Tinospora cordifolia) is important due to its tremendous use in phar- maceuticals and ayurvedic for- mulations to treat various health conditions including Covid-19 and can provide deep insights into the genomic basis of its medicinal properties. Dr. Vineet K. Sharma, Associate Professor, Department of Biological Sciences, IISER Bhopal, said, “Giloy also has anti-microbial activity and is used in skin dis- eases, urinary tract infection, and dental plaque, among oth- ers. It is also found to reduce the clinical symptoms in HIV- positive patients and its antiox- idant activity has anti-cancer and chemo-protective proper- ties. Giloy extracts are found to be potential candidates in treat- ing various cancers like brain tumour, breast cancer, and oral cancer, as well.” The availability of Giloy genome will help in bridging the missing link between its genomic and medicinal prop- erties. This study will provide leads for exploring the genom- ic basis of its medicinal prop- erties. The Research has been published in the international preprint server for biology bioRxiv. ?=BQ =4F34;78 Chandigarh now has its first pollen calendar, which can identify potential allergy triggers and provide a clear under- standing for clinicians as well as allergy sufferers about their causes to help limit their expo- sure during high pollen loads. A group of scientists from Post Graduate Institute of Medical Education and Research (PGIMER) and Panjab University, both in Chandigarh, have developed this first of its kind calendar giving significant pollen types in Chandigarh. People can have access to the Pollen Calendar of Chandigarh through the website (https://www.care4cleanair.com /champ). The study revealed the first pollen calendar for Chandigarh to provide up-to-date informa- tion. ³^bc^UZXSbSXTS^UST]VdTX]5Xa^iPQPS´ C :Raa^PS X]UaPX]?d]YPQ 7ahAPYX]RWX]V c^R^_[TcX^] 1^dcTUQi VYWXdd_ _^T_^ BcdSh)6X[^hRP]QTdbTUd[ X]caTPcT]cPVPX]bc2^eXS 2WP]SXVPaW VTcbXcbUXabc _^[[T]RP[T]SPa APWd[6P]SWX P_^[XcXRP[ RdRZ^^)19?
- 5. ]PcX^]$ 347A03D=kCD4B30H kB4?C414A!! :D0A274;;0??0=Q 274==08 Chief Minister MK Stalin is having the last laugh watching the predicament of his predecessor Edappadi Palaniswami over the develop- ments in the AIADMK. The party founded by late M G Ramachandran and nurtured by late J Jayalalithaa had sent M Karunanidhi, Stalin’s father, into political wilderness from 2011 till he breathed his last in 2017. Karunanidhi had served a ten year exile from 1977 to 1987 when MGR was the chief minister of the State. V K Sasikala, who was appointed as the interim gen- eral secretary of the AIADMK following the demise of J Jayalalithaa in December 2016 and who had eased out O Panneerselvam from the chief minister’s seat in February 2017 in her bid to occupy the top seat has reportedly patched up with the latter recently. She called on Panneerselvam at a private hospital in Chennai where his wife Vijayalakshmi breathed her last. Sasikala’s nephew and heir apparent TTV Dhinakaran too visited the Periyakulam residence of Panneerselvam to console him over the bereavement. These developments come at a time when Panneerselvam and Palaniswami are drifting away from each other. Caste is the binding factor in Tamil Nadu, the Dravidian heartland. Sasikala and Panneerselvam belong to the Thevar community while Palaniswami and his associates are from the Gounder caste. Thevars are the dominant caste in southern Tamil Nadu while Gounders form majority of the western region. Though Panneerselvam had declared a “Dharmayudham” against Sasikala and her clan immedi- ately after he was ousted as chief minister, it is interesting to note that he has not uttered anything against her or other family members during the last two years. But Palaniswami is on record stating that Sasikala and her relations have no space in the AIADMK. Panneerselvam walked out of the AIADMK legislature party meeting that had elected Palaniswami as Leader of the Opposition. Tamil Nadu Government, in an unprece- dented move, brought in new investigators to probe the heist- cum-murder case of the Kodanad Estate which was jointly owned by Jayalalithaa and Sasikala, In an incident that shook political Tamil Nadu, a group of people trespassed into the Kodanad Estate in April 2017, murdered the security guard and robbed the bungalow of many sensitive documents. The main accused in the case, Kanakaraj, a driver who had been employed by Jayalalithaa, died in a mysteri- ous road accident at his native town of Salem within weeks of the heist-cum-murder. K V Sayan, another accused, who had a miraculous escape from a road accident, has reported- ly confided to the investigating team about hitherto unheard angle to the heist which top leaders of the AIADMK feel would make the needle of sus- picion point towards higher ups in the party. Most of the AIADMK observers feel that there would be a churning in the party. “It is almost certain that Panneerselvam and Sasikala would come together. Palaniswami is going to have tough days ahead as Sayan, an ally of Kanakaraj has disclosed a lot of information to the police about the Kodanad Estate case,” said Sam Rajappa, veteran scribe. The AIADMK founded in 1972 reached its zenith in 2011 as Jayalalithaa decimated the DMK in the assembly elections and 2014 Lok Sabha election. Though she returned to power in the 2016 election, the party has become a rudderless ship with her passing away. “There are no charismatic leaders in the AIADMK and time alone will tell how far the Thevar community succeeds in hold- ing together other castes like Goundars, Vanniyars and Nadars,” said Govindarajan Satyamurthy, political com- mentator. :D0A274;;0??0=Q :278 Eight more persons were diagnosed with Nipah symptoms in Kerala’s Kozhikode district on Monday, according to Health Minister Veena George. Speaking to media persons, the Minister said that 32 persons who had interacted with the 12-year-old boy, who succumbed to Nipah on Sunday, have been admitted to Medical College Hospital in Kozhikode and they are under observation. Health officials have iden- tified 251 persons who had had some kind of interaction with the deceased and efforts were on to find out more persons who might have interacted with the boy. According to Medical College Officials, the results of the samples sent to National Institute of Virology at Pune would be available by late evening. Health Department offi- cials on Monday collected the blood samples of cows, sheep and buffaloes from the sur- rounding areas to ensure that they were free from Nipah virus. Meanwhile Kerala diag- nosed 19,688 persons with Covid 19 on Monday, said Minister Veena George. The reduced numbers were due to Sunday’s lock down and the night curfew which was lift- ed only at 7 am on Monday. Samples of 1.17 lakh persons were tested and the Test Positivity Ratio was found to be 16.71 per cent. The pan- demic claimed 135 lives as Thrissur district topped the table with the highest number of Covid patients (3120). For the State to breath easy, the number of patients to be tested on Tuesday too should be in the range of 18,000 to 19,000, said a Government doctor. ?=BQ ;D2:=F Samajwadi Party chief Akhilesh Yadav has accused the Yogi Adityanath Government of being indiffer- ent to the plight of the people reeling under the impact of viral fever which has claimed many lives in several districts. He said the children were succumbing to the viral fever due to the lack of proper treatment in Government hospitals. He said a pall of gloom prevailed in Firozabad, Mathura, Mainpuri, Kanpur and Farrukhabad districts. Akhilesh Yadav, who vis- ited Agra and Firozabad on Monday, said contrary to the tall claims of the Chief Minister Yogi Adityanath that “all is well”, the government had paid no attention to restoring the public health services which had collapsed during the coronavirus pan- demic. He said dengue fever had caused havoc in west UP dis- tricts where many children had died due to the fever. He said the impact of dengue was now visible in eastern UP dis- tricts also. He said the situa- tion was no better in Lucknow as the surging crowd was unmanageable in government hospitals. The SP chief claimed that the government hospitals had run out of stock of essential medicines for the treatment of dengue. Akhilesh said due to the shortage of beds, the patients were not being admitted in hospitals. Questioning the claim of the state government about preparations for the third wave of the coronavirus out- break, he said the government hospitals were still facing shortage of beds and medi- cines. He said the viral fever had added to the woes of the poor people as they were already battered by the pandemic and now they were victims of viral fever. ?=BQ =4F34;78 The Supreme Court on Monday refused to defer the National Eligibility-cum-Entrance Test (NEET)-UG examination, scheduled for September 12, saying it does not want to interfere with the process and it will be very unfair to reschedule it. A Bench headed by Justice A M Khanwilkar said if stu- dents want to appear in multiple exams, then they need to prioritise and make a choice as there may never be a situation where everyone is satisfied with the date of exams. The apex court said however that the petitioners will be at lib- erty to make a representation before the competent authorities on the issue and the same may be decided at the earliest in accor- dance with the law. The arguments which you (counsel for petitioners) are canvassing may not be relevant for 99 per cent candidates. For one per cent candidates, the entire sys- tem cannot be put on hold, the bench, also comprising justices Hrishikesh Roy and C T Ravikumar, told advocate Shoeb Alam who was appearing for the petitioners. In a first, the NEET-UG exam 2021 will be conducted in 13 lan- guages with Punjabi and Malayam being the new additions, Union Education Minister Dharmendra Pradhan had announced in July. He had also said that a new exam cen- tre for the NEET has been opened in Kuwait. ?=BQ =4F34;78 Abhishek Banerjee, TMC MP and nephew of West Bengal Chief Minister Mamata Banerjee, appeared before the Enforcement Directorate (ED) here on Monday for question- ing in a money laundering case linked to an alleged coal pilferage scam in the State. Abhishek Banerjee, 33, arrived at the ED's office at Jamnagar house here just before 11 AM. I am ready to face inves- tigation...The agency officials are doing their work and I will cooperate with them, the MP said. The investigating officer of the case recorded his statement under provisions of the Prevention of Money Laundering Act (PMLA), offi- cials said. He represents the Diamond Harbour seat in the Lok Sabha and is the national general secretary of the Trinamool Congress (TMC). The ED has filed a crimi- nal case under the PMLA after taking cognizance of a November, 2020 FIR of the CBI relating to a multi-crore coal pilferage scam linked to Eastern Coalfields Ltd mines in the state's Kunustoria and Kajora areas in and around Asansol. Local coal operative in West Bengal, Anup Majhi alias Lala, is alleged to be the prime suspect in the case. The agency has claimed that Abhishek Banerjee was a beneficiary of funds obtained from this illegal trade. His wife Rujira was also summoned by the agency in this case on September 1 but she did not appear citing the prevailing coronavirus situation and requested the agency to instead question her in Kolkata. Some IPS officers and a lawyer linked to Abhishek Banerjee have also been sum- moned to appear on different dates this month. The ED has arrested two accused persons in the case, including Vikas Mishra, the brother of TMC youth wing leader Vinay Mishra, who is suspected to have fled the country and renounced his Indian citizenship. The other accused arrest- ed in the case early this year is former Inspector in-charge of Bankura police station Ashok Kumar Mishra. The ED had earlier claimed that the Mishra brothers received proceeds of crime worth Rs 730 crore on behalf of some influential persons and for themselves in this case involving an estimated amount of Rs 1,352 crore. The ED also filed a chargesheet in May this year in this case. Agartala: Tripura police arrested five people including a Hindutva organisa- tion leader after a 16-year-old Muslim girl tied knot with a Hindu youth remained missing for 45 days, police said on Monday. Western Tripura's Sepahijala District Superintendent of police Krishnendu Chakraborty said that the police so far arrested five people including Tapan Debnath, a Hindutva organisation leader. The girl (a class IX student) from Charilam village following love affairs willingly married to 23-year-old youth Suman Sarkar and converted to Hindu community. The couple remained untraceable since July 24. We hope to detect the girl and his fiance soon as our massivesearchoperationsareon.Debnath and his colleague Chandra Sekhar Kar had played active role in the entire devel- opment, Chakraborty told IANS. The police authority on Monday has handed over the case to the Crime Branch.After the police initially did not take any active action to rescue the girl, her father filed a complaint with the High Court. The division bench of the Tripura High Court comprising Chief Justice Akil Kureshi and Justice Satya Gopal Chattopadhyay, had directed the police to find out the girl and report to the court at the earliest but the police failed to do this so far. IANS 80=BQ 908?DA Following a complaint against a man for allegedly raping a female stray dog, the Kota police has registered an FIR. The complaint was lodged by a concerned citizen with the help of People for the Ethical Treatment of Animals (PETA) India. The Kota Superintendent of Police (SP) and the Kunadi police station house officer (SHO) were contacted to take up the issue. The FIR references Section 377 of the Indian Penal Code (IPC), which makes carnal intercourse with an animal a punishable offence with imprisonment for life, and section 11 of The Prevention of Cruelty to Animals (PCA) Act, 1960. The alleged perpetrator is on the run. Violent people often start by abusing animals and then move on to targeting human vic- tims. Therefore, this case should worry everyone, says PETA India Emergency Response Assistant Kabir Bhanu Das. PETA India has urged the Centre to include bestiality as a cognisable offence in an amend- ment to the PCA Act and to intro- duce stronger penalties for cruel- ty to animals under this Act. 80=BQ =4F34;78 The mining community of Goa — mining workers, people employed in the logis- tics industry, barges, ports, etc., is appealing to the Supreme Court, Central and State Governments to restart mining in the State before the fourth consecutive mining sea- son is gone for a toss in the state. In the interest of revival of the state economy and pro- tecting the livelihoods of min- ing dependents, immediate resurrection of mining is of utmost importance. The aver- age debt of a nuclear family in Goa is estimated to be Rs 5 lakh and the debt of the state is roughly calculated to be over Rs 20,000 crore since all the mining activities in the state have been banned. It has been close to three and a half years since all the mining activities in the state have been put on hold without a foresightedness of its effect on the people of Goa. It has affected the livelihood means for 15-20 per cent of Goans dependent on mining activi- ties. 0XVOLPJLUO PDUULHGWR+LQGX RXWKJRHV PLVVLQJKHOG 6^PbSTQcaXbX]V c^^eTaC!ZRa^aT QTRPdbT^UX]X]V QP]X]BcPcT R_S``VUW`c cRaZ_XWV^R]V decRjU`XZ_;RZafc ?ZaRY`_cZdVZ_VcR]R )^`cVdj^ae`^ReZT B0D60AB4=6D?C0Q :;:0C0 In a major relief for Bengal Opposition Leader Suvendu Adhikari — under probe by the CID in a mysterious death case of his former security guard — the Calcutta High Court on Monday direct- ed the police not to take any coercive action against him besides asking it to seek the permission of the Court before arresting him in this or any future cases. The BJP and Adhikari had been alleging vendetta politics against the Trinamool Congress Government say- ing his name had been included in the three year old case as a counter offen- sive measure against the Enforcement Directorate action in a money launder- ing case against TMC national general secretary and Chief Minister Mamata Banerjee’s nephew Abhishek Banerjee. Adhikari had been summoned by the CID to appear before it on Monday. The BJP leader however evaded appear- ance even as he moved the High Court. The instant case related to an alleged suicide committed by one of his security guards three years ago. Besides restraining the police from taking further action on the summons issued by the CID the High Court also stayed investigation in three of five cases filed against him after he quit the TMC in December 2020 to join the BJP. The court stayed probes into cases of political clash at Nandigram and a gold chain snatching case at Panskura. Adhikari’s lawyer quoting the court order said that “investigations can con- tinue in the two cases … and the police may question Suvendu Adhikari at a place and time of his choice consider- ing the fact that he is Leader of Opposition.” The State Government was think- ing of moving the Division Bench, sources said. $,$'0.DOOVHWIRUGLVLQWHJUDWLRQDVVWUDQJHWKLQJVXQIROGLQ71 E4¶d2SYZdYV3R_Vc[VV RaaVRcdSVW`cV65dRjd cVRUjW`cZ_gVdeZXReZ`_ D4cVWfdVde`UVWVc?66E C=A067D=0C70Q D108) In an effort to prevent the possible “third wave” of Covid-19 in Maharashtra, Chief Minister Uddhav Thackeray on Monday exhorted various political parties, social and cultural organisations to avoid holding programmes, celebrations, meet- ings, rallies and morchas to avoid crowds during the forthcoming festive season. In an appeal made to political parties and NGOs ahead of the 11-day Ganesh festivities, the chief minister said: “Having had the experience of two earlier waves of Covid-19, I appeal to political parties, social and cultural organisations not to hold programmes, celebrations, meetings, rallies and morchas to avoid crowds during the forthcoming festive season” “You can always celebrate festivals by following the Covid-19 protocols. Our effort should be to prevent a third wave of Covid-19 in the state. We must give top priority to public health,” Uddhav said. “As the chief minister of the state, I have put the state administration on a high alert. At the same time, I appeal to ruling and Opposition parties to take pre- cautions to avoid crowds. No one wants to enforce restrictions during the festive season. Let the people celebrate the fes- tivals well but the people should take pre- cautions to avoid a situation where the state government would have no other alternatives but to impose restrictions,” the chief minister said. Alluding to the demands by the Opposition BJP to lift all the restrictions including the ones relating to temples, Uddhav said: “I get to hear a lot of clam- our for lifting restrictions. The people who are demanding easing of restrictions should realise that we cannot play with the lives of people. Festivals come and go, but protecting the lives of people is more important. All political parties have major role to play in ensuring that peo- ple follow the Covid-19 protocols announced by the government” Meanwhile, NCP’s national spokesperson and State Minorities Affairs Minister Nawab Malik asked all political parties to heed the chief minister’s appeal in public interest and avoid all such gath- erings that attract crowds. Congress’ Rehabilitation Minister Vijay Wadettiwar indicated that the state government might impose certain restric- tions in view of an increase in the num- ber of Covid cases in the state. Opposition BJP leader Ashish Shelar hit out at the ruling MVA leaders for its “double standards”. “On one hand the state government is asking the general public to follow the Colvid-19 protocols, while on the other hand the ruling party lead- ers have been allowed to address huge ral- lies or public meetings,” Shelar said. ?=BQ ;D2:=F Addressing the State working com- mittee meeting of the BJP Mahila Morcha on Monday, BJP UP unit chief Swatantra Dev Singh kicked up a controversy by saying that it was a sin to vote for Samajwadi Party, Bahujan Samaj Party and Congress because leaders of these parties were afraid to visit temples and pay obei- sance and were afraid to chant ‘Bharat Mata ki Jai’. The statement came against the backdrop of Singh’s recent meeting with Samajwadi Party patron Mulayam Singh Yadav when the for- mer called on the veteran leader at his house to invite him for a condolence meeting to mourn the death of late chief minister of UP, Kalyan Singh. In that meeting, Yadav Senior report- edly invited Singh to join the Samajwadi Party. The BJP top leader even said that the farmers’ agitation had taken a political turn as the agitators who were earlier talking about farmers' rights, were now more interested in ousting the BJP from power. “The leaders who claim them- selves as farmers’ stand exposed now,” he said. The next assembly elections in Uttar Pradesh will be held in February-March next year. In the 2017 elections, the BJP had won 312 out of 403 seats. The SP and Congress fought the elections together but while SP managed to bag only 47 seats, the Congress was limited to a meager seven seats. Mayawati's BSP was successful in winning 19 seats. ?=BQ ;D2:=F Senior Congress leader and former Governor of Uttar Pradesh, Uttarakhand and Mizoram, Aziz Qureshi, was slapped with sedition charges for his remarks against the Yogi Adityanath Government which he termed as a “blood-sucking demon”. Qureshi had visited veteran Samajwadi Party leader Mohammad Azam Khan and his wife Tazeen Fatma at their home in Rampur district. After coming out from the courtesy meeting, the former Governor made the state- ment while speaking to media persons present there. Subsequently, an FIR was lodged against Qureshi at Civil Lines police station of Rampur on Sunday on a complaint by Bharatiya Janata party leader Akash Kumar Saxena. The complainant alleged that Qureshi's statement was divisive and could cause unrest between two com- munities and create unrest in society. The BJP leader also handed over to police a pen drive containing Qureshi's statement which was aired by various news channels. Qureshi has been charged under Sections 153A (promoting enmity between two groups on grounds of reli- gion, race), 153B (imputations, asser- tions prejudicial to national integra- tion), 124A (sedition), and 505(1)(B) (intent to cause fear or alarm to the public) of the Indian Penal Code, a senior police officer said. Qureshi is a senior Congress leader and has served as Governor of Mizoram from 2014 to 2015 and also held charge of Uttar Pradesh for some time during his tenure as governor of Uttarakhand in later years. ([*XY4XUHVKL ERRNHGIRU VHGLWLRQLQ83 1RSURVHFXWLRQRI 6XYHQGXVDQVRXUW SHUPLVVLRQ+ 19?D?d]XcRWXTUbPhbbX]c^e^cTU^aB? 1B?2^]VaTbbPbcWThS^]´ceXbXccT_[Tb 8GGKDYWHOOVSROLWLFDOSDUWLHV WRDYRLGPHHWLQJVUDOOLHV PRUFKDVFXOWXUDOHYHQWV 2E83 (C78A3F0E4C7A40C 2T]caTX]SXUUTaT]cc^_[XVWc^U _T^_[TaTT[X]Vd]STaX_PRc ^UeXaP[UTeTa)0ZWX[TbW
- 6. national outcry over the use of flagrant mercenaries. The inci- dent became symbolic of America’sconsistentinabilityto comprehendwhythe‘liberated’ populace hated the American presence,albeitundertheguise of ‘contract combatants’ like Blackwater, who refused to comply by the laws and restraintsinciviclifethattheUS wastryingtoproject,butfailing. As Blackwater contractors had initially tried to wriggle out of justice citing inapplicability of local laws, the locals perceived this highhandedness as that of not just the contractors them- selves,butofsovereignUS’sself- ishness and unconcernedness. The ‘divide’ in opinions about the US military’s foreign inter- vention and intention never bridged between the ground perceptions in conflict zones and mainland USA, as both sides imagined a different real- ity. The contractors were often considered far more ruthless and insensitive towards local sentiments than professional soldiers, and they got embold- ened by the deliberate impuni- ty afforded onto their conduct. Erik Prince, founder of Blackwater, later proposed a brazen $5 billion plan in 2018 that envisaged replacing US Military with private forces — while that plan got shot down, today he is accused of profiting off desperate people who were tryingtogetoutofAfghanistan by selling inflated tickets on charteredflights.Profit-motive thatisinherentinanycorpora- tised setup showed its cold face even amid such humiliating retreat.Aformerdistinguished soldier who served in Trump’s Cabinet,GenJamesMattis,had presciently warned: “When Americans put their nation’s credibility on the line, privatis- ingitisprobablynotawiseidea.” Theideaofcontractwarpolicy isfraughtwiththeriskofgetting ‘sold out’ in case a better deal comesalong—thereisnoplace for patriotism or ideology for a ‘Soldier of Fortune’. Russia’s Wagner Group is a similar‘Company’whichoffers plausible deniability to the Russian expansionism across continents.Asthebattlegrounds of Middle East and Central Asiagetsneakierandasymmet- ric,theutilityofmercenariesto operategotirresistibleand,per- ceptively, cost effective. Today, there are specialist contractors who cater to specific clients, such as Malhama Tactical, the first-of-its-kind Jihadi private militarycontractorandconsul- tant,whoseservicesareavailable to any terror group or puritan- ical regime! The global securi- ty market is awash with prod- ucts and services that can the- oretically do the needful with- out attracting international attention, legality or opprobri- um. The post-Afghanistan world will introspect many existing models and options of conductingthe‘interventionist’ rolesinadiscreetandcost-effec- tivemanner—sadly,themush- rooming industry of corpora- tised security solutions will get an inevitable fillip, irrespective ofthedownsideofthisphenom- enon. This can metastasise the alreadycomplexdomainofthe terror industry as the ‘control lever’ in such operations is either very limited or suscepti- bletofleeting‘counter-opportu- nities’.Thefailureofconvention- alforces,foreignpolicyoreven domesticpoliticalcompulsions should not give rise to even moresurreptitious,recklessand uncontrolledcorporateoptions. Byitsinherentconstruct,itcan alsobemisusedtowardsdimin- ishing the tenets of democracy andbluntinginternalopposition as the services of such entities are domain agnostic — only, profit is king. Prevailing global securitysituationwarrantsless- er weaponry in private hands; privatising combatants only adds to the complexity. (The writer, a military vet- eran, is a former Lt Governor of Andaman Nicobar Islands and Puducherry. The views expressed are personal.) CD19µC75CDEB5 Sir — It delights us to see Tamil Nadu Chief Minister MK Stalin changing the political culture in the State for the bet- ter. He has allowed the distribution of 65 lakh school bags embossed with the pic- tures of former AIADMK Chief Ministers; J Jayalalithaa and E Panneerselvam. What has made it a mag- nanimous gesture is that having their pic- ture is otherwise regarded as a privilege of the incumbent Chief Minister. It was to his credit that Stalin, as the sitting Chief Minister, did not superimpose his picture on those of the ex-Chief Ministers. A leader worth his salt, Stalin has put pub- lic service above personal fame and polit- ical rancour. His gesture was in sharp contrast to the insistence of the AIADMK Government to print the picture of Amma on the relief materials supplied by NGOs in the aftermath of natural disas- ters. It also stands out at a time when attempts are being made to erase the memories of national leaders like Jawaharlal Nehru for ideological reasons. It is also noteworthy that Stalin has asked his party’s men to refrain from spending their time and energy on eulogising him to inveigle themselves into his affections. Those leaders who wallow in being praised to the skies would do well to fol- low his example. G David Milton | Tamil Nadu 1D?EB1=5D7?5G5 Sir — The world’s biggest sporting event for the specially abled saw India excel. With five gold, eight silver and six bronze medals, our para athletes demon- strated their capabilities and proved that they have high spirit and enthusiasm, despite their physical inabilities. The Tokyo Paralympics was a record-break- ing campaign for India. It must be noted that since making its first appearance at the Paralympics in 1968, India had won only 12 medals in total till the 2016 Rio edition. It is a matter of pride that a bunch of indomitable Indian para athletes sub- stantially increased the medal tally, fol- lowing the footsteps of the Indian con- tingent in the Tokyo Olympics. It must be admitted that the “Khelo India” scheme launched by the Government in 2017 had provisions for promoting sports, among specially abled sportspersons. Although there are draw- backs in the scheme, differently abled sportspersons have more access to more special facilities and coaching than before. More support from the private sector is required for the promotion of sports among the disabled which is expected to happen after a successful Tokyo Paralympics. The tournament has given hope to many people who doubt their potential because of physi- cal disabilities. Venu GS | Kollam C3µCCG971DD85329 Sir — It’s heartening to see the Supreme Court (SC) clean the dirt from the soci- ety using its judicial wave. Particularly for the CBI, the SC has sought data on the agency's success rate in court cases and is likely to evaluate its perfor- mance. A two-judge Bench of Justices SK Kaul and MM Sundresh observed that it is not enough for the agency to mere- ly register a case and investigate, but also to ensure that the prosecution is carried out successfully. It's time that the SC brings in best practices to shorten the time taken by the courts to close pending cases. The SC must also pull up investigating agencies and the police for laxity in investigations and undue delays in filing charge sheets. With due respect to the judiciary, one wants to know, who is going to evaluate the performance of the SC and other courts? It reminds me of the Bengali proverb Chalan bole suchn ke tor keno cheda (A steve laughs at the eye of a nee- dle) or pot calling the kettle black. Bidyut Kumar Chatterjee | Faridabad A 2 A 6 C H : E 9 A 2 D D : @ ? gggTQYi`Y_^UUbS_] UPRTQ^^ZR^SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaPR^SPX[h_X^]TTa 347A03D=kCD4B30H kB4?C414A!! % BT]Sh h^daU UTTSQPRZc c^) [TccTabc^_X^]TTa/VPX[R^ 8]cWTfPZT^UcWTDB_d[[QPRZUa^0UVWP]XbcP]cWTaTXbR[TPaP]S _aTbT]cSP]VTa^UcWT²R^]caPRcR^QPcP]cbX]SdbcahVTccX]VPUX[[X_ F78;4C74DB064 A4BD;CB70E4 70A3;H144= 4=2DA068=6 C740186DDB =0CDA45C748A ?A4B4=24;460;8CH 022D=C018;8CH 0:4B8C 4GCA44;H 2=E4=84=C5A 0DC7A8C84BC ?DB78=78674A =D14AB0=3 C74A41H1H?0BB 0F:F0A3 ²@D4BC8=8=6³ ;4CC4AB CC C74438CA 28?@945BB8=67 C W^dbP]Sb ^U UPaTab _a^cTbcX]V PVPX]bccWT2T]caT³bcWaTTR^]ca^eTabXP[ PVaXRd[cdaP[ [Pfb WT[S P PbbXeT PWP_P]RWPhPc PcdiPUUPa]PVPaX]DccPa ?aPSTbWc^R^]cX]dTcWTXaPVXcPcX^]PVPX]bc cWT19?CWT#d]X^][TPSTabPSTXcR[TPa cWPccWThfX[[RP_PXV]PVPX]bccWT19?X] Q^cW cWT DccPa ?aPSTbW P]S DccPaPZWP]S 0bbTQ[hT[TRcX^]bX]!!!P]SP[b^cWaTPc T]TSc^RPaah^]fXcWcWTXaPVXcPcX^]cX[[cWT !!#;^ZBPQWPT[TRcX^]bCWTad[X]V19? WPbQTR^T]Tae^dbP]SS^Tb]^cZ]^f fWPcc^S^fXcWcWTVa^fX]VP]VTaP^]V cWTUPaTabCWT2^]VaTbbP[b^e^XRTSbd_ _^ac U^a cWT PWP_P]RWPhPc fXcW _Pach [TPSTaAPWd[6P]SWXbPhX]VcWPccWTRP[[^U cadcW fPb TRW^X]V P]S P] °d]Ydbc 6^eTa]T]c±f^d[SQTU^aRTSc^[XbcT] 5PaTabPaTcWT_a^eXSTab^UcWTR^d] cahP]ScWT6^eTa]T]cRP]]^cbX[T]RTcWTXa e^XRTPVPX]bccWTUPa[PfbCWTfW^[TR^d] cahXbfXcWcWTUPaTabX]cWTUXVWcc^bPeT PVaXRd[cdaTP]SX]STP]SX]VcWTXaSdTbX] [XTd^UcWTXaWPaSf^aZCWTPWP_P]RWPh Pc fPbP[b^PPaZ^U_a^cTbcPVPX]bccWT [PcWXRWPaVT Qh cWT 7PahP]P _^[XRT X] :Pa]P[fWXRW[TUcPc[TPbc X]YdaTSCWT UPaTab_a^cTbcR^d[S_^bTcWaTPcbU^acWT 19?b _^[XcXRP[ RP_PXV] X] D? U^a cWT d_R^X]V0bbTQ[hT[TRcX^]b8cf^d[SQT f^acWbTTX]VW^fcWTbTPbbXeT_a^cTbcb fWXRW WPeT Tad_cTS PVPX] PUcTa P fWX[T f^d[SX_PRccWTR^X]V0bbTQ[h_^[[b P]SfWPcbcaPcTVhf^d[ScWT6^eTa]T]c U^[[^fc^_PRXUhcWXbfPeT^UUPaTab 1WPVfP]CWPSP]X| dQPX 6Qb]UbcµcdYbWQY^c]_]U^de] 6ROGLHUVRIQRIODJ FDUUQRDOOHJLDQFH R etreat of the US forces from Afghanistan will bring back focus on ‘con- tract combatants’, despite their inefficacy, governance and lack of morality that accompanies their shadowy usage. ‘Soldier of Fortune’isanestablishedphenom- enonthatgoeswithpopularterms as mercenaries, hired guns and legionnaires,whereintheyarenot members of any official military but fight for money in an increas- ingly corporatised framework. Sinceantiquity,foreignmercenar- ies have fought in distant lands (Greekmercenariesweredescribed as Yavanas in Indian texts). Arguably,theEastIndiaCompany was among the earliest renditions of corporate contractors (‘Company’) who further hired local mercenaries. In the 20th century, the fragile regimes of AfricaandLatinAmericabecame the favoured playing grounds for mercenaries, especially the white architypes. The recently conclud- ed US operations in Afghanistan (andtheongoingoperationsinthe Iraq-Syrianswathes)haveseenan extensive use of ‘contract combat- ants’ with names like Blackwater (now rechristened, Academi), KBR, Titan and Northbridge. Whiletheusageresultshavehard- ly been encouraging, the ambigu- ous nature of their legality, over- sight, accountability and presence makesitextremelyconvenientfor authoritiestopushinhighernum- bers, and thereby bypass awk- wardcongressional,public,multi- lateral or any other form of sover- eign‘questioning’ .Once,anunprece- dented 1,60,000 contractuals were workingintandemwiththeparal- lel ‘surged’ numbers of matching 1,60,000 US Military personnel in the Iraqi-Syrian region. Given the need to fight but withoutblood,painoraccountabil- ity — outsourcing of security has developed a global market and unleashed a dark industry where personnel are trained and armed with the latest weaponry. Importantly, their deployment numbers,actionsorevenfatalities committed/suffered, need not get recorded on the official tally. Conversely,itcanleadtosituations like the infamous 2007 Nisour Square (Baghdad) massacre of 14 civilians by security guards from Blackwater, which led to an inter- SOUNDBITE =^R^d]cahRP] Pb_XaTc^QTR^TP] TR^]^XR^aaTVX^] P[_^fTaW^dbTfWX[T QTX]VST_T]ST]c^] X_^acbc^STUT]SXcbT[U ?aTbXST]c ¯AP=PcW:^eX]S 8RP]]^cSXbR[^bT cWTTgPRcSPcT ^UP]]^d]RX]V cWTX]R^X]V 6^eTa]T]cQdc XcfX[[QTb^^]FTPaTb^[eX]V b^TcTRW]XRP[XbbdTb CP[XQP]b_^ZTb_Tab^] ¯ IPQXWd[[PWdYPWXS 8cXbP[fPhb aTUaTbWX]VfWT] P^eXTRT]caTS Pa^d]SPUTX]Xbc bc^ahXbc^[SQhcWT e^XRTb^Uf^T] 0Rc^a ¯AXRWP2WPSWP 7XPRWP[XbP_a^^U ^UW^fcWTR^d]cahb adaP[b^RXTchXb T_^fTaX]VcWT f^a[Sb[PaVTbcP]S UPbcTbcePRRX]PcX^]RP_PXV] ?aXTX]XbcTa ¯=PaT]SaP^SX AXbWPQW?P]c bW^fTSWTXb RP_PQ[T^UQPccX]VX] ^aTcWP]^]Tbch[T 0]SX]P[[UPXa]Tbb WTbS^]TXcQTU^aTPVPX]bc 0dbcaP[XPTPa[XTacWXbhTPa 5^aTa4]V[P]SRP_cPX] ¯=PbbTa7dbbPX] 7 KH.HUDODXQLWRIWKHRQJUHVVILQGVLWVHOIDWDFURVVURDGV7KHDSSRLQWPHQWRI .6XGKDNDUDQDVWKH3UDGHVKRQJUHVVRPPLWWHHFKLHIKDVRSHQHGD3DQGRUD·V ER[ZLWKVRPHRIWKHROGJXDUGVUDLVLQJWKHEDQQHURIUHYROWDJDLQVWWKHKLJK FRPPDQG2RPPHQKDQGWKHHDUROGIRUPHUKLHI0LQLVWHUDQG5DPHVK KHQQLWKDODIRUPHU/HDGHURIWKH2SSRVLWLRQERFRWWHGDQRQOLQHIXQFWLRQLQZKLFK 5DKXO*DQGKLZDVWKHFKLHIJXHVW,WVSHDNVYROXPHV DERXWWKHGLVFRQWHQWPHQWLQWKHSDUW7KHJURXVH RIKHQQLWKDODDQGKDQGWKHZHUHERWKULYDOVWLOO 6XGKDNDUDQ·VDSSRLQWPHQW
- 7. LVWKDWWKHZHUHQRWFRQ VXOWHGEWKHKLJKFRPPDQGEHIRUHUHRUJDQLVLQJWKH 'VKHQQLWKDODKDGVWDJHGDURDGVKRZIURP .DVDUDJRGLQWKHQRUWKWR7KLUXYDQDQWKDSXUDPLQWKH VRXWK LQ 'HFHPEHU WR SUHVVXUH WKHQ 0 2RPPHQKDQGWRLQGXFWKLPLQWKHRXQFLORI 0LQLVWHUV*URXSLVPDQGIDFWLRQDOLVPDUHQRWQHZ LQWKH6WDWHRQJUHVV$IDFWLRQLQWKHSDUWJRW. .DUXQDNDUDQUHPRYHGDVWKH0LQFKDUJLQJ KLPRIVKLHOGLQJWKRVHDFFXVHGLQWKHLQIDPRXV,VURVSFDVH/DWHUKHULDQ3KLOLS DWUXVWHGDVVRFLDWHRIKDQGDQG$.$QWRQGLVFORVHGWKDWWKHVSFDVHZDVD VWRUIDEULFDWHGWRRXVW.DUXQDNDUDQIURPWKH0·VFKDLU 2QHQHHGQRWJRLQWKHVHDUFKRIUHDVRQVIRUWKH´VXFFHVVLYHIDLOXUHVµRIWKHSDUW LQWKHODVWWZR$VVHPEOHOHFWLRQVKHOGLQDQG6XGKDNDUDQURVHIURPWKH UDQNVWRKLVFXUUHQWSRVLWLRQWKURXJKVKHHUKDUGZRUN,WZDV6XGKDNDUDQZKRUHYLYHG WKHRQJUHVVLQ.DQQXUGLVWULFWWKHVWURQJKROGRIWKH3,0
- 10. 7KHRQJUHVVKLJKFRPPDQGQHHGV WRLJQRUHWKHELFNHULQJEDVHFWLRQRIOHDGHUVWKDWKDVLWVRZQDJHQGD,WLVWLPHWR VKRZWKHUHEHOVWKHLUSODFHDQGRIIHU6XGKDNDUDQWKHHOERZURRPWRIXQFWLRQ , QGLDZLOOJHWDIDLUPHDVXUHRIWKHLQQHUWKLQNLQJRQ$IJKDQDIIDLUVRI3DNLVWDQKLQD DQG 5XVVLD GXULQJ WKH 6HSWHPEHU 'XVKDQEH PHHWLQJ RI WKH 6KDQJKDL RRSHUDWLRQ2UJDQLVDWLRQ62
- 11. 7KDWVKRXOGKHOS1HZ'HOKLIRUPXODWHLWVWKRXJKWV RQGHDOLQJZLWKWKHPDVZHOODVWKH7DOLEDQ,QGLDPDKDYHEHHQWKHRQORQHZLWK RXWIRUPDOFRPPXQLFDWLRQVZLWKWKH7DOLEDQZKHQWKHODWWHUFDPHWRSRZHURQ$XJXVW EXWVLQFHWKHQWKH$IJKDQJURXSKDVQRWPLVVHGDQRSSRUWXQLWWRUHDVVXUH,QGLD RQWKHWHUURULVPIURQW7KHLQLWLDWHGDIRUPDOPHHWLQJZLWK,QGLDLQ'RKDVHQGLQJ RYHUDIDLUOVHQLRUUHSUHVHQWDWLYH,QGLDQRZQHHGVWRDVVHVVWKHVWUDWHJLHVRIKLQD DQG3DNLVWDQZKLFKDUHDOUHDGLQDERDVWIXOPRGHRIIRUJLQJFORVHUOLQNVZLWKWKH 7DOLEDQ7KHQRQ$PHULFDQWURLNDRI5XVVLDKLQDDQG3DNLVWDQZLOOEHFDXWLRXVHYHQ ZDURIVHHLQJ,QGLDLQYROYHGLQ$IJKDQLVWDQ7KDWLVZKWKHLUSUHVHQFHDWWKH62 PHHWLQJLVDOOWKHPRUHFUXFLDO)RUDUJXPHQW·VVDNH LID7DOLEDQJRYHUQPHQWFDQFRQYLQFH1HZ'HOKLRI LWVVLQFHULWWRJXDUDQWHH,QGLD·VVHFXULWDQGHFR QRPLFLQWHUHVWVLWZRXOGREYLDWH,QGLD·VQHHGIRUD PHGLDWRUZLWKWKH7DOLEDQ,QGLDLVDZDUHDQGWKH 7DOLEDQLVWRRWKDWLWFDUULHVPRUHZHLJKWDQGFUHG LELOLWWKDQ3DNLVWDQLQWKHLQWHUQDWLRQDOFRPPXQL WDQGKDVWKHEDFNLQJRIWKH8QLWHG6WDWHV:KHUH KLQDLVFRQFHUQHGWKHFRXQWULVQRWJLYHQWRRSHQ OFKDOOHQJLQJ,QGLDGHVSLWHWKH/DGDNKVWDQGRII UHOLQJ LQVWHDG RQ VXEWOH PDQRHXYUHV LQ WKH 81 6HFXULWRXQFLOOLNHZKHQLWGLGQRWVXSSRUWDQ ,QGLDQVWDWHPHQWRQWHUURULVPZLWKRXWQDPLQJWKH7DOLEDQ 7RWKDWH[WHQWHYHQZLWKRXWDQIRUPDOUROHWRSODLQ$IJKDQLVWDQDWSUHVHQW ,QGLDJRHVWR'XVKDQEHQRWZLWKRXWVRPHFRQILGHQFH8QOHVVWKHUHLVDGUDVWLFFKDQJH LQLWVSROLFKLQD·VLQYROYHPHQWLQ$IJKDQLVWDQZLOOQRWEHDVGHHSDQGH[KDXVWLYH DVWKHPHGLDFODLPV$WQRFRVWZLOOLWUHSHDWWKHIROOLHVRIWKHIRUPHU8665DQGWKH 8QLWHG6WDWHV,WZLOOEHZRQGHULQJKRZLQWKHDEVHQFHRIWKH86LQ$IJKDQLVWDQ VWDELOLWRQWKHJURXQGFDQEHHQVXUHGIRUKLQHVHHFRQRPLFLQLWLDWLYHV,WPDWKLQN RIPRUHLQYHVWPHQWVRQODIWHUWKDW2IFRXUVHKLQDKDVLQYHVWHGLQFRXQWULHVZLWK DVPXFKLQVWDELOLWWKURXJKLWV%HOWDQG5RDG,QLWLDWLYHEXW$IJKDQLVWDQSRVHVGLI IHUHQWSUREOHPVKLQDZRXOGWUWROHYHUDJHILQDQFLDODLGDQGUHFRJQLWLRQDVWKHLQFHQ WLYHVIRUUHVWUDLQLQJWKH7DOLEDQ,WZLOODOVRQXGJHDOO3DNLVWDQWRPHQWRUWKH7DOLEDQ WRVHHWKDWWKHKXQJHUIRUSRZHUDPRQJWKHYDULRXVIDFWLRQVGRHVQRWHQGXSLQDQ LQWHUQDOFRQIOLFW,WZRXOGDOVRZDQW3DNLVWDQWROHDQRQWKH7DOLEDQWRUHLQLQWKH WHUURULVWJURXSVVKHOWHUHGLQ3DNLVWDQ7KHTXHVWLRQEHIRUH3DNLVWDQLVZKHWKHUWKH DOOSRZHUIXO7DOLEDQZLOOKHHGLWVGHPDQGVRUDFWLQGHSHQGHQWOOLNHKRZLWDSSHDUV WRKDYHKHGJHGLWVEHWVEKROGLQJWDONVZLWK,QGLD$QRWKHUZRUULVWKDWWKHZRUOG ZLOODOZDVKROGLWUHVSRQVLEOHIRUFRQWLQXHGLQVWDELOLWLQ$IJKDQLVWDQ ``ea`Z_e :_UZdRccRj 7KHLQILJKWLQJLQ.HUDODRQJKDVOHIWWKH VSDFHIRUDQHIIHFWLYH2SSQXQRFFXSLHG ?82D1; ?PbbT]VTabU[^dcX]V2E83P__a^_aXPcTQTWPeX^dacaPeT[^]PcaPX]]TPa?Pc]P ?C8 ,QGLDZRXOGJHWDSHHNLQWRWKHSVFKHRI3DN KLQD5XVVLDRQ$IJKDQLVWDQDWWKH62PHHW