Pioneer dehradun-english-edition-2021-06-07

1. 20?BD;4
6&B4CB8=8DC0G
5 $5A=2B
;^]S^]) CWT6Va^d_^U
[TPSX]VTR^]^XTbWPeTaTPRWTS
PWXbc^aXRPVaTTT]cc^aTU^a
cWTV[^QP[cPgbhbcTc^PZTXc
UXcU^acWTV[^QP[SXVXcP[PVT
B_TPZX]V^dcbXSTFX]UXT[S
7^dbTX];^]S^]bATVT]cb
?PaZ^]BPcdaSPhcWTDB
CaTPbdahBTRaTcPah9P]TcHT[[T]
bPXScWTX]XdaPcT^UPc
[TPbc $_TaRT]cf^d[ST]ScWT
aPRTc^cWTQ^cc^X]R^a_^aPcT
cPgPcX^]?(
=0B070B0==D=243
!8BB8=BCE4=DB
=^ccX]VWP) 5^aSTRPSTbcWT
Tg_[^aPcX^]^U^dab^[PabhbcT
[TUc^]T^U^da]TXVWQ^daX]V
_[P]TcbET]db[PaVT[h
d]Tg_[^aTS=^fcWX]VbPaT
PQ^dcc^RWP]VT8]cWT[PcTbc
P]]^d]RTT]cUa^=PbPb
b^[PabhbcTTg_[^aPcX^]
_a^VaPTcf^XbbX^]bWPeT
QTT]VXeT]cWTV^PWTPSU^a
ET]db
?=BQ ;D2:=F=4F34;78
As the second wave of the
Covid-19 pandemic abates,
the BJP has now decided to
focus on next year’s Assembly
polls, especially in Uttar
Pradesh (UP), with a massive
outreach programme involving
one lakh party workers
After the BJP and RSS
leaders held several round of
talks with Ministers and MLAs
in Lucknow to prepare the
road map for the crucial
Assembly polls and assess the
political damaged cause by the
outbreak, BJP national gener-
al secretary Radha Mohan
Singh called on UP Governor
Anandiben Patel on Sunday.
At the same time, BJP pres-
ident JP Nadda held discussions
with party general secretaries,
States-in-charge and Morcha
chiefs for two days in New
Delhi to review the relief and
awareness programme and laid
out the road map to intensify
efforts in the coming months.
The meeting between
Anandiben Patel and Radha
Mohan Singh has created more
speculation over a possible
Ministry expansion in UP
which is going to the polls in
the next seven months.
Later in the day Singh met
UP Assembly Speaker Hriday
Narayan Dikshit. Singh, how-
ever, described these meetings
as a courtesy call.
On possible Cabinet
reshuffle, he said, “There are
vacancies in the Ministry and
they can be filled. Chief
Minister Yogi Adityanath will
take a call on these vacant posts
at the appropriate time.”
The organisation and the
Government are running like
a well-oiled machine. The
Government is very popular
and there is no reason to bring
a change in the party and the
Government, he said.
Three Cabinet-rank
Ministers – Home Guard and
Family Pension Chetan
Chauhan, Technical Education
Minister Kamal Rani and
Revenue and Flood Control
Minister Vijay Kashyap – have
died of Corona. Adityanath has
so far not allocated their
Ministry to other Ministers as
additional charge.
UP with 403-members in
the State Assembly can have 60
Ministers – including Cabinet,
Independent and State
Ministers. Earlier there were 56
Ministers with four vacancies.
With the death of three min-
isters Yogi Adityanath can now
accommodate seven more
Ministers to fulfil the
Constitutional obligation.
Singh said that the party
had got a good victory in the
Panchayat polls and now the
district panchayat president
elections are to be held. “The
Panchayat election process is
not complete. Wait till the
complete election process is
over,” he said when asked
about the party's performance
in the Panchayat polls.
About his meeting with the
Governor and the Speaker he
said that it has been more than
six months since he came to
UP. During this time I could
not meet any senior leader”, he
said.
Last week, BJP's national
general secretary organisation
BL Santosh and Singh had
visited Lucknow for three days.
During their visit Santosh met
senior Ministers and both the
Deputy Chief Ministers Dinesh
Sharma and Keshav Prasad
Maurya separately.
Meanwhile, in Delhi after
the two-day meeting, Nadda
on Sunday also asked the
party's ST Morcha and Mahila
Morcha to reach out to people
with the Central Government's
schemes of Van Dhan and
Nutrition for Women and
Children.
Kisan Morcha has also
been directed to train farmers
for Farmer Producer
Organisations, according to
BJP national general secretary
Arun Singh.
?=BQ =4F34;78
The Centre on Sunday
approved the Performance
Grading Index (PGI) 2019-20
for States and Union Territories
(UTs), which is designed to
catalyse transformational
change in the field of school
education. Punjab, Chandigarh,
Tamil Nadu, Andaman and
Nicobar Islands and Kerala
occupy the highest grade of
A++. Most of the States and
UTs have improved their
grades in PGI 2019-20 com-
pared to the earlier years.
However, no one reached the
Level 1 (951 – 1,000) PGI
score category.
First published in 2019 for
the session year 2017-18, the
index aims to drive States to
undertake “multi-pronged
interventions” for optimal
school education outcomes.
“The PGI helps the
States/UTs to pinpoint the gaps
and accordingly prioritise areas
for intervention to ensure that
the school education system is
robust at every level, said
Education Minister Ramesh
Pokhriyal ‘Nishank’ in a state-
ment.
According to the report
released by Nishank, Andaman
and Nicobar Islands, Arunachal
Pradesh, Manipur, Puducherry,
Punjab and Tamil Nadu have
improved their overall PGI
scores by 10 per cent.
Andaman and Nicobar Islands,
Lakshadweep and Punjab have
shown improvement of 10 per
cent or more in the ‘Access’
domain, said a statement from
the Ministry of Education.
?=BQ =4F34;78
The Government has used
roughly C4,500 crore of the
total C35,000 crore meant for
procuring the Covid-19 vac-
cine.
“C4,488.75 crore has been
released to HLL Lifecare
Limited (the procurement
agency for the Union Health
Ministry) till date towards pro-
curement of Covid-19 vac-
cines Covishield (21 crore
doses) manufactured by M/s
Serum Institute of India and
Covaxin (7.5 crore doses)
manufactured by M/s Bharat
Biotech International Limited
at the unit cost of C157.50
including taxes (C150 + five per
cent GST),” the Government
said in its response to a Right
to Information plea filed by
activist Saurav Das.
The Government’s reply,
dated May 26, also said that ini-
tially, through the PM-Care
funds, the Government pro-
cured 5.6 crore doses of
Covishield at the unit cost of
C210 including taxes (C200 +
five per cent GST) and one
crore doses of Covaxin at the
unit cost of C309.75, including
taxes (C295 + five per cent
GST). So, the C4,488.75 crore
has been used for the procure-
ment of two Covid-19 vac-
cines at the unit cost of C157.50
including taxes (C150 + five per
cent GST).
“The procurement of the
Covid-19 vaccine and vacci-
nation is an ongoing process,
the RTI response added.
Earlier, the Supreme Court
on May 31 had asked the
Union Government to clarify
how the C35,000 crore ear-
marked in the Union Budget
for procuring vaccines had
been spent so far. Further, the
top court had asked why these
funds cannot be used for giv-
ing free vaccination for those
in the age group 18 to 44 years.
The apex court posed this
question to the Union
Government in the suo motu
case that the top court was
hearing on the coronavirus
situation in India. Apart from
calling the Government’s pol-
icy “arbitrary and irrational”,
the court also said that the
Union Government justifying
its lower prices (for vaccines)
on account of its ability to place
large purchase orders, raises the
issue as to why this rationale is
not being employed for acquir-
ing 100 per cent of the month-
ly CDL doses.
The Union Budget for the
Financial Year 2021-2022 had
earmarked C35,000 crore for
procuring vaccines. In light of
the Liberalised Vaccination
Policy, the Central Government
is directed to clarify how these
funds have been spent so far
and why they cannot be utilised
for vaccinating people aged
18-44 years, the Bench said.
BC055A4?AC4AQ =4F34;78
Delhi Chief Minister Arvind
Kejriwal on Sunday urged
the Centre to allow the State
Government to launch
doorstep ration delivery.
The CM said crowded
ration shops are corona hotspot
and these shops could poten-
tially turn into Covid-19 super-
spreader zones in the city.
Kejriwal said, If pizza,
smartphones, and garments
can be delivered to doorsteps,
then why not ration?
His reaction came a day
after the Chief Minister Office
(CMO) claimed that
Lieutenant Governor Anil
Baijal again rejected the Delhi
Government's revolutionary
doorstep delivery of ration
scheme.
However, according to L-G
office, he did not reject the
scheme but only advised that
constitutional procedure
should be followed.
In a virtual briefing,
Kejriwal said the Delhi
Government was completely
prepared to launch the scheme
in next week.
All necessary tenders
completed, and arrangements
were done, he said.
In corona times, ration
shops are corona hotspots, and
with the launch of the scheme,
many people could avoid
crowding in these shops,
Kejriwal said, adding, For the
last 75 years, ration mafia ruled
and they looted ration.
Doorstep delivery would have
been a revolutionary initia-
tive.
According to the Delhi
Government, the city current-
ly has 1.78 million ration card
holders.
Sources in the Central
Government claimed that the
reason behind rejecting this
scheme is because the ration is
provided by the Centre and the
Delhi Government cannot take
credit for it.
Appealing to Prime
Minister Narendra Modi,
Kejriwal said, Believe me, Sir,
I am not doing this work for
even the slightest credit. I have
only one aim: Somehow the
poor should get their full
ration. Please let me implement
this, and all credit will be given
to you. I will tell the whole
world that this scheme was
implemented by the Prime
Minister.
?=BQ :;:0C0
In what the BJP leadership
called Mamata Banerjee
politics of vendetta, the East
Midnapore police have lodged
an FIR against BJP leader
Suvendu Adhikari and his
brother Soumendu for alleged-
ly looting away hundreds of
tarpaulin and other relief
materials — kept to be dis-
tributed in the cyclone-hit
areas — worth several lakhs of
r u p e e s
from Contai municipal
godown.
A complaint lodged by
one Ratnadip Manna, a mem-
ber of Contai Municipal
Administrative Board, alleged
that tarpaulin worth lakhs of
rupees were taken away by
forcefully and illegally break-
ing the locks at the instance
of Adhikari and his brother
and former Municipal Chief
Soumendu Adhikari of Contai
Municipality.
The complaint was regis-
tered on a when day Rakhal
Bera a close associate of
Adhikari was arrested on
charges of extorting cash from
people promising them jobs.
He was arrested from his
Maniktala residence in North
Kolkata.
?=BQ =4F34;78
India and China hope to break
the stalemate at the Line of
ActualControl(LAC)inLadakh
during the 12th round of mili-
tary level talks likely to be held
shortly.
More than one lakh jawans
from two sides are engaged in a
stand-off for the last one year at
three friction points.
Favouring dialogue at the
military and diplomatic level,
India has all along maintained
that disengagement and de-
escalation have to be complete
from all face-off sites to ensure
long lasting peace and tran-
quility at the LAC. However,
China is not willing to do so
and has so far not given any
commitment to hasten the
process of withdrawing its
troops from the three points
namely Hot Springs, Gogra
and Depsang valley.
In fact, there is no thinning
out of troops by China since the
withdrawal from both the
armies from southern and
northern banks of the Pangong
Tso(lake)in late February.
The lake was the first place
where the stand-offs began
last year in early May when an
Indian patrol was stopped by
the Chinese.
18BF0944C10=4A944Q ;D2:=F
Iam guilty … God has pun-
ished me for my decisions,”
Radha Gobindo Pramanik, 71,
sighed as he looked around the
big hall in his house where
preparations were on for a
religious ritual.
“Corona has taken away
the people I loved the most. I
am alone in this world,” he said
with tears in his eyes.
Just 45 days ago, Pramanik
had a happy family. His wife
Mita was a chirpy and much-
loved woman. They had a
daughter Navanita, who lived
in Ghaziabad with her hus-
band.
The elderly couple was
planning to bring Navanita,
who was seven months preg-
nant, from Ghaziabad to
Lucknow. They wanted their
daughter’s first delivery to take
place in Lucknow. They had
spoken to a doctor and short-
listed the city's top nursing
home where the delivery would
take place.
“Mita was very happy
because our daughter was
going to have her first child
after nine years of marriage.
She had so many plans. Right
from the doctor to the cook she
had made all arrangements,”
Pramanik said.
On April 2, a day before
the couple went to Ghaziabad
to bring their daughter to
Lucknow, they hosted a party
at their home.
“A few days before the
proposed party, my wife had
a fever and a cough. I took her
to the doctor who gave her
medicine. Her fever came
down. We thought it to be a
seasonal viral fever.
Some of my friends sug-
gested that we should get a
Covid test done. But I refused
because I did not see any
Covid-like symptoms and her
fever came down within a
day,” Pramanik said.
On April 2, over 50 peo-
ple came to their house. Mita
greeted everyone and active-
ly took part in the celebra-
tions.
“The next day, we left for
Ghaziabad. My daughter was
very happy to see us. The
mother and daughter talked
the whole night where Mita
explained the arrangements
she had made in Lucknow for
her delivery,” he said.
The next day, Mita’s fever
returned. She was again taken
to the doctor who gave her
medicines. But her condition
deteriorated and on April 6 she
died of the infection.
“As Mita always wanted
Navanita's first baby to be
born in Lucknow, I brought
my daughter and son-in-law to
Lucknow. I was confident that
I would manage because Mita
had made all the arrange-
ments. My daughter also want-
ed to stay with me,” he said.
4`gZUdTRccVU3;A
cVRUZVdW`ca`]]d
7RIRFXVRQ
83PDMRU
RXWUHDFK
URDGPDS
3feAf_[RS
VcR]R^RVZe
e`#_UXcRUV,
5V]YZZ_eYZcU
3fjZ_XdY`edZd
`_X`Z_Xh`c
4V_ecVcVa]ZVd
e`CE:a]VR
µCFURICFU
XVHGWRJHWRYLGMDEV¶
2]]`hfde`]Rf_TYU``cdeVa
cReZ`_dTYV^V+4e`A
µ,IJDUPHQWVSL]]D
FDQEHGHOLYHUHGWR
GRRUVWHSVWKHQ
ZKQRWUDWLRQ
7:CRXRZ_de3;Ad
DfgV_UfSc`eYVc
W`cµ]``eZ_X
cV]ZVW^ReVcZR]
:_UZR4YZ_Re`Y`]U#eY
c`f_U`W^Z]ZeRcjeR]de`
UVWfdV=24eV_dZ`_d
4`gZU*
:?:?5:2
CC0;20B4B) !$#$
($$
340C7B) ''! $$%
A42E4A43) !#'(!%
!%# '!
02C8E4)!!$#
070)$' ' !$%
:´C0:0)!%($$! !!(
:4A0;0)!%' #%!
D?) %(''(
34;78) #!(!##'

2. New Delhi: Deputy Chief
Minister Manish Sisodia con-
demned the Bharatiya Janata
Party's protest against refusal of
the scheme and criticised the
Centre for not allowing it. We
want to stop the black market-
ing of ration at once so that
every household can practice
their right to basic ration, he
said.
DZd`UZRd]R^d
4V_ecVW`c_`e
R]]`hZ_XdTYV^V
/LIHUDYDJHGEYLUXVKHOLYHVWRPRXUQKLVGHDG
ER]Vd`W5VdaRZc
ARce
19?DccPa?aPSTbWX]RWPaVTAPSWP^WP]BX]VWfXcW6^eTa]^a0]P]SXQT]?PcT[
SdaX]VPTTcX]VX];dRZ]^f ?C8
?=BQ 347A03D=
The Covid-curfew, which
was to end on June 8, has
been extended by seven days
till 6 AM June 15. While most
restrictions prevalent in the
earlier phases of the Covid-cur-
few have been maintained, var-
ious relaxations have been pro-
vided for different activities.
Further, the district magis-
trates have been authorised to
grant further relaxations in
rural areas under Gram
Panchayats according to the
area specific condition of
Covid-19.
According to the standard
operating procedures issued
by the chief secretary Om
Prakash, all PDS-ration shops
will open daily during this
period from 8 AM to 12 PM.
Groceries, ration and general
stores will open on June 9 and
14 from 8 AM to 1 PM while
stationery and bookshops will
also open on these days during
the same time period.
Liquor shops will open on
June 9, 11 and 14 from 8 AM
to 1 PM though bars will
remain closed till further
orders.
Shops related to food pack-
aging, garments, tailors, opti-
cians, cycle stores, industrial
machinery, motor parts and
drycleaners will open on June
11 from 8 AM to 1 PM.
Photocopy shops and timber
merchants will be allowed to
open on June 9 from 8 Am to
1 PM.
Further, all the fruits, veg-
etables, dairies, bakeries, meat,
chicken and fish shops will
remain open daily from 8 AM
to 12 PM.
Conditions applied earlier
on arrivals from other states
will remain applicable along
with the various restrictions
and relaxations allowed for
different activities in the earli-
er phases of the Covid-curfew.
4`gZUTfcWVhVieV_UVUZ_
FeeRcRYR_USjRhVV
hZeY^`cVcV]RiReZ`_d
0;;?3BA0C8=
B7?BF8;;?4=
308;H3DA8=6
C78B?4A83
5A'0C !
?6A24A84B
A0C8=64=4A0;
BCA4BF8;;
?4==9D=4(
0=3 #5A'
0C ?
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $8bbdT $#
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D==30H9D=4 !! *?064B !C!
@A:?:@?'
DB8=380C84B
CC0:4=278=0
DA@CE#
5434A4AF8C73A0FB
5A5A4=27?4=
m
m
H@C=5)
=0CF0A=BADBB8014;0ADB
0608=BCC7A40C4=8=60;;84B
9;?G=I
D15D*
591FBB1=
! F9F139DI

3. ]PcX^]!
! # !$ %'(')
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 270=3860A7
Haryana Government on
Sunday extended the lock-
down clamped in the state by
another week till June 14, while
easing several restrictions that
were in place to curb the spread
of COVID-19.
The government has per-
mitted reopening of restau-
rants, malls and bars with
restrictions. While restaurants
and bars can function from 10
am to 8 pm with 50 percent
seating capacity, home delivery
will be permitted till 10 pm.
The government has also
allowed reopening of religious
places with 21 people at a
time. The State Government
has termed the lockdown
Mahamari Alert-Surakshit
Haryana (Epidemic Alert-Safe
Haryana).
Now, after duly consider-
ing the fact that although the
Covid positivity rate and the
number of new Covid positive
cases have declined, so as to
continue the preventive and
precautionary measures to con-
tain the Covid pandemic, the
government has decided to
extend the 'Mahamari Alert-
Surakshit Haryana' from June
7 (5 am onwards) to June 14
(till 5 am) in the state of
Haryana, an order issued by
Chief Secretary Vijai Vardhan
stated. According to the order,
“Shops other than standalone
shops are allowed to open
from 9 am to 6 pm in two
groups, namely odd and even-
shops with odd numbers on
odd dates and shops with even
numbers on even dates. Malls
are allowed to open from 10 am
to 8 pm. The restaurants and
bars (including in hotels and in
malls) are allowed to open
from 10 am to 8 pm with 50 per
cent of the seating capacity and
adopting requisite social dis-
tancing norms, regular saniti-
sation and COVID-19 appro-
priate behavioural norms.
Home delivery from hotels,
restaurants and fast food joints
is permitted until 10 pm.”
Corporate offices have also
been permitted to open with 50
per cent attendance.
Religious places are
allowed to open with 21 per-
sons at one time with the con-
dition that they follow COVID-
19 appropriate behavioural
norms, the order stated.
The gatherings in wed-
dings, funerals are allowed
upto 21 persons. Weddings
can take place at places other
than home and courts but no
movement of 'Barat' procession
will be allowed, it stated.
For gatherings other than
weddings or funerals, the max-
imum number allowed will be
50 and prior permission from
the deputy commissioner
would be required.
Apart from this, the club
houses, restaurants or bars of
the golf courses have also been
allowed to open with 50 per
cent seating capacity from 10
pm to 8pm and the visitors
shall be allowed to play in golf
courses by the management.
Notably, Haryana
Government had imposed the
lockdown in the state on May
3 in view of the prevailing
Covid-19 situation.
4PbTbRTacPX]
aTbcaXRcX^]b
9RcjR_R8`geVieV_Ud
]`TU`h_eZ]];f_V%
?=BQ 0A8CB0A270=3860A7
Amidst tight security
arrangements, the 37th
anniversary of Operation Blue
Star was observed on Sunday at
the Sikhs’ highest temporal
seat — Akal Takht — in
Amritsar. During the event,
posters of Jarnail Singh
Bhindranwale and Khalistani
flags were seen inside the
Golden Temple (Sri Harmandir
Sahib).
A large number of people
had carried banners and plac-
ards saying “Khalistan
Zindabad” and raised pro-
Khalistan slogans during the
event.
Also, the controversial
Punjabi movie actor-turned-
farmer and political activist
actor Deep Sidhu, who hit the
headlines for hoisting Sikh
religion’s flag at Red Fort along
with the Indian tricolor nation-
al, was seen at the Akal Takht.
As many as 6,000 police-
men were deployed ahead of
the anniversary on Sunday
which is also a lockdown day
in Punjab. Like every year,
several Sikh organizations this
year too had planned to reach
Akal Takht to observe the
anniversary.
A programme to mark the
event was organized by the
Shiromani Gurdwara
Parbandhak Committee
(SGPC).
Last year, the Punjab police
had imposed a lockdown to
stop people from proceeding
towards the Golden Temple
while the anniversary pro-
gramme was underway.
Operation Blue Star is used
to refer to the Indian military
action carried out between
June 1 and June 10 in 1984, in
order to capture the Sikh leader
Jarnail Singh Bhindranvale and
his followers from the buildings
of Harmandir Sahib complex in
Amritsar.
Akal Takht officiating
Jathedar Giani Harpreet Singh,
during his customary address
to the Sikh community from
the Akal Takht’s podium,
emphasized on maintaining
unity among the Sikhs while
tagging the event as “Chaurasi
(84) Da Ghallughara” (holo-
caust).
“Words like ‘Operation
Bluestar’ or ‘Saka Neelataara’
must be avoided to refer to the
event as it hurt the sentiments,”
said Akal Takht Jathedar,
amidst pro-Khalistan slogans.
The parallel Jathedar of
Akal Takht Dhyan Singh
Mand, along with 2015 Sarbat
Khalsa main organizer Jarnail
Singh Sakhira, also read out the
message.
“Like the earlier massacres
of Sikhs in 1746 and 1762 by
the Mughal empire were
termed as ‘chhota ghallughara’
and ‘vadda ghallughara’ in
which 7,000 and 35,000 Sikhs
were killed, respectively, the
1984 Army attack is nothing
short of it,” said Giani Harpreet
Singh.
Comparing the Indian
Army’s attack on the Golden
Temple and Akal Takht with
the war between the two
nations, he said: “Like, the
earlier two ‘ghallugharas’, the
third one occurred in 1984
when the Indian Army attacked
the Golden Temple, the way
China and Pakistan attacked
India in 1962 and 1965. Upon
attack, the Indian authorities
did worse than what the win-
ning forces did with the defeat-
ed nation’s citizens.”
He said that many emails
were received demanding to
term the event as “Amritsar
Sikh genocide”, but the attack
was not executed only on the
Golden Temple complex but on
37 other Sikh shrines across the
country. “It was not con-
strained to Amritsar only. In
1984, the genocide had started
on the streets of Delhi, Kanpur,
Tata Nagar, and other areas
between November 1-4. Hence,
it should be termed as ’84 da
ghallughara,” he said.
The Jathedar added that
the event could never be for-
gotten and remained like an
irreparable wound.
He said that the Sikh
organisations, be it SGPC,
DSGMC, CKD, Takht Hazur
Sahib board, Patna Sahib board
and other Sikh organisations,
should all unite keeping aside
their differences of opinion.
]cWP]]XeTabPah^U_TaPcX^]
1[dTbcPa0[PaVT]dQTa^U_T^_[T
RPaaXTSQP]]TabP]S_[PRPaSb
bPhX]V³:WP[XbcP]IX]SPQPS´P]S
aPXbTS_a^:WP[XbcP]b[^VP]b
SdaX]VcWTTeT]c
?a^:WP[XbcP]b[^VP]baPXbTSPc6^[ST]CT_[T
?=BQ 270=3860A7
Dera Sacha Sauda chief
Gurmeet Ram Rahim,
who is serving a 20-year jail
sentence in Haryana's Sunaria
jail for raping two of his disci-
ples, was on Sunday tested
positive for Covid-19.
He has been shifted to
COVID ward at Medanta
Hospital in Gurugram.
Earlier on Thursday, he
had undergone some tests at the
Post Graduate Institute of
Medical Sciences (PGIMS),
Rohtak after he complained of
abdominal pain. The 53-year-
old sect head of the Sirsa-
headquartered Dera was taken
to Medanta Hospital for further
tests on Sunday morning and
he was diagnosed Coronavirus
positive. In May, he was admit-
ted to the government hospital
after he complained of dizziness
and blood pressure fluctua-
tion. He was discharged after an
overnight stay at the hospital.
Convicted on August 25,
2017, the dera chief is serving
a 20-year jail term for the rape
of two women disciples, and
life imprisonment for the mur-
der of Sirsa-based journalist
Ram Chander Chhatrapati.
9PX[TS3TaPRWXTU
APAPWXcTbcb
_^bXcXeTU^a2^eXS
?=BQ 270=3860A7
From the next month, all the
pensioners in Punjab are set
to get the enhanced pension of
Rs 1500, instead of Rs 750. For,
the state’s Social Security,
Women and Child
Development Department has
issued a notification for the
same clearing decks for the
two-fold hike in social securi-
ty monthly pension from Rs
750 to Rs 1500 from July 1
onwards.
“The notification has
paved way for doubling the
pension for old age, handi-
capped persons, widow and
destitute women besides
dependent children in line
with the State Government's
commitment made during the
budget session this year to
ensure welfare of the deprived
sections of the society to pro-
vide financial assistance to the
tune of Rs 1,500 per
month to all eligible
beneficiaries covered
under the social
security pensions,”
said an official
spokesperson on
Sunday.
Notably, to dou-
ble the monthly pen-
sion from Rs 750 to
Rs 1,500, a budgetary
outlay of Rs 4,000 crore had
been allocated during 2021-22,
signifying an increase of 72
percent from 2020-21 bud-
getary expenditure of Rs 2,320
crore.
Meanwhile, the social secu-
rity pensions, amounting to Rs
2,089 crore, were disbursed in
2019-20; and Rs 2,277 crore in
2020-21, which is three-fold of
what was provided by the pre-
vious SAD-BJP government
in the year 2016-17 — which is
Rs 747 crore.
A total of 25.55 lakh ben-
eficiaries, including 13 lakh
beneficiaries belonging to the
Scheduled Caste, have been
provided pension during the
year 2020-21.
The Chief Minister Capt
Amarinder Singh had recent-
ly announced free education
upto graduation for all those
children orphaned in the
COVID pandemic, as well as
families that have lost their
breadwinning member from
July 1, 2021 onwards.
?=BQ 270=3860A7
Punjab Government, keeping
pace with the technology
around the globe where
Electronic Identity Cards
(eIDs) have been introduced in
numerous countries, has also
initiated the usage of eIDs
equipped with Near Field
Communication (NFC) tech-
nology for their officers or
employees through one of its
prominent entity — Punjab
Mandi Board.
Board chairman Lal Singh
said that these eIDs are
equipped with NFC technolo-
gy — a standard-based wireless
communication technology
that allows data exchange
between devices that are a few
centimeters apart — will be
used as a primary authentica-
tion tool. The NFC operates at
13.66 MHz and transfers data
at up to 424 Kbits per second.
Notably, an NFC-enabled
mobile device can act as a card
or reader or both, enabling the
user device to share informa-
tion and to prove his or her
identity.
Pointing out further, Lal
Singh said that Punjab Mandi
Board has made the beginning
by generating eIDs for its offi-
cers or employees using this
NFC technology. He also
revealed that Mandi Board
would launch this technology
next week. For this, the Human
Resource Management System
(HRMS) data has been used,
where the details of every offi-
cer or employee is stored in the
form of a service book. “Thus,
an employee will be authenti-
cated by his or her HRMS data,”
said the Mandi Board chair-
man, adding that this facility
may be further extended to
pensioners, as they are part of
the HRMS system.
He added that when used
for contactless identity, espe-
cially during the COVID-19
period, NFC-enabled mobile
phones incorporate smart chips
(called secure elements) that
allow the phones to securely
store and use the data to match
with the identity of person.
Nowadays, NFC is available as
standard functionality in
mobile phones, and allows
users to perform safe contact-
less usage, access digital content
and connect electronic devices
simply. Mandi Board secretary
Ravi Bhagat said that Punjab
Mandi Board has already
implemented the HRMS sys-
tem and now all officers or
employees are part of this sys-
tem, where salaries are also
being drawn by them through
this system only. “Thus, usage
of eIDs using NFC technology
would prove to be a milestone
for Punjab during this pan-
demic, specially whose employ-
ees are working day and night
even during lockdown or cur-
few situations, where they have
to carry their ID card,” he
said. He added that Mandi
Board-issued eIDs will serve
the twin purpose of being used
as an identity card as well as a
business card. “The person,
who is carrying this NFC card,
just needs to tap over the
smartphone to pass on his or
her details to another person.
This NFC card may also carry
his social network information
like Twitter, Facebook,
Instagram, YouTube channel
etc which can be edited by the
person concerned at their own
end anytime. Thus, in just one
tap, one can share information
without looking at his ID card,”
he said.
He further pointed out
that various government
schemes like citizen info card
or identity card, old age pen-
sion, driving license, or insur-
ance schemes etc could also be
attached with this smart e-card
to make one single platform to
access all the schemes.
“After getting required
approval from the
Government, this card can be
utilized for the benefit of citi-
zens in Punjab as well as other
parts of the country.
?d]YPQQTR^TbUXabcBcPcTc^dbT=52QPbTST83b ?d]YPQR[TPabSTRZbU^acf^U^[SWXZT
X]^]cW[h_T]bX^]Ua^9d[h
?=BQ 270=3860A7
Haryana Health Minister
AnilVijonSundaysaidthat
the state has received a propos-
al for supply of 30 million dose-
1 and 30 million dose-2 from
Pharma Regulatory Services
Limited, Malta for COVID-19
vaccination.
Thus, a proposal of 6 crore
(60 million) doses of Sputnik V
vaccine has been received by the
State Government, Vij said.
He said that the State
Government is considering this
proposal and will present it in
the cabinet meeting for final
approval.
Sharing the status of the
vaccine roll out, he said that the
administration of the COVID
vaccine is being done in the
entirestateandpeopleareensur-
ing their full participation in it.
He said that those who
have not been administered the
vaccineshouldgetitdoneasand
when their turn comes.
Notably, the State
Government had floated a glob-
al tender to procure one crore
COVID-19 vaccination. The
government aims to vaccinate
around 1.76 crore eligible peo-
ple. The beneficiaries include
1.05 crore falling in the age
group of 18 to 44 years and
remaining 71 lakh in the age
group of 45 to 60 years and
above. Thus, around 3.5 crore
vaccination doses are to be
administered to 1.76 crore ben-
eficiaries of which around 62
doses have been administered.
Since the beginning of the
vaccination drive in January, the
state has been able to fully vac-
cinate around 10 lakh people
(3.4 percent of the total popu-
lation) while about 52 lakh peo-
ple (17 percent of the total pop-
ulation) have received their first
jab of either Covaxin or
Covishield. Till June 6, a total of
around62lakhvaccinejabshave
been administered in Haryana,
which has an estimated popu-
lation of 2.9 crore.
Post Corona Care Centres
opened in Haryana
Anil Vij said that keeping in
mind the health of the patients
who have recovered from
Coronavirus, post Corona Care
Centres ‘Umang’ have been
openedingovernmenthospitals
of the state.
In ‘Umang’ Centre, the
patients who have recovered
from Corona are being treated
for post COVID complications.
Also, such patients are being
taught yoga and pranayama
otherthanconsultationbyphys-
iotherapists and doctors, Vij
said.
The Minister said that there
is a gradual decline in the
COVID-19 cases in the second
wave, however, the people
should still be cautious and vig-
ilant. One should strictly adhere
totheCOVID-relatedguidelines
soastocontainthespreadofthe
virus.Forthis,peopleofthestate
shouldensurewearingofmasks,
maintaining social distancing
and wash hands at regular inter-
vals, he added.
?a^_^bP[c^_a^RdaT%RaB_dc]XZEUa^P[cPQPbTS
_WPaPUXac^QT_dcd_X]2PQX]TcTTc)0]X[EXY
?=BQ 270=3860A7
Alarge number of farmers
led by Bharatiya Kisan
Union leader Rakesh Tikait on
Sunday continued their sit-in
at Sadar police station in
Tohana at Fatehabad district
demanding the release of two
farmers.
The BKU leader who has
been leading the protest in
front of Tohana Sadar police
station since Saturday night
announced that the protest
will continue till the arrested
farmers are released.
The decision came after a
marathon meeting between
farmer leaders and the district
administration failed to reach
a consensus over the release of
two farmer leaders -- Vikas
Sisar and Ravi Azad -- arrest-
ed on Wednesday. They were
arrested for surrounding the
home of Tohana MLA
Devendra Singh Babli of the
Jannayak Janta Party (JJP),
which is allied with the ruling
BJP.
Addressing a gathering
outside the police station on
Sunday, Tikait said the
protesting farmers will not
move from here till the time
the fellow farmers are
released. We are ready for
court arrest. We have been
telling the police to either
arrest us also or release them,
the BKU leader said.
The protesting farmers
had earlier also sought regis-
tration of a case against MLA
Babli for allegedly hurling
abuses at them.
On Saturday, the MLA
had apologised for abusive
comments made during a
spat with farmers last week
while they were protesting the
central farm laws.
Notably, Tikait, along
with some other farmer lead-
ers, had assembled at the
grain market Tohana on
Saturday night and then
marched towards the police
station.
)DUPHUVOHGE5DNHVK7LNDLWFRQWLQXH
VLWLQDW+DUDQDSROLFHVWDWLRQ
?=BQ 70;8
Protesting against the Punjab
Government for allegedly
selling COVID-19 vaccines to
the private hospitals, the Aam
Aadmi Party (AAP) leaders on
Sunday gheraoed the residence
of Punjab Health Minister
Balbir Singh Sidhu in Mohali
and burnt his effigy while rais-
ing slogans against the gov-
ernment. The leaders said that
the Capt Amarinder Singh-led
Congress Government had
procured the vaccination on
government quota and sold the
same to private hospitals at
higher prices.
The protest was led by
Deputy Leader of Opposition in
Punjab Legislative Assembly
Saravjit Kaur Manuke, MLAs
Jai Kishan Singh Rodi, Amarjit
Singh Sandoa, youth wing co-
president Anmol Gagan Mann
and senior leader Manwinder
Singh Giasarpura. The leaders
demanded that the Health
MInister should immediately
be sacked from the Punjab
Cabinet and a criminal case
should be registered against
him. Meanwhile, the Punjab
Police detained the AAP lead-
ers and workers who were
protesting and later took them
to the police station.
The leaders, while address-
ing the protesters in front of the
Minister’s residence, said that
he had proved to be a complete
failure in protecting and ensur-
ing better health facilities for
the people of Punjab during
the ongoing COVID-19 pan-
demic. “Now, the Health
Minister is cheating the people
of Punjab by selling the vacci-
nation meant for the state
people to private hospitals,”
t h e y
said.
Taking a dig, the AAP
leaders stated that the Congress
Government and Balbir Singh
Sidhu were fleecing innocent
people of the State even in this
hour of crisis. “The govern-
ment had bought the vaccine
for Rs 400 in the name of the
people of Punjab and sold it to
private hospitals for Rs 1,060
and have unethically earned
crores and have now closed the
vaccine centres claiming vacci-
nation shortage,” said Manuke.
She said that the Congress
party had come to power in
Punjab by promising to end the
mafia rule and had also
promised to take action against
the Badals, who had committed
various scams during their
tenure, but the Congress and its
Cabinet Ministers too are help-
ing the mafia to fearlessly flour-
ish in Punjab proving that
both the Badals and the
Congress are hands in gloves
when it comes to scams. Stating
that the Congress Government
has also become a government
of scams, Anmol Gagan said
that even today, the people of
Punjab are being robbed by the
sand mafia, spurious liquor
mafia, transport mafia and
fake medicines mafia.
“The people of Punjab have
become aware of the misdeeds
of the Congress Government
and in the upcoming elec-
tions of the Punjab Assembly
to be held in 2022, the people
of the state will also take
account of the vaccine scam
and show the way out to the
Congress from the state,” she
said.
11@WXUbQ_Uc
@e^ZQR8UQdX
=Y^YcdUbµcbUcYTU^SU

4. dccPaPZWP]S
! # !$ %'(')
1HAB74=30;0;
As the world reels under the
Covid pandemic, we find
that the history of diseases
dates back to the earliest times,
indicated even by the early leg-
end of Dhanvantari, an incar-
nation of the god Vishnu, who
emerged from the kshir-sagara,
the ocean of milk, carrying the
vessel of amrita, the divine
drink of immortality.
Dhanvantari is said to be the
physician of the gods, and the
first of all physicians on earth.
This legend is post-Vedic, but
diseases and their remedies can
be traced back to the Vedas
and even earlier.
Even in the Paleolithic
Age, people suffered both from
diseases and from injuries;
attempts must have been made
to cure them, to help them
heal. We don’t know what
these early attempts were but
by the Bronze Age, medicine
and systems of healing includ-
ing surgery, the use of herbs
and spiritual methods were
used in ancient Egypt, Iran,
India, Mesopotamia and other
parts of the ancient world.
In India-Pakistan, in the
Harappan civilisation (2600-
1900 BCE), some Harappan
seals and artefacts have been
interpreted from the stand-
point of medicine. Kenneth G
Zysk, an Indologist from the
University of Copenhagen,
also suggested that the exten-
sive drainage system in
Harappan cities indicated ‘a
concern for public health and
sanitation’, and that perhaps the
Great Bath at Mohenjodaro
was used for hydrotherapy,
though the latter seems unlike-
ly. On the other hand, David
Clark, in his book Germs,
Genes, and Civilization, links
the Harappan drainage system
with the spread of water-borne
diseases causing the downfall
of the civilisation.
The Rig Veda and later
Vedic Samhitas, particularly
the Atharva Veda, have refer-
ences to the healing and cur-
ing of ailments. The Rig Veda
can be dated to 1500 BCE or
earlier, while the Atharva Veda
probably dates to around 1000
BCE. Bheshaja is the term
used for medicine or a reme-
dial measure in the Vedic texts;
remedies included plants,
water, and spells. A bhishaj or
physician is frequently men-
tioned, right from the time of
the Rig Veda. Among the Vedic
gods, the Ashvins, Varuna,
and Rudra are known as
bhishaj. One hymn in the Rig
Veda (10.97) refers to a physi-
cian with his plants and heal-
ing powers. In the same text,
the Ashvins, the twin horse-
men, are the greatest healers,
who could heal the lame and
the blind, restore youth, and
even replace a leg with a metal
one. These miraculous cures
may have been mythical or
based on ancient stories and
legends. They do not exist in
the Atharva Veda, which
describes different methods
to treat illness and disease.
However, the practice of med-
icine seems to have been a pro-
fession by the time of the Rig
Veda.
The Vedic texts also reflect
a knowledge of the body and
its functions, and some knowl-
edge of human anatomy. The
Atharva Veda provides infor-
mation on the body, mentions
diseases and also indicates the
plants and herbs used to cure
these. Herbs that can cure dis-
ease are also praised in prayers
and invocations. There are
prayers to water, which has
healing powers, and to fire,
which is believed to guard
against demons. Both
pishachas and rakshasas, types
of demons, were believed to
cause diseases. Healing rituals,
accompanied by chants, are
described. Diseases, personi-
fied as demons, were sent to far
off countries or peoples, car-
ried away by birds, or trans-
ferred to the ground.
But apart from these, many
diseases are actually described
in the Vedic Samhitas, partic-
ularly in the Atharva Veda, and
a few of these are listed here.
Yakshma is a general term
indicating ‘disease’. In later
texts, yakshma is a term for
consumption but in the Vedic
Samhitas it is not used in such
a specific way. Yakshma
occurred in both human adults
and children, and in cattle,
causing pain, fever and debil-
ity.
Jayenya or jayanya is men-
tioned with jaundice and pain
in limbs. If these are its symp-
toms, it could be some kind of
liver disease. It has also been
mentioned with yakshma and
with apachit (‘skin sores’). Like
yakshma, it pervaded the
whole body. It also led to a
swollen belly.
Takman, or fever, has sev-
eral hymns related to it in the
Atharva Veda. The term tak-
man for fever is used only in
this text. Takman had several
different varieties. Some of
the fevers described are clear-
ly malarial, while others are
associated with rashes. Two
verses from an Atharva Veda
hymn are below:
‘When you, being cold,
and then again deliriously hot,
accompanied by cough, did
cause the (sufferer) to shake,
then O takman, your missiles
were terrible: from these sure-
ly exempt us!
Destroy the takman that
returns on (each) third day, the
one that intermits (each) third
day, the one that continues
without intermission, and the
autumnal one; destroy the cold
takman, the hot, him that
comes in summer, and him
that arrives in the rainy sea-
son!’ (Atharva Veda 5.22.
10,13.)
Some ailments associated
with takman in the Atharva
Veda are kasha (cough);
paman, a skin disease, which
could be an itch, eruptions or
scabs that occur with fever;
prishtyamaya, a pain in the
sides or ribs; and asharika, pos-
sibly the pain in limbs that
accompanies fever.
Balasa is mentioned sev-
eral times in the Atharva and
occasionally later. The
medieval commentators
Mahidhara and Sayana inter-
preted it as consumption; it is
said to be a kind of yakshma,
because of which bones and
joints fall apart. It causes lumps
in the armpits, suggesting a
disease associated with the
lymph glands.
Hariman mentioned in the
Rig Veda, Atharva Veda, and
elsewhere indicates yellowness
in a disease, and that is clear-
ly jaundice.
Hridroga or heart disease
is mentioned in the Rig Veda.
It seems to be the same as the
hridayamaya and hridyota
cited in the Atharva.
Kshetriya seems to be an
internal disease with multiple
symptoms. It is associated with
yakshma, and with seizure
(grahi) and evil spirits.
Rapas is mentioned in the
Rig and the Atharva, and
seems to be a term for a dis-
ease, though it has also been
translated as ‘wound’. The dis-
ease attacked the foot and
joints, particularly knees and
ankles. A crawling creature
known as ajakava was said to
live under the skin and cause
this.
Alternatively, it was caused
by polluted water or by a crea-
ture living in water.
This is just a sample of
some of the diseases men-
tioned. In addition various
terms and descriptions have
been analysed to indicate ref-
erences to eye diseases, mal-
nutrition, anaemia, various
swellings and skin disorders,
diseases caused by worms, hair
loss, stomach problems, paral-
ysis, haemorrhoids, tetanus,
convulsions, rheumatism, mus-
cular dystrophy and leprosy,
among others.
Mental diseases too were
known. Insanity of two types is
referred to: unmadita, probably
that which was self-created or
circumstantial, and unmatta,
‘demonic possession’.
Remedies included spells,
chants and the use of various
herbs, some of which are still
used in Ayurveda today.
The Atharva Veda thus
provided the basis for the
medical science of Ayurveda,
later systematised in Ayurvedic
texts that probably date to the
first few centuries CE or some-
what earlier, and include the
works of Bhela, Charaka, and
Sushruta.
Medicine was also exten-
sively studied in Buddhism
and taught in monasteries.
Bhaishajya guru is the Buddha
of healing.
Later epidemics such as
plague, cholera, or influenza
that spread across the world are
well documented, along with
the ravages caused by germs
during the invasions of the
Americas and Australia-New
Zealand, but these early texts
show that the battle against dis-
ease started very long ago.
(A PhD in ancient Indian
History, the writer lives in
Dehradun and has authored
more than ten books)
*8(672/801
7TP[cWP]SSXbTPbTX]P]RXT]c8]SXP
?=BQ 347A03D=
The downward trend in the
contagion of Covid -19 in
Uttarakhand is continuing. The
state health department report-
ed 446 new cases and 1580
recoveries from the disease on
Sunday. With this the cumula-
tive count of novel Coronavirus
(Covid-19) in Uttarakhand has
increased to 3,34,024 and
3,05,239 recoveries from the dis-
ease.
The authorities also report-
ed the death of 23 patients on
the day which increased the
death toll to 6699 in the state.
The samples of 17,568 sus-
pected patients were sent for
testing on Sunday and the sam-
ple positivity rate is at 6.74 per-
cent. The recovery percentage
from the disease in the state is
91.38 percent.
Out of the 23 deaths report-
ed on Sunday five occurred at
Government Doon Medical
College Dehradun and four at
All India Institute of Medical
Sciences (AIIMS) Rishikesh.
The authorities also added
12 deaths in the toll which had
occurred in the past but were
not reported earlier. Out of
them 10 such deaths were
reportedfromHaridwardistrict.
The provisional state capi-
tal Dehradun reported 121,
Haridwar 67, Pithoragarh 61,
Tehri 54, Udham Singh Nagar
26, Nainital 25, Chamoli and
Uttarkashi 23 each,
Rudraprayag nine, Almora
seven, Bageshwar six and
Champawat four new cases of
the disease on Sunday.
The state now has 16,125
active patients of the disease.
Haridwar is the top position in
the list of active cases with
2,544 cases.
Pithoragarh has 1675, Pauri
1643, Tehri 1414, Chamoli 1406,
Nainital 1395, Dehradun 1231,
Udham Singh Nagar 1119,
Almora 974, Champawat 597,
Uttarkashi586andRudraprayag
461 active cases of the disease.
The state now has 299
patients of Mucormycosis
(Black fungus) and out of them
47 have died while 18 have
recovered from the disease.
In the ongoing vaccination
drive 31,185 people were vacci-
nated in 321 sessions in differ-
ent parts of the state on Sunday.
A total of 6,87,404 people have
been fully vaccinated while
23,61,053 have received the first
dose of the vaccine in the
state.
?=BQ 347A03D=
In clear indication that the
second wave of the contagion
of Covid 19 in Uttarakhand is
contained to a large extent, the
positivity rate in the state has
come down to 3.19 percent in
the week ending June 5.
The positivity rate, which
is calculated by number of
positive cases divided by total
number of tests and is an indi-
cator of the spread of infection
in the population, has come
below the 5 percent mark for
the first time in the last seven
weeks in the state.
The data maintained by the
Social Development for
Communities (SDC)
Foundation suggests that the
total number of new cases and
the active cases too are at low-
est levels in the last eight and
seven weeks respectively.
The week (May 30 to June
5) is the 64th week since the
first case of the disease was
reported in the state on March
15 last year reported 6466 new
cases of the disease.
This is the lowest weekly
count since 5765 cases report-
ed in 56th week (April 4 to 10).
In the 64th week 17,305 active
cases were reported which is
the lowest figure since 15,386
active cases reported in 57th
week (April 11 to 17).
In the week ending June 5
a total of 304 deaths were
reported which is a big relief.
The highest weekly deaths were
reported 62nd week (May 16 to
22) when 1,111 deaths were
reported. In 63rd week (May
23-29), 626 deaths were report-
ed.
The founder of the SDC
foundation Anoop Nautiyal
said that good development in
the majority of parameters is
certainly a big relief.
He however added that the
only major concern is that the
testing has reduced by 22 per-
cent in 64th week when com-
pared with 63rd week.
In 64th week 2,02,426 tests
were done while 2,58, 601 tests
were conducted in the previous
week. He said that the author-
ities should continue focusing
on more tests to combat the
contagion.
3_^dQWY_^_V3_fYT!)
S_^dQY^UTY^Eµ[XQ^T/
?=BQ 347A03D=
In the recently released rank-
ings of the NITI Aayog on
Sustainable Development
Goals (SDG) marked by the
United Nations, Uttarakhand is
on third position in the coun-
try on Gross Enrollment Ratio
(GER) of the students between
18 to 23 years age group in the
enrolment in higher education
institutes. The state received 70
marks in the field of education
and is in fourth position in the
country. The United Nations
SDG is based on 16 parameters
and education is fourth among
them.
The higher education is
taken under Goal number 4.3
in the report and is associated
with Gross Enrollment Ratio
(GER) of 18 to 23 age group
youth. In this parameter
Sikkim is in first position in the
country with 53.9 marks,
Himachal Pradesh in second
spot with 39.6 and
Uttarakhand in third position
in the country with 39.1 marks.
In goal number four which is
associated with education (pri-
mary, upper primary, sec-
ondary, higher) Kerala with 80
marks is in top position in the
country followed by Himachal
Pradesh ( 74), Goa ( 71) and
Uttarakhand ( 70).
Expressing happiness at
the high rankings the state
received in SDG parameters,
the state minister for higher
education Dhan Singh Rawat
has appreciated the role of
educationists, teachers, officers
and employees of the educa-
tion department. “The high
ranking obtained by the state
in the education sector would
prove to be a milestone for the
state and would boost the
morale of the teachers and
encourage the students and
their parents,’’ he said.
?=BQ 347A03D=
Chief Minister Tirath Singh
Rawat met various Union
ministers during his visit to the
national Capital on Sunday.
Meeting the Union Health and
Family Welfare minister Dr
Harsh Vardhan, Rawat request-
ed that a branch of All India
Institute of Medical Sciences
(AIIMS) be established in the
Kumaon region in addition to
a medical college in Kotdwar.
Vardhan assured Rawat of
appropriate action in this
regard.
The chief minister also
met the Union Defence minis-
ter Rajnath Singh and thanked
him for the establishment of
one temporary Covid-care cen-
tre each in Rishikesh and
Haldwani through Defence
Research and Development
Organisation (DRDO). Stating
that these Covid care centres
have all necessary facilities, he
said that these are major devel-
opment in Uttarakhand’s health
sector. Referring to the impor-
tance of Uttarakhand, Singh
said that the border areas of the
state are also strate-
gically important.
He assured all pos-
sible help from the
centre to the state.
Rawat then met the
chief of defence
staff, general Bipin
Rawat. The duo dis-
cussed aspects relat-
ed to encouraging
defence and aero-
space manufactur-
ing in the state. A
delegation from
Uttarakhand will
soon meet the chief
of defence staff in
this regard.
Meeting the Union minis-
ter of State for Power, New and
Renewable Energy, RK Singh,
the chief minister informed
him about the works done in
green energy sector by encour-
aging solar and pine needle
projects by linking these to
employment generation. Rawat
said that the state is committed
to environmentally sustainable
energy development. He
requested that a new
policy/guidelines be framed
for the MNRE providing grant
for construction and develop-
ment of small hydro power
projects. He also sought case to
case basis viability funding for
under construction projects
like the 120 MW Vyasi project
considering the high tariff.
Singh also assured all possible
assistance from the Centre to
the State government.
The chief minister also
met the Union Jal Shakti min-
ister Gajendra Singh
Shekhawat. He informed the
minister that under the Jal
Jeevan mission more than 6.60
lakh drinking water connec-
tions have been provided in the
state. When Prime Minister
Narendra Modi had
announced this mission in
2019, the personal domestic
water connections in
Uttarakhand were eight per
cent which have now increased
to 45 per cent. The chief min-
ister also requested Shekhawat
for the cabinet committee’s
permission for the Lakhwad
project. The central govern-
ment will provide all possible
help to the state government,
assured the Union minister.
3=TYcSeccUcfQbY_ecYcceUcgYdXE^Y_^=Y^YcdUbc
?=BQ :C3F0A
The Covid-19 pandemic has
resulted in various changes
to the working and learning
arrangements of people with
many working from home or
attending classes online.
However, the increased screen
time has also increased isola-
tion among the people, say
experts.
Students and youngsters
who are spending time on
screens extensively at home
can affect their mental health
severely.
Head of department and
senior psychiatrist at govern-
ment Doon medical college, Dr
JS Rana said, “Predominantly
people are suffering from anx-
iety and due to social disrup-
tion people also suffer from
stress, depressive illness and
insomnia.”
To the students having
their first time experience of
online classes he said,
“Students were not comfort-
able in the present set of sce-
nario because they were unable
to engage socially. Since our
concentration cannot go
beyond thirty minutes so class-
es should be of shorter dura-
tion and self-directed learning
can be used which keeps stu-
dents engaged.”
He suggests indulging in
healthy habits and said,
“Breathing exercises should
be done regularly and nutri-
tious food intake is a must.
Indulge in your favourite activ-
ity, read books, listen to music,
watch movies just see and do
all those things which will
uplift your mood. Spend time
in a constructive manner
rather than indulging in inap-
propriate activities because in
this grim time when people
feel lonely and sad some are
attracted to alcohol and sub-
stance abuse which should be
avoided.”
Talking about the effects of
increased screen time, psy-
choanalyst Aditi Arora said,
“Earlier there was considerable
community communication
wherein people used to share
their interests and support
each other but now when
screen time has significantly
increased people are deeply
affected by the virtual world
and are more isolated than
before.
People who are deeply in
the virtual world are going to
have many social issues
because the virtual world does
not work in reality.”
She suggested that the cor-
porate companies that are
making people work for hours
must provide some mental
health relief from profession-
als to their employees whose
screen time has increased sig-
nificantly since lockdown.
“Mental health interven-
tion should be provided to
them at least once a week for
which they should make some
intimate groups and encourage
them to talk about their prob-
lems.”
For those people who
sometimes are not able to
share their problems with their
family or loved ones, she sug-
gests that such people should
seek help and talk about their
problems.
“If you want individual
sessions, hire a therapist or
make communities in social
media where you get to talk
about your problems or visit
some websites and blogs where
you can confess your prob-
lems,” she added.
8]RaTPbTSbRaTT]cXTRPdbX]V
P]gXTchXb^[PcX^]bPhTg_Tacb
=8C80Ph^V³baT_^ac^]
B36)D³ZWP]SaP]ZbcWXaS
X]6a^bb4]a^[[T]cAPcX^
DccPaPZWP]SXb^]
cWXaS_^bXcX^]X]cWT
R^d]cah^]6a^bb
4]a^[[T]cAPcX^^U
cWTbcdST]cb
QTcfTT] 'c^!
PVTVa^d_X]cWT
T]a^[T]cX]WXVWTa
TSdRPcX^]X]bcXcdcTb
F¶YR_UcVa`ced%%'_Vh
4`gZUTRdVd`_Df_URj

5. ]PcX^]#
! # !$ %'(')
0A270=09HC8Q =4F34;78
Making a case for vaccinat-
ing pregnant women, a
report by a group of doctors
from a Central Government
hospital in Delhi has pointed
out that it can have dual ben-
efits—both the mother and
newborn get antibodies which
have been demonstrated in
cord blood and breast milk.
Currently, a pregnant
woman is either not included
for vaccination or the policies
are not clear as the decision for
inoculation is left on the
woman herself, the report pre-
pared by doctors from
Safdarjung Hospital and
Vardhman Medical College in
Delhi said as it made a case for
their vaccination on a priority
basis in the routine protocol for
antenatal care.
“For Covid not to further
aggravate the already heavy
burden of maternal and under-
five mortality, there is a strong
case for inclusion of pregnant
women as a high priority group
for vaccination, ‘’ said the
group of medical experts led by
Dr Yamini Sarwal.
Their observation is in line
with the global studies which
have made the case for vacci-
nating pregnant women against
the influenza virus. “It is
appears to have a significant
positive effect on birth weight
in babies,” said a study pub-
lished in CMAJ (Canadian
Medical Association Journal).
Hence, evidence is emerg-
ing of the safety and efficacy of
Covid vaccination, which along
with benefits of passing on the
protection to the newborn,
call for including pregnant
women in the high priority
group for vaccination, it said.
Observing that pregnant
women are known to be at sig-
nificantly higher risk for severe
Coronavirus-related compli-
cations compared with non-
pregnant women, it said, the
issue of protecting such women
is critical.
Vaccination has emerged
as a reliable protective measure
against severe COVID-19
infection, the report noted.
Arguing for prioritisation,
the report said pregnant
women experience more severe
COVID-19 disease than non-
pregnant women.
They are more likely to
require hospitalization, admis-
sion to ICU, receive invasive
ventilation and extracorporeal
membrane oxygenation when
compared with non-pregnant
women, it said, adding, there is
a 70 per cent increased risk of
death among symptomatic
pregnant women as compared
to non-pregnant ones.
In fact, a study in
American Journal of Obstetrics
and Gynecology has said that
contracting COVID-19 while
pregnant can have deadly con-
sequences for the mother.
The study, which followed
240 pregnant women between
March and June 2020, found
that the Covid-19 mortality rate
in the pregnant women was
significantly higher when com-
pared to the Covid-19 mortal-
ity rate in similarly aged indi-
viduals within Washington
state.
The study also found that
pregnant women with Covid-
19 had 3.5 times higher Covid-
19 associated hospitalization
rate than the similarly aged
general population in
Washington state.
?=BQ =4F34;78
Seeking to counter the
Opposition, especially
Congress’ unrelenting criti-
cism of the under-construction
Central Vista project amid the
pandemic, the Ministry of
Housing and Urban Affairs on
Sunday came out with a docu-
ment titled “Myths and
Realities”, wherein it talked
about the funds for the project
and environmental issues sur-
rounding it among others.
Rebutting the Opposition
charge that the Centre was
spending C20,000 crore on the
ambitious project and the funds
could have instead been uti-
lized to fight the Covid-19
pandemic, the Ministry said:
“Till date, only two projects of
New Parliament Building with
tendered cost C862 crore and
Redevelopment of Central
Vista Avenue with tendered
cost C477 crore have been
awarded and works are under-
way. Expenditure incurred on
these 2 projects till March
2021 is C195 crore and budget
provision for 2021-22 is C790
crore.”
The ministry said that the
redevelopment plan was envis-
aged in 2019 much before the
outbreak of the pandemic. It is
a generational infrastructure
investment project, involving
multiple projects spread over
six years and the C20,000 crore
being talked about is a gross
rough estimate of all the
planned development/redevel-
opment works, the Ministry
maintained.
It also rubbished the
reports that C13,450 crore is
being incurred on new house
for Prime Minister. The esti-
mate includes multiple pro-
jects, including 10 buildings,
the ministry said, adding that
the construction work for the
Prime Minister’s residence has
not yet been tendered and no
sanction has been accorded by
the Government. “The cost for
the PM’s residential complex
has been mischievously exag-
gerated in media,” the ministry
said.
Further, the ministry
rejected the charge of diverting
funds from public healthcare
and Covid-19 response to the
Central Vista Project. The
ministry said that in Union
Budget 2020-21, there was a
137 percent increase from pre-
vious year’s budget estimate in
allocation for public healthcare
and well-being expenditure.
“C35,000 crore of the
annual allocation has been
allocated as a one-time grant
towards Covid-19 vaccination,
significantly more than the
cost of the Central Vista rede-
velopment project. Thus, the
one-time amount for vaccina-
tion for FY 2021-22 is 175%
more than the total budget for
the Central Vista project,
which is expected to be com-
pleted by 2026,” the ministry
said.
Union Minister for hous-
ing and urban affairs Hardeep
Singh Puri had recently lashed
out at the Congress for its
“bizarre” objections.
Amid demands for stop-
ping the work, the Ministry
said that doing so at this stage
will entail creating liabilities for
the government under the
existing contracts and the
workers’ interest. It also cited
inflation as a key issue if the
project is delayed.
Justifying the need for a
new Parliament house, the
Ministry said that the present
Parliament House, completed
in 1927, was never designed to
accommodate a bicameral leg-
islature for a full-fledged
democracy and it is already
highly stressed. “If the strength
of the Parliament is increased
after the freeze on its expan-
sion lifts in 2026, it will be nec-
essary to ensure that
Parliament House has the facil-
ities for a larger Parliament to
function,” the ministry’s release
said.
X]R[TPab³hcWbP]SATP[XcXTb´^eTa2T]caP[EXbcP
?=BQ =4F34;78
With the Centre and the
State continuing to be at
loggerheads, a Union Home
Ministry team, headed by a
Joint Secretary, will visit West
Bengal to assess the damage
caused by Cyclone Yaas. The
Central team, constituted by
Ministry of Home Affairs
(MHA), will visit the State for
three days for spot visits and
discussing the situation with
the State Government officials.
Recently Chief Minister
Mamata Banerjee had said that
as preliminary assessment, the
cyclone had led to a damage of
an estimated C20,000 crore to
the property and agriculture.
She had also said that 18 lakh
people were affected by the
cyclone and around 2. 21 lakh
hectares of crops and 71,560
hectares of horticulture area
suffered damage.
Prime Minister Narendra
Modi conducted an aerial sur-
vey of the cyclone-affected
area of West Bengal on May 28
and later called a review meet-
ing at the Kalaikunda air force
station.
The Chief Minister did
not attend the meeting chaired
by the Prime Minister, leading
to the Centre issuing several
notices to the Chief Secretary.
The Department of
Personnel and Training
(DoPT), the cadre controlling
ministry for the IAS officers,
summoned Chief Secretary
Alapan Bandyopadhyay for
serving in the central govern-
ment.
However, he did not come
to the capital and chose to
retire on May 31, instead of
accepting a three-month
extension sanctioned to him by
the state and Central
Government. Subsequently, he
was appointed as the chief
advisor to the State
Government by Banerjee.
6^eccTPc^eXbXc1T]VP[
c^PbbTbb³HPPb´SPPVT
2TT`cUacZ`cZeje`acVX_R_e^`eYVcdW`c[RSd+VUZTR]ViaVced
?=BQ =4F34;78
Anti-helminitic drug
Niclosamide, which has
been extensively used for treat-
ment of tapeworm’s infection
in adults as well as children, is
now being evaluated for treat-
ment of hospitalised Covid-19
patients. The Council for
Scientific and Industrial
Research (CSIR) in collabora-
tion with Laxai Life Sciences
Pvt. Ltd., has initiated Phase-
II clinical trials with this repur-
posed drug.
“Having received approval
from the drug regulator, the
clinical trial has been initiated
this week at different sites and
we hope that the trial will be
completed within 8-12 weeks.
Based on clinical evidence
generated during clinical trials
in Indian studies, emergency
use authorisation may be
sought so that more treat-
ment options are available to
Covid-19 patients,” said Dr
Ram Upadhayaya, CEO, Laxai
Life Sciences
The trial is a multi-centric,
phase-II, randomized, open
label clinical study to evaluate
its safety and tolerability for the
treatment of Covid-19 patients.
The safety profile of this
drug has been tested over time
and has been found safe for
human consumption at dif-
ferent dose levels.
Dr Ram Vishwakarma,
Advisor to DG-CSIR,
explained that in a screen to
identify drugs that can inhib-
it syncytia formation,
Niclosamide was identified as
a promising repurposed drug
by a research group from
King’s College, London, who
collaborated in this project.
“The syncytia or fused
cells observed in the lungs of
patients with Covid-19 prob-
ably results from the fusogenic
activity of the SARS-CoV-2
spike protein and Niclosamide
can inhibit syncytia forma-
tion,” he said.
Also, said Dr
Vishwakarma, independent
collaborative research between
CSIR-IIIM, Jammu and NCBS,
Bangalore has recently demon-
strated that Niclosamide is
also a potential SARS-CoV2
entry inhibitor blocking the
viral entry through pH depen-
dent endocytic pathway.
“Given these two inde-
pendent experimental stud-
ies, Niclosamide has now
emerged as a promising drug
candidate for clinical trials in
Covid-19 patients.”
Dr Srivari
Chandrashekhar, Director
CSIR-IICT Hyderabad, high-
lighted that the Active
Pharmaceutical Ingredient
(API) is being made by Laxai
Life Sciences based on
improved technology devel-
oped at IICT and the lab is a
partner in this important clin-
ical trial which could provide
cost effective therapeutic
options for patients if trial is
successful.
7ULDOVRQIRU1LFORVDPLGHIRU
KRVSLWDOLVHGRYLGSDWLHQWV
A0:4B7:B8=67Q =4F34;78
During the nearly one-
month period from May 7
to June 4, the Central para-
military forces have recorded
a downward spiral of active
cases of Covid-19 from 8,564
to 3,410, which is about 60 per-
cent decline during the period.
However, the death toll
from the pandemic increased
from 263 to 320 during the
period.
As on May 7, the paramil-
itary forces had recorded
68,998 cases of coronavirus
infection of which 60,169
patients were cured and 263
patients died due to the viral
disease.
On June 4, the total num-
ber of Covid-hit patients stood
at 81,216 including 77,486
recoveries and 320 casualties.
Till May 7, the three para-
military forces—CRPF, BSF
and CISF—recorded close to
80 percent of the total Covid
cases among the Forces that
also included the ITBP, SSB,
NDRF and NSG. The com-
bined figure of the total Covid
contractions in CRPF, BSF
and CISF was 54,782 out of
grand total of 68,998 cases
among all the seven forces.
By June 4, the total num-
ber of infected personnel rose
to 81,216 of which 65,012
cases were from CRPF, BSF
and CISF which is roughly 80
per cent of the cases across all
the seven forces. The remain-
ing 16,204 cases were from
other paramilitary forces, ITBP,
SSB, NSG and NDRF.
The CRPF has topped the
parameters of Covid infection
with 23,987 cases and 22,939
recoveries besides 122 casual-
ties. The number of active
cases as on June 4 in the CRPF
was 926 which is slightly lower
than 1,024 cases in the BSF.
?PaPX[XcPahU^aRTbaTR^aS%[Tbb
PRcXeT2^eXSRPbTbX][Pbc^]T^]cW
?=BQ =4F34;78
India reported 1,14,460 new
coronavirus infections, the
lowest in 60 days, while the
Covid-19 death at 2,677 was
the lowest in 42 days even as
the active cases also dropped
below 15 lakh, as per the data
updated at 8 am on Sunday,
said the Union Health Ministry
in a statement here.
With the fresh cases, the
total tally of coronavirus cases
in the country climbed to
2,88,09,339 while the death toll
has touched 3,46,759. Also,
20,36,311 tests were conduct-
ed on Saturday taking the total
cumulative tests conducted so
far for detection of COVID-19
in the country to 36,47,46,522.
The daily positivity has
further declined to 5.62 per
cent . It has been less than 10
per cent for 13 consecutive
days, the ministry said.
The weekly positivity rate
has declined to 6.54 per cent.
The active cases have reduced
to 14,77,799 comprising 5.13
per cent of the total infections,
while the national Covid-19
recovery rate has improved to
93.67 per cent. A net decline of
77,449 cases has been record-
ed in the COVID-19 caseload
in a span of 24 hours.
Recoveries continue to
outnumber daily new cases
for the 24th consecutive day.
The number of people who
have recuperated from the
disease surged to 2,69,84,781,
while the case fatality rate
stands at 1.20 per cent, the
data stated.
A total of 23,13,22,417
vaccine doses have been
administered so far. “A total of
1,63,85,701 COVID-19 vac-
cine doses are still available
with the states and UTs to be
administered,” it said.
India’s COVID-19 tally
had crossed the 20-lakh mark
on August 7, 30 lakh on
August 23, 40 lakh on
September 5 and 50 lakh on
September 16.It went past 60
lakh on September 28, 70
lakh on October 11, crossed
80 lakh on October 29, 90
lakh on November 20 and
surpassed the one-crore mark
on December 19.India crossed
the grim milestone of 2 crore
on May 4.
The 2,677 new fatalities
include 741 from
Maharashtra, 443 from Tamil
Nadu, 365 from Karnataka,
209 from Kerala, 120 from
Uttar Pradesh and 118 from
West Bengal.
A total of 3,46,759 deaths
have been reported so far in
the country including 99,512
from Maharashtra, 31,260
from Karnataka, 26,571 from
Tamil Nadu, 24,557 from
Delhi, 21,151 from Uttar
Pradesh, 16,152 from West
Bengal, 15,009 from Punjab
and 13,192 from Chhattisgarh.
The ministry stressed that
more than 70 per cent of the
deaths occurred due to
comorbidities.
9^TYQcUUc_gUcd^Ug
3_fYTSQcUcY^ TQic
?=BQ =4F34;78
The Congress and the BJP on
Sunday sparred over the
ongoing Twitter row. Former
Congress President Rahul
Gandhi took a swipe at the
Modi Government, saying it is
fighting for a blue tick while
leaving people to become “aat-
manirbhar” (self-reliant) to get
Covid vaccines. Hitting back,
the BJP said he should get out
of social media and work on
the ground. The BJP also asked
him to speak to Chief Ministers
of Congress-ruled States
regarding alleged scams and
irregularities in the Covid vac-
cination programme there.
Rahul’s remarks came a
day after outrage over the
removal of ‘blue tick’ badge
from the personal accounts of
Vice President M Venkaiah
Naidu and RSS’ top func-
tionaries, including Mohan
Bhagwat, by Twitter, only to
restore it later.
“The Modi government is
fighting for the blue tick. If you
want a Covid vaccine, then be
self-reliant,” he said in a sar-
castic tweet in Hindi, using the
hashtag “#Priorities”.
Taking a dig at the former
Congress chief, BJP spokesper-
son Sambit Patra said doing
politics on Twitter is his
(Rahul’s) “most important sub-
ject” and “biggest platform”.
Patra asserted that the
Modi government has done an
admirable job in spearheading
such a big inoculation pro-
gramme and providing free
ration to the poor.
For her part, Congress gen-
eral secretary Priyanka Gandhi
Vadra alleged that the Modi
government reduced oxygen
beds by 36 per cent, ICU beds
by 46 per cent, ventilator beds
by 28 per cent between
September 2020 and January
2021.
“Is the health of Indian cit-
izens less important than the
Central Vista project?” she
asked, alleging that the
Government has declared the
project as an essential service
with people working day and
night to complete it by 2023.
“When every expert in the
country, the Parliamentary
Committee on Health and their
own sero-surveys warned them
that additional beds would be
needed for an inevitable second
wave,” she said as part of her
‘ZimmedarKaun’ (Who is
responsible) campaign.
19?6^ecUXVWcX]VU^a
Q[dTcXRZ]^cX]^Rd[PcX]V
_T^_[TbPhbAPWd[
?=BQ =4F34;78
Rahul and Priyanka also
commented on the con-
troversy over Delhi
Government-run Govind
Ballabh Pant Institute of Post
Graduate Medical Education
and Research asking its nurs-
es not to converse in
Malayalam.
The hospital order has,
however, been revoked.
“Malayalam is as Indian as any
other Indian language. Stop
language discrimination,”
Rahul tweeted. Priyanka
tweeted in Malayalam saying:
“This order is a violation of the
basic values of our country. It
is racist, discriminatory and
utterly wrong.”
;P]VdPVT
SXbRaXX]PcX^]
aPRXbc)?aXhP]ZP
?=BQ =4F34;78
With climate change posing
challenges in various sec-
tors and daily life, researchers
from across the States under
the aegis of Department of
Science and Technology ( DST)
are tracing the impact of glob-
al warming on the country,
finding new ways to track the
global problem, improving the
projection of climate, its impact
as well as vulnerability to pre-
pare for the future.
For instance, Dehradun-
based researchers have found
that small-sized glaciers in
Sikkim are melting at a higher
magnitude as compared to
other Himalayan regions in a
study published in ‘Science’
conducted by the Wadia
Institute of Himalayan
Geology. Researchers from the
same institute have also found
that black carbon from agri-
cultural burning and forest
fire has alerted over the years
may influence melting of
Gangotri Glacier.
Similarly, a team of scien-
tists from IIT Kanpur has
found that aerosols like black
carbon and dust, which makes
the Indo-Gangetic Plain one of
the most polluted regions of the
world, have led to increased
incidents of high rainfall events
in the foothills of the
Himalayan Region, said a
senior official from the Union
Ministry of Science and
Technology.
In another work support-
ed by DST, IISc researchers
showed that a planetary wave
from the North Atlantic is
capable of derailing the Indian
monsoon on which the Indian
economy is heavily dependent.
In fact, Centres of excel-
lence in Climate Change in
four Indian Institute of
Technologies – Delhi, Bombay,
Kharagpur, and Madras, are
working on improving climate
projection models to make
them more comprehensive and
accurate, said the official.
For it's part, the Centres of
Excellence (CoEs) Centre for
Climate Change, IIT Delhi,
has contributed to significant
improvements to the base
model, moving towards devel-
opment of the India Centric
Climate Model (ICCM).
Connection between
monsoon and irrigation prac-
tices has been established by
DST Centre for Excellence in
Climate Studies, IIT Bombay.
They have underlined the
need for representation of
irrigation practices, farmer’s
behavior, and vegetation- land
and atmosphere interactions
to improve model predictions
and also develop agricultural
vulnerability maps at the
National level, added the
official.
Meanwhile DST Centre
for Excellence in Climate
Change Impact on Coastal
Infrastructure and the
Adaptation strategies, IIT
Madras is developing suit-
able climate change adaptation
measures for coastal infra-
structure and utilization of
water resources. A technique
is known as “pseudo global
warming method” has been
adapted and successfully used
for prognostic understanding
of how cyclones originating in
the Bay of Bengal would
behave in the near future
(2025) and in far future (2075)
under different RCP scenarios
(a greenhouse gas concentra-
tion trajectory adopted by the
Intergovernmental Panel on
Climate Change).It is pre-
dicted that cyclone damage
potential will increase signif-
icantly in future. This strate-
gic knowledge is essential for
all the studies related to adap-
tation of coastal infrastruc-
ture, water resources man-
agement in coastal areas and
preparedness of coastal com-
munities to extreme events in
the future.
Historical climate data for
the Indian Ocean region has
been used by Center of
Excellence (CoE)- IIT
Kharagpur to understand the
temporal variability of wave
height (SWH) over the Bay of
Bengal (BoB) region for the
period 1997-2015, which have
been published in reputed
international and national
journals.
BUcUQbSXUbcZ_Y^XQ^Tcd_
QTTbUccSY]QdUSXQ^WU

6. ]PcX^]$
! # !$ %'(')
:D0A274;;0??0=Q :278
The beleaguered president of
Kerala BJP, K Surendran,
who is held responsible for the
election debacle of the party by
the entire State leadership, had to
field former Governor of
Mizoram K Rajasekharan to save
himself from the grilling by the
media on Sunday. Interestingly,
the presence of Union Minister
V Muraleedharan did not go well
with Kerala Police and they stood
their ground that the meeting
would not be allowed come what
may.
The 11-member core com-
mittee of the party which was to
meet at Ernakulam’s Bharat
Tourist Home, to take stock of the
situation arising out of the BJP’s
wash out in the Assembly elec-
tion had to be shifted to the dis-
trict committee office following
the instruction of the Kerala
Police that a meeting of this mag-
nitude could not be allowed in a
hotel.
Before moving out of the
hotel, the State leaders including
Rajasekharan and union minis-
ter of State V Muraleedharan
addressed the media and alleged
that the police action was in
response to directive issued by
the political boss of Kerala (read
Pinarayi Vijayan, Chief
Minister).
Rajasekharan alleged that
the CPI(M) and CPI with the
help of the media were selectively
targeting the BJP and its president
Surendran in connection with the
heist and seizure of hawala
money of C3.5 crore, reportedly
belonging to the Hindutwa party.
“A part of the money was seized
from Dharmarajan. It was the BJP
leadership that approached the
police with a complaint that the
money meant for election cam-
paign has been stolen. If it was
hawala money, do you think we
would have approached the
police? Moreover, Dharmarajan
is an activist of the BJP and we do
not have any issues in accepting
our links with him,” said
Rajasekharan.
Though Union Minister
Muraleedharan and former
Kerala chief were present during
the media conference along with
Surendran, they maintained
silence.
When asked why the
Enforcement Directorate could
not be entrusted with the inves-
tigation, the union minister said
it was not possible.
C P Radhakrishnan, the
party leader in charge of Kerala
affairs had flown ito Kochi to pre-
side over the meeting.
“It is really shocking to note
that the Kerala Police did not
allow a meeting which
was to be addressed by a Union
Minister and a two-time member
of the Lok Sabha to take place.
Rajasekharan is correct when he
stated that this was an act of vic-
timization by the CPI(M),” said
a political commentator based in
Thiruvananthapuram.
The BJP in Kerala is facing
the worst crisis it has come
across during the last four
decades. Sundara, an indepen-
dent candidate who had filed his
nomination from Manjeswaram
had alleged the other day that he
was forced to withdraw from the
race at the instance of Surendran
who had paid him C2.5 lakh and
a mobile phone.
He also said that he had been
offered licences to open two
liquor outlets in
Karnataka if Surendran wins the
election.
;UbQQ@_YSUcd_`c2:@Vb_]
X_cdY^W]UUdY^;_SXYX_dU
:D0A274;;0??0=Q :278
The Kerala Pradesh
Congress Committee finds
itself between a deep sea and
devil syndrome. Following the
disastrous performance of the
party in the recent Assembly
election, the reigning KPCC
chief M Ramachandran has
expressed his desire to quit. The
decision has been hastened by
the appointment of V D
Satheeshan as the Leader of the
Opposition in place of Ramesh
Chennithala was was ousted
from that post.
Though a team of AICC
observers led by Mallikarjun
Kharge who were deputed by
party president Sonia Gandhi
held many rounds of talks with
the new legislators and the
former chiefs of the KPCC, a
solution remains elusive. A
number of leaders have pitched
in for the coveted post and this
include Kodikkunnil Suresh,
Sashi Tharoor (both former
union Ministers), K
Muraleedharan, Benny
Behannan, K Sudhakaran (all
MPs) ,P T Thomas MLA and
K C Joseph, former Minister.
The information trickling
out of Indira Bhavan (KPCC
headquarters) at
Thiruvananthapuram is that
former Chief Minister
Oommen Chandi and Ramesh
CVhennithala are cut up with
the move by the High
Command to bring in a new
leader as the party chief. K
Sudhakaran, popularly known
as Kerala Simham (Malayalam
for Lion), and has proved his
organisational skills is the
preferred leader of the new
generation of Congressmen
though he is 70.
But Oommen Chandi and
Ramesh are totally opposed to
Sudhakaran becoming the
KPCC president .”Both of them
have made it known that they
would not accept any organi-
sational responsibilities if the
High Command appoints
Sudhakaran,” said a former
leader of the KPCC.
Tariq Anwar, the special
representative of Sonia Gandhi
is in the capital city to know the
pulse of the other leaders.
Though Anwar held a series of
meetings with all the leaders
who matter in the KPCC, the
name of the new chief remains
a mystery.
“The person who is
appointed as the KPCC presi-
dent by the Congress High
Command would command all
support from all sections.
There is no confusion in it,”
Chandy told reporters at
Kottayam. The incoming
KPCC president would have to
lift the party from the abyss of
defeat as the Congress has lost
two successive elections to the
assembly, something unheard
of in the last four decades.
RQJLQDIL[RYHUQHZ3
FKLHI¶VDSSRLQWPHQWLQ.HUDOD
:D0A274;;0??0=Q :278
The week beginning on
Monday will see a series of
agitations and demonstrations
in the hitherto peaceful islands
of Lakshadweep against the
move to introduce “reforms” by
the Administrator Praful Patel.
Fearing a backlash from
the people, the Lakshadweep
Development Authority by a
special order on Saturday asked
all non-residents and outsiders
to leave the island immediate-
ly. People from Kerala and
other States who have come to
the islands as visitors and con-
tract workers have to leave the
archipelago by Monday, said
the order.
“Ours is a peace-loving
population and we are happy if
we are left alone,” Mohammed
Faizal, MP, told The Pioneer on
Sunday. He said a latest order
issued by the Administration
that all fishing boats operating
from the islands should have a
Government official in them
was bizarre.
“There are more than 100
fishing boats operating from
each of these islands and how
are they ging to post govern-
ment officials in all these boats?
It is these kinds of laws that
make us alien in our own
land,” said Faizal.
Wajahat Habibullah, a for-
mer IAS officer who was a
highly revered bureaucrat and
was the Administrator of
Lakshadweep for many years
said that the reforms
announced by the present
administrator were something
which the islands could do
without.
He cautioned the authori-
ties that the slew of draft leg-
islation will have wide ranging
impact on the islands.
“Lakshadweep with its land
ownership constitutionally pro-
tected be opened to interna-
tional tourism not as a means
for generating wealth for
investors from the mainland
but to bring prosperity to the
islanders,” he pointed out in a
recent article on the issue.
Meanwhile 93 retired civil
servants from across the coun-
try have sent a letter to Prime
Minister Narendra Modi
against the controversial deci-
sions by administrator Praful
Patel. The former officials said
the move to bring in reforms as
desired by Patel would alienate
the islanders.
“Each of these draft regu-
lations is part of a larger agen-
da that is against the ethos and
interests of the islands and
islanders,” said the officials
stating that these decisions
were taken without
consulting the people of
Lakshadweep.
The Kerala High Court by
a special order issued last week
had asked the Lakshadweep
Administration to submit its
explanation and affidavit with
respect to the draft resolu-
tions within a fortnight.
The retired officials have
asked for the immediate recall
of the administrator and the
appointment of a serving
bureaucrat in his place.
=RdYRUhVVae`hZe_Vdd
deZcRXRZ_deRU^Z_cVW`c^d
?A0344?B0G4=0Q 0;860A7
People have not yet forgotten
the incident of getting 29
vaccine filled syringes in the
dustbin at Jamalpur Urban
Primary Health Center
(UPHC) of Aligarh, a new
case has came to limelight in
which the vaccines which were
allotted to Aligarh's
Naurangabad UPHC were
being administered in Noida's
Jaypee Greens Society.
The officials of health
department are in denial on the
one hand, but also on the
other hand they are saying to
take strict action against the
defaulters.
Now the question arises
that when the vaccine cannot
go from one center to another
center in the district, then how
did the entire consignment of
this vaccine allocated for
Aligarh reached Noida.
That too when these vac-
cines are audited daily in the
official document of the Health
Department.
Aligarh: The key accused in the last
month's Aligarh hooch incident, which
has claimed at least 35 lives so far, was
nabbed in the early hours of Sunday,
police said.
Accused Rishi Sharma, who carried
a reward of C1 lakh on his arrest, was
held near Bulandshahr border in west-
ern Uttar Pradesh, Aligarh Senior
Superintendent of Police (SSP) Kalanidhi
Naithani said.
Sharma, whom the police described
as the kingpin of the liquor mafia, was
named in 13 different cases connected
to the recent liquor tragedy, and was
nabbed this morning on the Aligarh-
Bulandshshar border as he was about to
slip out of the district after being holed
up in his hideouts since the past nine
days.
On Saturday, the police had raised
the bounty on Sharma from C75,000 to
Rs 1 lakh.
His wife, son, two brothers and a
nephew were arrested in the last five
days.
The search for Sharma was extend-
ed to half a dozen neighbouring states
and several districts, where he had his
network.
The police were tracking over 500
cell phone numbers belonging to his
close circle. Police were tipped off on
Saturday night that Sharma would be
travelling to Bulandshshar in an SUV.
He was nabbed in his vehicle, which
was carrying a large cache of spurious
liquor, police said.
Nearly 50 people have died in
Aligarh since consuming spurious liquor
on two different occasions recently,
according to police, while officials esti-
mated that the death toll could go up to
100 as autopsy reports of another 50
hooch consumers were awaited.
In a major breakthrough in the
hooch incident, key accused and Rs 1
lakh rewardee Rishi Sharma has been
arrested from near Bulandshahr border,
Naithani said.
Earlier, the police had arrested
accused Vipin Yadav, with C50,000
reward on his arrest, and Rishi Sharma's
brother Munish Sharma carrying a
bounty of C25,000 in this case, the SSP
said.
C=A067D=0C70Q D108
Thespian Dilip Kumar was admitted
to PD Hinduja at Khar in north-
west Mumbai on Sunday morning,
after he complained of breathless-
ness. His condition was described in
the evening as “stable” by the doctors
attending on him at the hospital.
“Dilip Sahab has been admitted to
non-Covid PD Hinduja Hospital Khar
for routine tests and investigations. He’s
had episodes of breathlessness. A team
of healthcare workers led by Dr. Nitin
Gokhale is attending to him. Please
keep Sahab in your prayers and please
stay safe,” the official Twitter handle of
Dilip Kumar said. The veteran actor's
official twitter handle is managed
personally by the thespian’s actress-wife
Saira Banu.
“Don’t believe in WhatsApp for-
wards. Saab is stable. Thank you for
your heart-felt duas and prayers. As per
doctors, he should be home in 2-3 days.
Insh’Allah,” the veteran actor’s twitter
handle said later in the evening.
Meanwhile, pulmonologist Dr.
Jalil Parkar who is treating him, said
that the actor has been diagnosed with
bilateral pleural effusion and kept on
oxygen support in the Intensive Care
Unit ward, where “his condition is sta-
ble”.
Nationalist Congress Party
President Sharad Pawar, who visited
the PD Hinduja hospital and enquired
after the actor’s health from Saira Banu
in the afternoon, tweeted: “Visited leg-
endary actor Dilip Kumarji at Hinduja
Hospital today to check on his health
and treatment, with the veteran actress
Saira Banu. I wish Dilip Kumarji a
speedy recovery and good health!”.
Minister of State in the PMO Dr.
Jitendra Singh said in a tweet: “Wishing
the living legend, the ultimate thespi-
an, clearly the last word in the school
acting and our all-time favourite… a
speedy recovery”.
Dilip Kumar, who turned 98 on
December 11, 2020, did not celebrate
his birthday as he lost his two younger
brothers --Ehsaan Khan and Aslam
Khan –who died of Covid-19 during
last year.
EPRRX]TbTP]cU^a0[XVPaWb=PdaP]VPQPS
D?72PSX]XbcTaTSX]_^bW=^XSPb^RXTch
C=A067D=0C70Q D108
In a relief to the health authorities, the
Covid-19 infections in Maharashtra
dropped to a low 12,557 on Sunday, even
as the State – with 618 new fatalities –
breached the grim milestone of total 1 lakh
deaths.
A day after the State logged 13,659
infections and 741 deaths, the daily infec-
tions went down by 1102 and the deaths
dropped by 123. Of the 618 deaths report-
ed on Sunday, 233 were current ones while
the remaining 385 were previous unac-
counted fatalities.
With 618 deaths reported in
Maharashtra on Sunday, the total number
of deaths in the state breached the one lakh
mark of total deaths as the fatalities rose
from 99512 to 1,00,130. Similarly, with
12,557 new infections, the total number of
cases climbed from 58,19,224 to 58,31,781.
As 14,433 patients were discharged
from the hospitals across the state after full
recovery, the total number of people dis-
charged from the hospitals since the sec-
ond week of March last year increased from
55,28,834 to 55,43,267. The recovery rate
in the state rose from 95.01 per cent to
95.05 per cent.
The total “active cases” in the state
dropped 1,88,027 to 1,85,527. The fatality
rate in the State rose from 1.71 per cent to
1.72 per cent. Mumbai logged 20 deaths
and 786 infections. As a consequence, the
Covid-19 toll in the metropolis increased
from 14,951 to 14,971, while the infected
cases went up by 786 to trigger a jump in
the infections from 7,09,857 to 7,10,643.
Pune with 21,216 cases continued to be
remain first in terms of maximum num-
ber of “active cases” in the state, while
Kolhapur with 18,734 “active cases” stood
second, followed by Mumbai (18,041),
Thane (16,672), Satara (15,151), Sangli
(10,349), Nagpur (9244), Ahmednagar
(7278), Ratnagiri (6109), Nashik (5981),
Solapur (5878), Sindhudurg (5870), Beed
(4277), and Raigad (4932).
Of the 3,65,08,967 samples sent to var-
ious laboratories across the state so far,
58,31,781 have tested positive (15.97 per
cent) for COVID-19 until Sunday.
Currently, 13,46,389 people are in
home quarantine while 6426 people are in
institutional quarantine.
1Sd_b4YY`;e]Qb
X_c`YdQYcUTcdQRU
.HDFFXVHGLQ$OLJDUK
KRRFKWUDJHGKHOG
?C8Q 060AC0;0
Twenty-four cases have been registered in different police
stations across eight districts of Tripura for attack on
journalists since 2020, police said on Sunday.
The Assistant Inspector General (AIG) of police (law
and order), Subrata Chakraborty said, the Director-General
of Police (DGP) has taken note of the recent reports pub-
lished in newspapers, expressing his concern over the
increasing incidents of violence against journalists and the
alleged failure of the police to take action against the attack-
ers. The Director-General of Police (DGP) VS Yadav held
a detailed review meeting with the district superintendents
of police on June 5.
During the discussion with the SPs, it was found that
17 cases were registered in 2020 and 7 cases were regis-
tered in 2021 as on date, the AGP said.
Chakraborty said that out of the 24 cases registered,
16 cases have ended in charge sheets, three cases were com-
promised by the parties involved while the remaining five
cases are still under investigation.
In some of these cases where the victims were unable
to identify the miscreants, all-out efforts were made by
police to identify them. Consequently, more than 15 per-
sons were identified during the investigation and charge-
sheeted. The investigation of cases registered was carried
out purely on merit and evidence, the police official said.
He informed that the arrests were made in cases where
the punishment was more than seven years as per the laid
down procedure and applicable sections of the Criminal
Procedure Code. In other cases, notices were issued.
!#RPbTbaTVXbcTaTSPVPX]bc
PccPRZb^]Y^da]P[XbcbX]
CaX_daPbX]RT!!)?^[XRT
Aligarh: An inquiry has been
set up in Noida's Jaypee Greens
Society in connection with the
vaccination of Naurangabad,
the urban primary health cen-
ter of Aligarh.
The CMO has constituted a
two-member panel of doctors
for the investigation. This panel
will submit the report in a
week.
Vaccination camp was
organized in the last week of
May at Jaypee Greens Society,
Noida. In this, the health
department team of Noida had
vaccinated the people of the
society.
People's heads were shak-
en when the people there got
the certificates of the Urban
Primary Health Center of
Naurangabad in Aligarh and
different dates were written
on them. Whereas the camp
was held for only one day.
When the complaint was made,
there was a stir.
02 IRUPVSDQHOWR
LQYHVWLJDWHWKHPDWWHU
HZeY')_VhUVReYdRYR
4`gZUe`]]Tc`ddVd=^Rc
?C8Q ?0=098
The Goa Forward Party on
Sunday wrote to the
Election Commission of India
to ensure a prioritised vaccine
drive against Covid-19 in the
State as it would be facing
Assembly polls in early 2022.
In the letter, GFP chief Vijai
Sardesai said campaigns in five
poll-bound States recently were
conducted without adherence
to Covid-19 norms which led
to a spike in cases.
It is our firm belief and
hope that a prioritised vaccine
drive and allocation of doses
for poll-bound states would
massively help reduce the risk
of spreading the virus, Sardesai
said in the letter.
65?faXcTbc^
428U^aePRRX]T
_aX^aXchSdTc^
!!!6^P_^[[b
Agra: Lockdowns due to the
coronavirus pandemic have hit
coolies at Agra's railways stations
hard, forcing many of them out of
work.
Some of them now pull rick-
shaws, others work as labourers.
Sharing his ordeal, Munna
Khan (50), a coolie at Agra Cantt
railway station, told PTI, There
are 102 coolies at the station who
are divided into two shifts. In one
shift about 52 coolies are allowed
to work, but these days only 10-
25 coolies are coming due to less
number of passengers.
Moreover, the passengers
avoid taking our service due to
fear of COVID-19. This adverse
situation is forcing us to do other
work to run the house, he added.
There are about 240 coolies
working at four major railway sta-
tions in Agra - Agra Cantt, Agra
Fort, Raja Ki Mandi and Idgah.
Another coolie at the Agra
Cantt station, 40-year-old Fakira
shared that he now also pulls a
rickshaw as there is no work at the
railway station since the outbreak
of the second wave of Covid.
I come to the station in the
hope of getting work but spend
the entire day sleeping. At night
I pull a rickshaw to fulfil the needs
of my family, he said.
Talking about the difficulties,
Rajveer said he spends Rs 150 on
travelling to the Agra Cantt station
from his home, which is about 15
kms away, in the hope to earn
some money.
At the station, I spend my
entire day sleeping or waiting for
passengers. Most of the day, I don't
get any money, he said. PTI
Puducherry: Puducherry reported 640
fresh coronavirus cases during last 24
hours as the overall tally rose to 1,09,079,
a senior official of the Department of
Health and Family Welfare Services said
on Sunday.
The new cases were identified at the
end of the examination of 9,215 swab sam-
ples projecting a positivity rate at 6.95 per
cent, Director of Health Department S
Mohan Kumar said. The 640 new cases
were spread over Puducherry (470),
Karaikal (136), Yanam (15) and Mahe (19).
Fifteen people succumbed to the
virus during the last 24 hours ending 10
AM Sunday pushing the toll to 1,628, he
said, adding seven of the victims had no
comorbidities. The Health depart-
ment Director said as many as 1,138
patients were discharged after recovery
during the last 24 hours from hospitals.
The number of active cases in the
union territory stood at 8,270 (1,236 in
hospitals and 7,034 in home isolation), he
added.The total recoveries so far climbed
to 99,181 with the 8,270 on Sunday.
Mohan Kumar said 11.03 lakh samples
have been examined so far and 9.51 lakh
of them turned out to be negative. PTI
F^aZTab_PRZP]V^TbPcPUXT[SX]P[SPSXbcaXRc^]Bd]SPh ?C8
?dSdRWTaah[^Vb
%#]TfRPbTb
?=BQ ;D2:=F
Uttar Pradesh has crossed the milestone of administer-
ing 2 crore cumulative vaccine doses and also emerged
as a leader by crossing the 30 lakh-mark in the 18-44 age
category, the highest in the country.
Enthused by the response, Chief Minister Yogi
Adityanath said the State must intensify the vaccination
drive to prevent a severe third wave and start targeting at
least 10 lakh doses a day from July onwards. The target is
to vaccinate at least 10 crore people in the next three months,
he said.
“Till now, we have administered more than 2 crore
(2,02,34,598) doses of vaccine. In view of the huge popu-
lation of Uttar Pradesh, we have to speed up the vaccina-
tion drive. We must now work upon expanding the ‘Mission
June’ target by three times in July,” Yogi said while address-
ing a high-level Covid review meeting on Sunday.
So far, around 1,66,27,059 people have received the first
dose of vaccine while 36,27,433 have been fully vaccinat-
ed. It is notable that so far, India has administered around
22.80 crore vaccine doses, of which UP accounts for around
8.9 per cent of the total doses. In the last 24 hours, around
3.88 lakh people were vaccinated in the State.
3Tb_TaPcTcXTbU^a0VaPb
R^^[XTb[^RZS^f]bU^aRT
P]hc^[^^ZU^a^cWTaY^Qb
eTacf^Ra^aT
ePRRX]TS^bTb
VXeT]X]D?