SlideShare a Scribd company logo
H>64B7B8=670??8=C43
3DE824270=24;;A
=Tf3T[WX)3T[WXCTRW]^[^VXRP[
D]XeTabXchEXRT2WP]RT[[^a
H^VTbWBX]VWWPbQTT]
P__^X]cTSPbcWTEXRT
2WP]RT[[^a^U3T[WXD]XeTabXch
X]Xbcah^U4SdRPcX^]^UUXRXP[b
bPXS^]FTS]TbSPhBX]VWfW^
fX[[QTcWT!aSEXRT2WP]RT[[^a
^U3DfX[[bdRRTTSH^VTbW
ChPVXfW^fPbbdb_T]STS[Pbc
Rc^QTa
19? 14=60;20=3830C4
140C4=1HC24=384B
:^[ZPcP)019?[TPSTa^UFTbc
1T]VP[fW^[^bc0bbTQ[h
T[TRcX^]Ua^PbTPcX]B^dcW!#
?PaVP]PbP]SfPbP[[TVTS[h
PbbPd[cTSQhC2f^aZTabX]
PhSXTSPcPW^b_XcP[WXb
UPX[hTQTabbPXS
20?BD;4
0?Q :01D;
Attackers struck Taliban
vehicles in an eastern
Afghanistan on Wednesday,
witnesses said, killing at least
two fighters and three civilians
in the latest violence since the
group’s takeover of the country
in mid-August.
In one attack, gunmen
opened fire on a Taliban vehi-
cle at a local gas station in the
provincial capital of Jalalabad,
killing two fighters and a gas
station attendant, witnesses
said. A child was also killed,
they added.
Another child was killed
and two Taliban were wound-
ed in a separate attack — a
bombing of another vehicle.
Another bombing of a Taliban
vehicle in Jalalabad also
wounded a person nearby,
although it was unclear if that
person was a Taliban official or
not. The witnesses spoke on
condition of anonymity for
fear of retribution.
No one claimed immediate
responsibility for Wednesday’s
attacks, although the Islamic
State group, which is head-
quartered in eastern
Afghanistan, took responsibil-
ity for similar attacks in
Jalalabad last week that killed
eight.
?C8Q =4F34;78
Shares of Zee Entertainment
Enterprises Limited
on Wednesday zoomed
nearly 32 per cent after
announcement of a merger
with Sony Pictures.
Leading media firms Zee
Entertainment and Sony
Pictures on Wednesday said
they have received in-principle
approval for a merger that will
combine both companies’ lin-
ear networks, digital assets,
production operations and pro-
gramme libraries.
The stock jumped 31.86
per cent to close at C337.10 on
the BSE. During the day, it ral-
lied 39 per cent to its 52-week
high of C355.40.
On the NSE, it zoomed
30.50 per cent to close at
C333.70. The company’s mar-
ket valuation also jumped
C7,823.98 crore to C32,378.98
crore on the BSE.
Buying was also there in
other group stocks, with Zee
Learn zooming 14.30 per cent
and Zee Media Corporation
gaining 4.92 per cent
on the BSE.
Detailed report on P9
Brasilia: Brazil’s Health
Minister Marcelo Queiroga
tested positive for Covid-19
hours after accompanying
President Jair Bolsonaro to the
United Nations General
Assembly (UNGA) in New
York on Tuesday, the
Government said.
Queiroga will remain in
New York in quarantine, the
Government’s communications
office said. “The Minister is
doing well,” the statement said.
It added that the rest of the del-
egation tested negative for
the virus.
Bolsonaro, a vaccine skep-
tic, defied UN rules that asked
all those attending the
Assembly to be vaccinated. He
has bragged about not getting
vaccinated.
Agencies
0178;0B7=0A08=Q
0;;070103
Amidst chanting of mantras
and following all the ritu-
als Akhara Parishad chief
Mahant Narendra Giri was
given Bhoo Samadhi on
Baghambari Gaddi Ashram
premises under a lemon tree as
per his wish, on Wednesday
afternoon. Office-bearers of
all 13 Akharas were present
there at the time of the Bhoo
Samadhi.
Prior to the Samadhi, his
body was taken to the mortu-
ary of SRN Hospital for post-
mortem examination, and then
was taken to the Sangam for
bathing it with the sacred
waters of the Ganga, the
Yamuna and the Saraswati.
The mortal remains,
placed in a flower bedecked
lorry, were moved around the
city to let people pay their
homage to the Brahmaleen
seer before the Samadhi.
Thousands of sants, disci-
ples and devotees marched
through the route raising slo-
gans for the Mahant. The van
was stationed at Bare
Hanuman Mandir near the
Sangam for Darshan. Narendra
Giri was the Mahant of this
temple.
Though the detailed post-
mortem report is awaited, what
had been briefed suggested
that the the cause of death was
suffocation. A ‘V’ mark was
seen on the neck of the
Mahant.
Under video camera
watch, a panel of five doctors
performed autopsy.
?=BQ =4F34;78
The Supreme Court on
Wednesday put the
Government on notice in two
separate matters related to girls.
Maintaining that induc-
tion of women to the NDA
cannot be postponed by one
year, the Supreme Court
allowed female candidates to
take the exam in November
this year and not wait till May
2022 as requested by the
Government.
Hearing a separate matter,
the apex court directed the
Centre to file an affidavit with-
in two weeks on the issue of
induction of girls in the
Rashtriya Indian Military
College (RIMC) in Dehradun
saying the issue cannot be
delayed further. Refusing to
accept the Centre’s request to
allow women candidates to
appear for the National
Defence Academy (NDA)
entrance from next year, the
apex court said it doesn’t want
women to be denied their
right. The Centre had told the
top court that a notification
allowing women candidates
to appear for the NDA exam
will be out by May next year.
A Study Group has been con-
stituted by the Defence ser-
vices, comprising experts to
expeditiously formulate a com-
prehensive curriculum for
women cadets at NDA, it had
said, adding that a Board of
Officers has been convened to
give a holistic and futuristic
proposal for training of women
Cadets at NDA incorporating
all relevant aspects.
A Bench headed by Justice
SK Kaul said the armed forces
are the best response team to
deal with emergency situa-
tions and it is hopeful that nec-
essary arrangements will be
put in place to pave the way
for the induction of women in
NDA without delay.
Additional Solicitor
General Aishwarya Bhati,
appearing for the Centre, stat-
ed that the Study Group has
been constituted by the
Defence services to examine
the changes in curriculum,
infrastructure, fitness training,
accommodation facilities, etc,
and sought for skipping the
upcoming NDA entrance
examination, scheduled to be
held on November 14.
?=BQ =4F34;78
As he left for his three-day
US tour, Prime Minister
Narendra Modi on Wednesday
said his interaction with world
leaders, including President
Joe Biden, will strengthen the
Indo-US Comprehensive
Global Strategic Partnership
and consolidate ties with Japan
and Australia.
Issuing a statement before
leaving for the US, Modi said
he will conclude his visit with
an address at the United
Nations General Assembly
(UNGA) focusing on the press-
ing global challenges, including
the Covid-19 pandemic, the
need to combat terrorism, cli-
mate change and other impor-
tant issues.
The PMO tweeted his pic-
ture just before Modi boarded
the plane for the US where he
will take part in a wide range
of programmes. He will be
accompanied by National
Security Adviser (NSA) Ajit
Doval and External Affairs
Minister S Jaishankar besides
Foreign Secretary Harsh
Shringla and some other top
officials there.
“I will be visiting the USA
from 22-25 September, 2021,
at the invitation of His
Excellency President Joe Biden
of the United States of
America. During my visit, I
will review the India-US
Comprehensive Global
Strategic Partnership with
President Biden and exchange
views on regional and global
issues of mutual interest,” said
the PM.
“I am also looking forward
to meeting Vice-President
Kamala Harris to explore
opportunities for cooperation
between our two nations par-
ticularly in the area of science
and technology,” he said.
?=BQ =4F34;78
The Centre on Wednesday
informed the Supreme
Court that an amount of
C50,000 will be given by the
States as ex-gratia to the kin of
all those who died of Covid-19
and also to those who die of the
disease in future. The ex-gra-
tia assistance will also be given
to the kin of those who died of
the virus due to involvement in
Covid-19 relief operations or
activities associated with the
preparedness for dealing with
the pandemic, the Centre said.
In an affidavit, the Centre
said the National Disaster
Management Authority
(NDMA) has made these rec-
ommendations.
The ex-gratia assistance
will be subject to the cause of
death being certified as Covid-
19 as per the guidelines issued
by the Ministry of Health and
Family Welfare and the ICMR,
the Government said. It added
that the ex-gratia assistance will
be provided by States from the
State Disaster Response Fund.
On September 3, the top
court had expressed displeasure
over delay in framing of guide-
lines for issuance of death cer-
tificates to the families of those
who died of Covid-19. The SC
had in its June 30 verdict
directed the NDMA to recom-
mend within six weeks the
guidelines for ex-gratia to the
family of the Covid victims.
On June 30, Justice Ashok
Bhushan-headed bench
ordered the Centre to imple-
ment the mandated ex-gratia to
Covid victims, which was can-
celled by the Government,
when Covid started spreading.
Before the first lockdown,
as per NDMA guidelines, C4
lakh was granted as ex-gratia
when a calamity is declared as
a national disaster. But after
declaring the lockdown, an
order was issued to cancel the
ex-gratia provision.
The Prime Minister-
chaired NDMA received flak
from the SC for it.
The SC also ordered steps
to simplify guidelines for
issuance of “death certifi-
cates/official documents stating
the exact cause of death, that is,
‘Death due to Covid-19’” for
enabling dependents to get
benefits of welfare schemes.
?=BQ =4F34;78
Pakistan allowed India to
use its airspace for Prime
Minister Narendra Modi to
travel to the US. The PM’s
plane avoided Afghanistan as it
has closed its airspace for any
commercial use since the
Taliban took control.
India had sought permis-
sion from Pakistan regarding
the usage of Pakistan’s airspace
for Modi’s flight to the US, for
which Islamabad gave a nod.
In the past, Islamabad had
denied this access when
President Ram Nath Kovind
and Modi travelled abroad in
2019.
This move was to protest
against abrogation of Article
370 giving special status to
Jammu  Kashmir.
2PaRPbb^UPfWP[TPcEPbPXQTPRWX]?P[VWPaSXbcaXRc^]FTST]TbSPh ?C8
Dubai: Sunrisers Hyderabad
pacer T Natarajan tested posi-
tive for Covid-19 but the team’s
IPL match against Delhi
Capitals on Wednesday went
ahead as scheduled after the
remaining contingent was
found to be negative. Left-arm
pacer Natarajan, who is com-
ing back from a knee surgery,
has been isolated along with six
close contacts which also
include out of favour India all-
rounder Vijay Shankar.
“Sunrisers Hyderabad play-
er T Natarajan tested positive
for Covid-19 at a scheduled
RT-PCR test. The player has
isolated himself from the rest
of the squad,” a BCCI release
stated. P12
C!e`4`gZUgZTeZ^d¶Z_+8`ge
([JUDWLDDLGDOVRWRIDPLORIWKRVHZKRIDOOSUHWRFRURQDYLUXVLQIXWXUH6WROG
?=BQ =4F34;78
Aday after New Delhi
slammed the UK for
adopting a “discriminatory”
policy against Covishield and
warned of “reciprocal mea-
sures,” the British Government
on Wednesday added it to the
list of approved Covid-19 vac-
cines but kept India out of the
eligible countries list flagging
the vaccine’s certification. Fully
vaccinated Indians will thus
still have to undergo a 10-day
self isolation or quarantine
after their arrival in Britain.
The Oxford/AstraZeneca
Covid-19 vaccine, manufac-
tured by the Serum Institute of
India, was recently excluded
from a list of eligible Covid-19
vaccines recognised under
Britain’s reviewed internation-
al travel norms, effective from
October 4.
The updated UK travel
guidelines now said,
“Formulations of the four list-
ed vaccines, such as
AstraZeneca Covishield,
AstraZeneca Vaxzevria and
Modern Takeda, qualify as
approved vaccines.”
The site explains that from
4 am, October 4, those who
have taken vaccines from a “rel-
evant public health body” in
specific countries will be con-
sidered “fully vaccinated”. That
list does not include India.
This suggests that Indians
vaccinated with two doses of
Covishield, produced by SII,
will still need to quarantine
even though India is now on
the Amber list.
?PZXbcP][Tcb^SXcaPeT[
eXPXcbPXab_PRTc^DB
0DKDQW1DUHQGUD*LUL
JLYHQ%KRR6DPDGKL
2 µG^RcdVV_
`__VT`WDR_e
KVV6_edYRcVd
k``^RWeVc^VcXVc
hZeYD`_jAZTefcVd
R__`f_TV^V_e
Rje``WRcD4R]]`hdh`^V_
e`eRV?52 ViR^Z_?`gZedV]W
3cRkZ]9VR]eYZ_
T`_ecRTed4`gZU
RWeVcF?82gZdZe
BA7´b=PcPaPYP]cTbcb2^eXS_^bXcXeT]^
TUUTRc^]8?; PcRWPbaTbc^UcTPUX]T
0ccPRZb^]CP[XQP]
eTWXR[TbZX[[$X]0U
FcVT`X_ZdVdgRTTZ_V
SfeVVad:_UZR`fe`W
V]ZXZS]VT`f_ecZVd]Zde
W]RXXZ_X[RSTVceZWZTReZ`_
?aXTX]XbcTa=PaT]SaP^SXST_PacbUa^=Tf3T[WXU^aWXbeXbXcc^cWTDB0 ?C8
0ZWPaPBPSWdb_TaU^aPaXcdP[SdaX]V³1W^^BPPSWX´^U^acP[aTPX]b^U0ZWX[
1WPaPcXhP0ZWPaP?PaXbWPS_aTbXST]cPWP]c=PaT]SaP6XaXPWPaPYPc1PVWPQPaX
6PSSXPcWX]?aPhPVaPY^]FTS]TbSPh ?C8
D:]^Sc^2^eXbWXT[SQdc8]SXP]bbcX[[UPRT³`dPaP]cX]T´
=8:00;8:Q 270=3860A7
In what is being seen as Capt
Amarinder Singh’s decision
to break away from the party
he served for decades, the for-
mer Punjab Chief Minister on
Wednesday announced his
decision to pitch a strong
candidate against “Super CM”
Navjot Singh Sidhu.
His assertion came almost
simultaneously with a tweet
from his OSD saying,
“Reverting Back in a Big
Bang,” with Capt Amarinder’
picture and superimposed
caption — Capt 2022.
Virtually raising a banner
of revolt, Amarinder criti-
cised Rahul Gandhi and
Priyanka Gandhi for their
“inexperience”, adding “their
advisers are misguiding them”.
Also taking a dig at Sidhu
 Company over charges of
no action against the Badals
and SAD leader Bikram
Majithia, Amarinder chal-
lenged them to “throw the
Akalis leaders behind bars if
they can”.
At the same time, he came
down heavily on his bête noire
Sidhu for “interfering” in his
successor Chharanit Singh
Channi’s domain by “dictating
the terms”. Not sparing even
Congress supremo Sonia
Gandhi, Amarinder declared
that he had offered to quit as
Punjab CM three weeks back
she had asked him to contin-
ue.
DSWDLQUHYROWVWRSXW
XSµVWURQJFDQGLGDWH¶WR
GDVK6LGKX¶V0KRSHV
86YLVLWWRERRVW
VWUDWHJLFWLHV30
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !%
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=C7DAB30HB4?C414A !!! *?064B !C!
DA@CE#
32?024ABA4BCA82C
BA7C #
m
m
H@C=5)
4=EHB5278=0ADBB80?0:44C
C0;810=558280;B05;4034AB
7?EB1F31D
G19DD?G?B;
G9D8J?I1
! F9F139DI
@A:?:@?'
B=D8B0=0;CAD8BC
=C0BF8=3;4A
]PcX^]!
347A03D=kC7DAB30H kB4?C414A!!!
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV	VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 347A03D=
Ecologically sustainable aqua-
culture based on symbiotic
technology is set to revolu-
tionise the coastal aquaculture
industry in the country. The
aquaculture based on symbiot-
ic technology is a guaranteed
way for achieving Prime
Minister Narendra Modi's
vision for doubling the aqua
farmers' income, said Tamil
Nadu J Jayalalithaa Fisheries
University (TNJFU) vice-chan-
cellor G Sugumar. He was
speaking after inaugurating the
project on standardised pond-
based culture technique for
commercially important marine
finfishes and pond-based recir-
culated aquaculture system
(RAS) for vannamei shrimp at
Chippikulam near
Thoothukudi. Sugumar said
the initiative launched by Kings
Infra in association with the
university to promote the pro-
ject would help the aquaculture
farming practice to be truly sus-
tainable in the country. The
recirculated aquaculture sys-
tem (RAS) empowers farmers to
utilise water to the maximum
sustainable levels by eliminating
possible wastage by converting
the same to another resource.
Speaking on the occasion,
chairman and managing direc-
tor of Kings Infra, Shaji Baby
John said the company aims at
training over 5,000 farmers in
the coastal region by utilising
the technology being devel-
oped under this joint collabo-
rative project. Stressing on the
importance of doubling farmers'
income for the growth of the
economy he said the ecologi-
cally sustainable aquaculture
provides the best possibility for
the coastal farmers to realise the
dream of augmenting their
income. The joint venture
would develop a standard tech-
nology on developing the
framework for sustainable aqua-
culture technology in a step-by-
step manner incorporating the
necessary scientific inputs and
technical requirements. The
next stage would be creating a
knowledge-sharing platform for
extending the developed tech-
nology to the farming commu-
nity and also to provide on-farm
training, he added.
The Kochi-based Kings
Infra has been advocating the
need for an environmentally
sustainable aquaculture for the
past many years. Sustainable
aquaculture has considerable
scope for growth as 49 per cent
of global demand for human
consumption of fish is con-
tributed by aquaculture.
Aquaculture shrimp con-
tributed 74 per cent value of the
Indian seafood exports worth
Rs 43,717 crore exports in FY
2021.
Z_Xd:_WcRe`ScZ_XWRc^Vcd
f_UVcdfdeRZ_RS]VRbfRTf]efcV
?=BQ AA:44
The Roorkee mayor Gaurav
Goel sprayed insecticide
in various wards of the munic-
ipal corporation as part of the
measures being taken against
dengue in the city.
He said that the special
cleaning and awareness cam-
paign against dengue will con-
tinue to prevent the rise of
dengue in the city. He also
spoke about the general steps
to be taken by the public to pre-
vent breeding of the dengue
causing mosquitoes.
Municipal councillors and
officials were also present on
the occasion.
5RRUNHH0DRUKHDGV
DQWLGHQJXHGULYH
?=BQ AA:44
Discussions were held on the smart city concept on the third
day of a five-day online faculty development workshop spon-
sored by the All India Council for Technical Education (AICTE)
at the Faculty of Engineering and Technology of Gurukul Kangri
Vishwavidyalaya in Haridwar. On day three of the workshop,
deliberation was made on Smart City concept of the government
of India. Department of Electronics and Communication head
and the workshop convener Vipul Sharma said that lectures were
held in three sessions on the third day of the workshop.
C]Qbd3YdiS_^SU`dc
TYcSeccUTY^g_b[cX_`
?=BQ 347A03D=
The anti-drug task force
(ADTF) of Dehradun
police nabbed two persons
with 14.42 kilogrammes of
Ganja on Wednesday. The duo
allegedly used to sell the con-
traband mostly to school and
college students.
The police informed that
the two accused are 19 and 26
years old and belong to
Darbhanga in Bihar.
They were caught during
the checking of vehicles in the
morning near the Mata
Mandir area in Ajabpur.
According to the police, the
accused told during the inves-
tigation that they both bring
Ganja from Bihar at cheaper
rates and then sell it here to
school and college students
and some labourers for more
profit.
The officials informed the
police that they have registered
a case against both the offend-
ers in Nehru Colony police sta-
tion and that they will be pre-
sented in the court soon.
3ROLFHQDEGXRZLWK
NJ*DQMD
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar will
inaugurate 71 Har-Hith stores
on October 7 in the state.
“These stores have been set
up in 19 districts across the
state and will be inaugurated by
the Chief Minister through
video conferencing,” said an
official spokesman.
He said that there is a lot of
enthusiasm among the youth
towards the Har-Hith retail
store scheme in Haryana. The
Chief Minister has directed to
give priority to the families
identified through the Parivar
Pehchan Patra scheme in the
Har-Hith Stores scheme. If the
beneficiaries identified under
the Chief Minister Antyodaya
Parivar Utthan Yojana take a
loan under this scheme, then
the government will bear the
interest of one year on their
loan, the spokesman informed.
The Chief Minister on
Wednesday presided over a
review meeting regarding the
Har-Hith Retail Store scheme.
So far ,1258 youth have
applied under this scheme.
After completion of all these
formalities, 71 Har-Hith stores
will start functioning from
October 7.
Giving details, the
spokesman said that under the
Har-Hith retail store scheme of
the Chief Minister to promote
business, employment and
modern market in rural areas
of the state, 1258 applications
have been received so far, out
of which 982 have been sur-
veyed and 509 who have been
found eligible have been given
the benefit of this scheme. Of
these, agreements have been
signed with 151. Out of these,
95 applicants have taken Mudra
loan and 56 applicants have
applied with their own money.
During the meeting, the
Chief Minister directed the
officers to make a plan to open
5000 booths of Vita. He said
that there should be a Vita
booth at every bus stand, rail-
way station, hospital, market
etc. He also directed to make
portable cabins and open
booths so that more and more
people get employment.
The Chief Minister also
directed that the products of
other companies should also be
kept at these booths so that the
quality of our products can be
improved according to the
competition. Apart from this,
efforts should be made to open
Vita booths in Chandigarh as
well, he said.
+DUDQD0WR
LQDXJXUDWH+DU+LWK
VWRUHVRQ2FWREHU
?=BQ 270=3860A7
On the occasion of world
car free day, Himachal Chief
Minister Manohar Lal Khattar,
his Cabinet Ministers, BJP
MLAs and senior officers rode
bicycles from the Chief
Minister's official residence to
the Civil Secretariat, Sector 1
here on Wednesday.
The Civil Secretariat is
nearly two km from the Chief
Minister's official residence in
Chandigarh. While Khattar
came to office by bicycle, he
went back home on an e-
scooter to give a message of
environmental protection to
the public. In the past also, the
Chief Minister had been seen
riding a bicycle to his office.
While talking to the medi-
apersons on the occasion, the
Chief Minister said that he had
decided to not use his official
car for the entire day. I came to
the office by bicycle, complet-
ed my work in the office till the
afternoon and returned to my
residence by e-scooter wearing
a helmet. Even after the lunch
break, I came to the office by
e-scooter and participated in
the cabinet meeting, he said.
The Chief Minister said
that before 2000, the
Environment Transport
Association used to observe
green transport week in the
middle of June and fixed
Tuesday as annual car free day.
As many as 46 countries agreed
to observe world car free day
on September 22, 2000. It is
being observed continuously
since then. But now due to
environmental awareness, the
number of countries observing
this day is increasing, he said.
Khattar said that the pur-
pose of this day is to create
awareness about environmen-
tal protection among the peo-
ple, to make them aware about
the harm caused to the envi-
ronment by excessive use of
motor vehicles and to encour-
age them to use public trans-
port or cycle or even walking.
While calling upon the
people of the state to protect the
environment, he said that the
environment is getting pollut-
ed due to the continual increase
in the number of vehicles.
People have considered vehicles
as status symbols, due to which
employees and officers use
vehicles as the main mode of
commuting even when they
stay close to their offices, the
Chief Minister said. He called
upon people to take a pledge to
adopt a car-pooling system or
to travel on foot or cycle to
nearby places. He further
informed that Haryana
Government is promoting to
establish oxyvans in the state
and for this, about 3 crore
saplings are also being planted
by the forest department.
Students are being motivated
towards plantation, he added.
The Chief Minister also
informed that while taking
steps to reduce pollution levels,
till now plying of CNG buses
was being encouraged in
Gurugram, but now the
emphasis will be laid on run-
ning e-buses and e-autos there
too. He also inaugurated an
awareness exhibition on e-
vehicles organized at the Civil
Secretariat here. While taking
a round of the exhibition, he
inquired about the 'World Car-
Free Day’ as well as charging
stations set up by Haryana
Government, various schemes
to promote e-vehicles and
schemes like subsidy, Oxyvan,
CNG buses in Gurugram, vehi-
cle-scrap policy etc.
Subsidy will be given for
purchasing e-vehicles
Khattar said that in order to
encourage more usage of e-vehi-
cles in the state, the Haryana
Government will give subsidy to
the people for purchasing e-
vehicles. Electric vehicle poli-
cy chalked out by the State
Government will be launched
soon, he said. The policy pro-
poses to waive off road tax, reg-
istration fee, state toll tax and
provide an incentive of upto at
least Rs one lakh for new vehi-
cles. The Chief Minister said
that the government has also
formulated a vehicle-scrap pol-
icy for the discontinuation of
vehicles older than the pre-
scribed period in the NCR
region.
7PahP]P2bWd]bRPaU^aPSPh_TSP[bc^2XeX[
BTRaTcPaXPcP]SaTcda]bW^TQhTbR^^cTa
?=BQ 270=3860A7
Haryana Government on
Wednesday appointed
Justice Somnath Aggarwal
(retd.) of Punjab and Haryana
High Court as Commission of
Inquiry to ensure fair and
transparent investigation into
the incident of lathicharge on
farmers at Bastara Toll Plaza in
Karnal on August 28.
A decision to this regard
was taken in the meeting of the
state cabinet held under Chief
Minister Manohar Lal Khattar.
The Commission of
Inquiry will inquire into the
circumstances leading up to
and including the action by the
Police at Karnal on August 28
and the use of force against the
demonstrators, an official
spokesman said. He said that
the Commission will also
ascertain persons responsible
for said situation and further
will inquire into the role of IAS
Ayush Sinha, the then Karnal
sub divisional magistrate, in the
police action on farmers.
Justice Somnath Aggarwal
(retd) had in the past headed
Haryana Backward Classes
Commission.
Haryana Police had lath-
icharged a group of farmers at
Karnal’s Bastara toll plaza on
August 28 while they were
heading to protest against a BJP
meeting where Chief Minister
Manohar Lal and senior BJP
leaders were present.
7PahP]PP__^X]cb2^XbbX^]
^U8]`dXahc^_a^QTX]c^:Pa]P[
[PcWXRWPaVT^]UPaTab
?=BQ 270=3860A7
Haryana Home and Urban
Local Bodies Minister,
Anil Vij on Wednesday direct-
ed the concerned officers to
immediately open alternate
routes from Haryana to Delhi
due to closure of Singhu bor-
der and Tikri border due to
the ongoing farmers' agitation
for ten months now.
Vij while presiding over a
meeting of senior officers
here, asked them to start the
repair work of alternate routes
so that the general public
does not face any kind of
problem while commuting to
Delhi on these routes from
Haryana. The government
also released the list of alter-
nate routes which will be
repaired from Thursday
onwards. While giving
instructions to the officers,
the Home Minister said that
keeping in mind the conve-
nience of the people, the alter-
nate routes will have to be
repaired at the earliest and
work in this regard will start
from Thursday itself.
He said that short term
tenders will be issued soon. Vij
also asked the officials that the
work being done by NHAI on
NH-44 should be started
immediately so that there is no
problem in the movement of
people. On this, Vij assured
the concerned officers that if
there is any problem in start-
ing this work, the help of
police will also be provided to
NHAI. Similarly, he said that
HSIIDC roads are the main
alternative routes from
Sonepat to Delhi and they
should be repaired at the ear-
liest. Also, regarding the
Kundli-Manesar-Palwal
(KMP) Expressway, he direct-
ed the officers concerned that
there must be a provision of
public toilets at KMP.
Earlier speaking on the
issue of farmers’ unions not
attending the meeting of the
state-level committee on clear-
ing road blockade due to agi-
tation, Vij said that the
Supreme Court will be
apprized about the matter and
Home Minister Amit Shah
has already been informed
about the same. Vij said that
the case is slated to come up
for hearing on September 24,
while an early hearing has also
been sought.
He said that an affidavit
has also been filed regarding
efforts being made and the
present situation and now fur-
ther course of action will be
taken as per the court orders.
Notably, the farmers’ leaders
did not attend the meeting
convened by Haryana
Government’s high-powered
committee on Sunday over
clearing the blockade on
national highway-44 on the
Kundli-Singhu border.
Following the directions of
the Supreme Court, the State
Government had last week
constituted a state-level com-
mittee comprising Additional
Chief Secretary, Home, Rajeev
Arora as chairman to hold
talks with farmers’ organiza-
tions.
EXYbPXScWPccWT
Bd_aTT2^dacfX[[
QTP__aXiTSPQ^dc
cWTPccTaP]S7^T
X]XbcTa0XcBWPW
WPbP[aTPShQTT]
X]U^aTSPQ^dc
cWTbPT
0[cTa]PcTa^dcTbUa^7PahP]P
c^3T[WXfX[[QTaT_PXaTS)7ah
7^TX]XbcTa0]X[EXY
CWTcTRW]^[^VhXb
PVdPaP]cTTS
fPhU^aPRWXTeX]V
?aXTX]XbcTa
=PaT]SaP^SXb
eXbX^]U^a
S^dQ[X]VcWTP`dP
UPaTabX]R^T
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO$UHD'HKUDGXQ
8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL	$KPHGDEDG6RXWK%DQJDORUH	KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)
6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH	/XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
dccPaPZWP]S
347A03D=kC7DAB30H kB4?C414A!!!
?=BQ 347A03D=
The Pradesh Congress
Committee (PCC) Ganesh
Godiyal has accepted that pres-
sure is on the Congress party
after BJP and Aam Aadmi
Party (AAP) have announced
the names of the persons who
would be the face of their par-
ties in the upcoming assembly
elections in Uttarakhand. He
however added that the works
and developmental activities
during the term of the
Congress government in the
state are the face of the
Congress party.
The PCC president said
this when asked by The Pioneer
about pressure on the Congress
to declare its face in
Uttarakhand since the BJP has
declared that Chief Minister
Puskhkar Singh Dhami would
be its face while AAP has
made Colonel (Retd) Ajay
Kothiyal its CM candidate.
Launching an attack on
the CM Dhami for going on an
overdrive of announcing sops
without making provision for
the budget, Godiyal said that
the economy of the state is in
shambles. He said that the
Comptroller and Auditor
General (CAG) in its report has
mentioned that in the last four
and half years the burden of
debt on Uttarakhand has
increased by a whopping Rs
39,000 Crores. Godiyal said
that the situation is such that
the State Government in order
to pay salaries and pensions has
to borrow money. He said that
the CM is making only the
announcements and weaving a
web of lies to fool the people of
the state. The PCC president
said that the Congress party is
taking the services of econo-
mists and other experts for
drafting its manifesto and the
document would have the
party’s plan to revive the econ-
omy of the state. Godiyal
claimed that rampant corrup-
tion has occurred in the pur-
chase of medical equipment.
He said that the CM Dhami
should get this and the scams
of Kumbh testing and higher
education investigated failing
which it would become clear
that he is protecting the cul-
prits. when asked to comment
on the statement of former
Chief Minister Harish Rawat
that he want that someone
from Dalit community is made
the
CM of Uttarakhand ,
Godiyal said that any person
who is suited to lead the state
should be made the CM. He
added that Congress party has
always worked for developing
leadership among Dalits and
downtrodden sections of the
society and had made a Dalit
PCC president, speaker of
Vidhan Sabha and Rajya Sabha
MP.
?=BQ ?0DA8
The registrar of Govind
Ballabh Pant institute of
Engineering and Technology at
Ghurdauri in Pauri district,
Sandeep Kumar has been sus-
pended by the institute’s board
of governers. The board’s vice
chairperson and additional
chief secretary Radha Raturi
stated in the letter that Sandeep
Kumar is being suspended
with immediate effect since dis-
ciplinary action is being con-
templated against him due to
allegations of irregularities.
Kumar is accused of tampering
with records pertaining to his
appointment in the institute,
misleading the board of gov-
erners during his selection to
the post of registrar in the insti-
tute, financial irregularities and
not handing over files and
records of the institute which
were in his custody apart from
alleged ìrregularities in the
procurement of goods, work
and services in the institute. It
is also mentioned in the letter
that the board reserves the
right to add any further alle-
gation that is appropriate in the
light of information obtained
during inquiry. During the
period of suspension, Kumar
will not do any official work.
The newly appointed registrar
professor Y Singh confirmed
the suspension of Sandeep
Kumar. Pauri district magis-
trate Vijay Kumar Jogdande is
the administrator of the insti-
tute.
The president of joint
employees association Bharat
Singh Negi said that the asso-
ciation and the local people had
undertaken an agitation against
the irregularities allegedly
orchestrated by Sandeep
Kumar and had also met the
chief minister seeking an
inquiry. Kumar was appointed
in the institute to the post of
training and placement officer
in 2006. He was appointed as
in-charge registrar in 2016 and
again in 2017 before being
appointed the full-time regis-
trar of the institute in 2019.
?=BQ 347A03D=
The state health department
reported 23 new cases of
the novel Coronavirus (Covid-
19) and 16 recoveries from the
disease in Uttarakhand on
Wednesday. Death of no
patient was reported from the
disease on the day. The cumu-
lative count of Covid-19
patients in the state is now at
3,43,428 while a total of
3,29,695 patients have recov-
ered from the disease so far. In
the state, 7391 people have lost
their lives to Covid -19 till date.
The recovery percentage from
the disease is at 96 while the
sample positivity rate on
Wednesday was 0.13 per cent.
The state health depart-
ment reported six new patients
of Covid -19 from Dehradun,
four each from Pauri and
Pithoragarh, three from
Uttarkashi, two from Chamoli
and one each from Haridwar
and Tehri on Wednesday. No
new cases of the disease were
reported from Almora,
Bageshwar, Rudraprayag and
Udham Singh Nagar districts
on the day.
The state now has 256
active cases of Covid-19.
Dehradun with 126 cases is at
the top of the table of active
cases while Pauri has 30 active
cases. Tehri has only one active
case of the disease now. In the
ongoing vaccination drive
58,241 people were vaccinated
in 953 sessions in the state held
on Wednesday. As per the data
of the state health department
72,77,865 people in the state
have received the first dose of
vaccine while 28,76,500 have
received both doses of the vac-
cine.
?=BQ 347A03D=
The Health Minister of
Uttarakhand Dhan Singh
Rawat called upon the union
health and family welfare
minister, Mansukh Mandavia
in New Delhi on Wednesday.
In the meeting Rawat request-
ed that an All India Institute
of Medical Sciences (AIIMS)
should be opened in the
Kumaon region of the state.
He said that the people of
Kumaon division have been
demanding a super speciality
centre in their area for quite
some time and the demand
can be fulfilled by opening an
AIIMS in the region. Rawat
told the Union minister that
the state health department
has made necessary prepara-
tions to tackle the probable
third wave of the pandemic of
Covid-19.
He said that work on set-
ting up four new medical col-
leges and upgradation of
health centres is going on in
the state. Rawat told Mandavia
that one crore vaccine doses
have been administered in
the state and the target to
completely vaccinate the
entire 18 plus population
would be achieved in the
month of December.
Rawat was accompanied
by the health secretary Amit
Singh Negi and the Principal
of Government Doon Medical
College (GDMC) Dr
Ashutosh Sayana in the meet-
ing with the minister.
?=BQ 9B780C7
Abear was shot dead by
Forest department officials
in Joshimath late on Tuesday
night in the ongoing human-
wildlife conflict situation in this
part of Chamoli district. While
it is being stated that the bear
was shot in self-defense, some
observers opine that the
department personnel did not
conduct its tranquilisation effi-
ciently which led to the fatal
incident.
Black bear sightings are not
uncommon in Joshimath
though they have increased
near human settlements in
recent times due to various fac-
tors including improper
garbage disposal.
Late on Tuesday night, a
bear reached the inhabited
area of Sinhdhar. The locals
informed the forest depart-
ment about the bear. The
department personnel reached
the area along with a team
equipped to tranquilise the
animal. However, the bear ran
away downhill as the person-
nel neared it. The bear was hid-
ing in a field with the person-
nel approached it again to
tranquilise it. After the tran-
quiliser dart was shot, the agi-
tated bear rushed forward and
one of the department person-
nel crowding the site shot it.
Forest range officer Chetna
Kandpal said that the bear was
a female. Her body was buried
after post mortem examina-
tion. The department will con-
tinue to patrol the area, she
added.
?=BQ 347A03D=
The Congress party has
demanded termination of
the membership of Purola
MLA Rajkumar from the
Uttarakhand Assembly.
Rajkumar had recently joined
the BJP. The Leader of
Congress Legislature Party
(CLP) Pritam Singh submitted
a petition to Vidhan Sabha sec-
retary Mukesh Singhal on
Wednesday in which the
demand was made. In the peti-
tion Singh said that Rajkumar
contested the assembly election
of the year 2017 on the symbol
of Indian National Congress
from Purola assembly con-
stituency and was elected to the
fourth assembly of the state. He
said that on September 12,
2021 Rajkumar joined the BJP
in Delhi in presence of BJP
leaders Dharmendra Pradhan,
Anil Baluni, Madan Kaushik
and others. In his petition
Pritam Singh further added
that since Rajkumar has left the
Congress party on his own he
becomes ineligible for the
membership of the house
under the provisions of tenth
schedule of the constitution. He
demanded that the member-
ship of Rajkumar should be ter-
minated and the seat repre-
sented by him should be
declared vacant. The CLP
leader added that Rajkumar
should be barred from attend-
ing the proceedings of the
house in the capacity of its
member till action on the peti-
tion is taken.
?=BQ 347A03D=
In a significant development
the union ministry of health
has given its approval to the
Gandhi Centenary Eye
Hospital (GCEH) for setting up
an eye collection centre. The
hospital would be the first
centre in the state to have this
facility. The director general
(DG) state health services, Dr
Tripti Bahuguna has directed
the hospital authorities to start
the centre before November 1
this year. The GCEH has been
granted permission for starting
the eye collection centre under
the National Programme for
Control of Blindness. The
director National Health
Mission, Dr Saroj Naithani
said that the necessary infra-
structure and facilities would
be developed in the GCEH for
the centre.
Terming the permission
as a great achievement, Dr
Naithani said the people resid-
ing in the areas near to
Dehradun especially Garhwal
division would get the benefit
of eye transplant. She clarified
that the GCEH would only act
as the eye collection centre and
the collected eye ball would be
kept at the eye banks of All
India Institute of Medical
Sciences (AIIMS), Rishikesh or
Himalayan hospital Jollygrant,
Dehradun. It is worth men-
tioning here that there are
more than 40,000 people with
vision impairment. In India
cornea transplant is done in
about 50,000 people.
?=BQ ;0:B0A
Bharatiya Kisan Union
(BKU) leader Rakesh Tikait
said that despite governmental
pressure, the protesting farm-
ers are not relenting.
Addressing a Mahapanchayat
of protesters at Laksar in
Haridwar district on
Wednesday, he said that the
agitation will continue till the
farm laws are repealed.
Tikait said that Prime
Minister Narendar Modi had
promised to double the
income of farmers by 2022 but
farmers are far from achieving
this.
He said that the Bharatiya
Janata Party has failed to ful-
fill its promise of providing
employment to the youths. He
also alleged that Modi and
Union Minister Amit Shah
were close to the Ambanis and
Adanis. Stating that farmers
are suffering due to various
irregularities he opined that
traders will also go hungry if
the farmers lack money to
continue farming.
Referring to the coming
Assembly elections in
Uttarakhand and Uttar
Pradesh, Tikait said that the
people of these two states will
give a befitting reply to politi-
cians not working for their
welfare.
During his address, Tikait
focused considerably on polit-
ical and other issues along
with agricultural issues.
µ4`_Xf_UVcacVddfcVe`
R__`f_TVWRTVZ_FYR_U
BPhbcWPc2^]VaTbbWPb
P[fPhbf^aZTSU^a
STeT[^_X]V[TPSTabWX_
P^]V3P[XcbP]S
S^f]ca^SST]bTRcX^]b
*KXUGDXULLQVWLWXWH
UHJLVWUDUVXVSHQGHGIRU
DOOHJHGLUUHJXODULWLHV
3_fYT!)*#^UgSQcUc
!bUS_fUbYUcY^Eµ[XQ^T
?=BQ 347A03D=
The Nainital district admin-
istration has directed
municipal bodies to install
separate bins in marketplaces
for the proper disposal of used
face masks. The chief develop-
ment officer (CDO) Sandeep
Tiwari told The Pioneer that the
usage of face masks has
increased considerably in the
past two years due to the Covid-
19 pandemic but their dispos-
al with the regular garbage can
cause damage to human health
and the environment. He said
that the administration wants
people to develop a habit to dis-
pose of their face masks sepa-
rately as their usage may poten-
tially increase with time.
Many people throw used
face masks in garbage bins and
in open areas which can be
harmful to humans as well as
the environment. The admin-
istration is considering used
masks as a bio-hazard and
working for their proper dis-
posal across the district. As an
initiative, I have recently direct-
ed the municipal bodies to set
up separate bins in crowded
locations in their respective
areas for the disposal of the
used masks within one week,
said the CDO. He informed that
the municipal bodies of Nainital
and Haldwani have been direct-
ed primarily to install the sep-
arate bins for masks disposal
and others will follow it after-
wards.
Tiwari stated that the
administration is also consid-
ering making incinerators avail-
able in the municipal offices for
proper masks disposal to avoid
any further possibility of the
spread of any kind of infection.
Till then, the used masks will be
disposed of like biomedical
waste, said Tiwari.
=PX]XcP[23SXaTRcbX]bcP[[PcX^]^U
bT_PaPcTQX]bU^adbTSPbZbSXb_^bP[
1TPabW^cSTPS
X]Q^cRWTS
caP]`dX[XbPcX^]
PccT_c
2^]VSTP]SbSXb`dP[XUXRPcX^]^USTUTRc^a
APYZdPa´b0bbTQ[hTQTabWX_
2;?[TPSTa?aXcP
BX]VWbdQXcb
_TcXcX^]
'KDQ6LQJK
GHPDQGV$,,06
IRU.XPDRQUHJLRQ
TTcbD]X^]
X]XbcTaP]SPeXP
X]=Tf3T[WX
(HFROOHFWLRQ
FHQWUHWRFRPH
XSLQ'RRQ
:RQ¶WUHOHQWWLOOIDUP
ODZVDUHUHSHDOHG
%.8OHDGHU7LNDLW
?=BQ 1064B7F0A
The authorities have ordered
closure of the government
high school at Bilauna for three
days after a class VIII student
tested positive for Covid-19.
The chief education officer
(CEO) has issued an order to
close the school for three days
and conduct Covid tests of all
students who came in contact
with the positive student in this
school situated near Bageshwar
city. The student found infected
hasbeenkeptinhomeisolation.
The school management
informedthedepartmentaloffi-
cials about the student of
Bilauna's government high
school being found Covid pos-
itive. The CEO Padmendra
Saklanihasinstructedtheschool
managementtoclosetheschool
for the next three days and san-
itizetheschoolbuildingproperly.
BRW^^[R[^bTSU^acWaTTSPhb
PUcTabcdST]ccTbcb_^bXcXeT
?=BQ 347A03D=
In view of the increasing
number of dengue patients in
the city which has risen above
15 patients, the municipal com-
missioner Abhishek Ruhela
has directed the health section
of the Municipal Corporation
of Dehradun (MCD) to keep a
complete record of the fogging
being done by the sanitation
workers. Recently, many locals
from different locations have
approached the commissioner
for regular fogging in their
areas as a preventive measure
against dengue as many stated
that fogging is not being done
in several areas of the city for
weeks. On the other hand, the
officials of the health section
have been claiming constantly
that fogging is being done reg-
ularly across the city. According
to them, the workers are car-
rying out regular fogging in
areas like Indiranagar, Vasant
Vihar and Seemadwar where
most of the dengue patients
have been found so far and fog-
ging in other areas is being
done in regular intervals.
Due to this, Ruhela has
directed the officials of the
sanitation section to maintain
a complete record of when
and at which place, the fog-
ging is being done by the cor-
poration.
He said that the corpora-
tion will take public feedback
on the fogging and the report
on regular fogging will help in
maintaining transparency too.
=e^YSY`QS_]]YccY_^Ub
TYbUSdcd_[UU`V_WWY^WbUS_bT
?=BQ 347A03D=
The Dehradun Mayor Sunil
Uniyal 'Gama' inspected
the ongoing construction
works under Atal Mission for
Rejuvenation and Urban
Transformation (AMRUT) in
the Kaulagarh area on
Wednesday. Along with the
officials of Peyjal Nigam,
'Gama' also inspected the
sewage treatment plant of the
minimal liquid discharge
(MLD) system. The officials
informed the mayor that com-
pletion of this treatment plant
which is being constructed
with a budget of Rs seven
crore will considerably min-
imise waterlogging in the near-
by areas during monsoon. They
said that the plant will be
ready by March next year.
‘Gama’ asked the officials to
complete the work as soon as
possible to avoid any inconve-
nience to locals.
µ*DPD¶LQVSHFWV$0587
ZRUNLQ.DXODJDUK
?=BQ 347A03D=
In view of the Pulse Polio
drive on Sunday, the
Dehradun district administra-
tion has directed the health
department officials tocarry out
a detailed homework and work
plan to maximise the polio vac-
cination in the areas where chil-
dren are more vulnerable to be
deprived of the vaccination. In
a virtual meeting with the offi-
cials of various departments
including health, education,
Panchayati Raj and women
empowerment and child devel-
opment, the additional district
magistrate (ADM) Shiv Kumar
Barnwal directed to ensure the
implementation of Covid-19
guidelines in all the vaccination
centres. He asked the officials to
minimise the physical contact
with the children as much as
possible during the vaccination
and if required, parents should
be asked to help in giving polio
drops. The ADM also asked the
health department to allot the
duty to staff for the polio drive
without causing any disruption
in the ongoing Covid vaccina-
tion drive.
The district immunisation
officer Dinesh Chauhan also
informed during the meeting
that polio vaccination will be
administered in every health
centre of every block of the dis-
trict this Sunday except
Chakrata and Kalsi.
Subsequently,hesaid,theseven-
day door to door polio vaccina-
tion drive will be started from
Monday too. He also informed
that vaccination will be admin-
istered in a total of 1,245 booths
including 1,169 permanent
booths, 56 transit booths and 20
mobile booths with the help of
249 supervisors. Besides this,
1,002 teams with the help of 334
supervisors will conduct the
door to door drive across the
district, added Chauhan.
14=TYbUSdcXUQdXTU`d
d_g_b[_^]QhY]YcY^W
`_Y_fQSSY^QdY_^
?=BQ =08=8C0;
Hearing the case for release
of a Pakistani citizen
arrested on charges of spying,
the Uttarakhand High Court
maintained the sentence hand-
ed out to Lahore resident Abid
Ali alias Ajit Singh. Handing
out its judgement, the single
bench of Justice Ravindra
Maithani directed the govern-
ment to cancel his bail bond
and take him in custody,
adding that there was ade-
quate proof against Ali and that
he had violated the Passport
Act.
On January 25, 2010 dur-
ing the Kumbh Mela in
Haridwar, the police had arrest-
ed Ali in Roorkee under the
Official Secrets Act, Foreigners
Act and Passport Act. The
police found maps of army
installations in Meerut,
Dehradun, Roorkee and other
locations, one pen drive and
various documents pertaining
to sensitive information. On
raiding his accommodation in
Macchi Mohalla, the police
had found about a dozen SIM
cards concealed behind a
switch board and the ceiling
fan. Finding him guilty, the
lower court had sentenced him
to seven years imprisonment in
December 2012. His counsel
had filed an appeal or his
release but did not state correct
facts about his address and
other details.
A Court in Haridwar had
issued orders for his release but
the jail superintendent sub-
mitted an application in the
court and the office of the
senior superintendent of police
stating that the person was a
foreign citizen and that a per-
sonal bond and other formal-
ities had to be fulfilled before
his release.
The Government filed a
special appeal against the order
of the lower court stating that
the same should be cancelled as
there was ample evidence of Ali
spying.
CXZPXc^_X]TScWPc
caPSTabfX[[P[b^V^
Wd]VahXUcWTUPaTab
[PRZ^]Thc^
R^]cX]dTUPaX]V
8]8]SXPR^a]TP
caP]b_[P]cXbS^]T
X]PQ^dc$
_T^_[T
+PDLQWDLQVVHQWHQFH
LQ3DNHVSLRQDJHFDVH
]PcX^]#
347A03D=kC7DAB30H kB4?C414A!!!
?=BQ =4F34;78
There are no issues with the
CoWin app or the vaccine
certification process, National
Health Authority CEO RS
Sharma said on Tuesday, a few
minutes after a revised UK
advisory accepted Covishield as
a valid vaccine but said double-
jabbed Indians still have to
quarantine because of “vacci-
nation certification issues”.
“There are no issues on
CoWin with certification... sys-
tem is entirely WHO compli-
ant. We continue to have dis-
cussions with the International
Civil Aviation Organisation.
The UK High Commissioner
visited me on September 2.
They wanted to understand the
system... technical aspects,” Dr
Sharma told NDTV.
“A resource has been allo-
cated and two further conver-
sations have happened with
their team. These were techni-
cal-level conversations,” he
explained.
The British High
Commission said: “We are
engaging with the Government
of India to explore how we can
expand UK recognition of cer-
tification to people vaccinated
by a relevant public health
body in India.”
The UK’s updated travel
advisory now says:
“Formulations of the four list-
ed (i.e., recognised in the UK)
vaccines, such as AstraZeneca
Covishield, AstraZeneca
Vaxzevria... qualify as approved
vaccines”.
Serum Institute CEO Adar
Poonawalla, whose facility
manufactures (and then ships
back to the UK) Covishield said
that he was “delighted” with the
recognition but warned “the
matter for travel and quaran-
tine is not resolved”
The rules also consider
who have received jabs under
public health bodies in
Australia, Antigua and
Barbuda, Barbados, Bahrain,
Brunei,Canada, Dominica,
Israel, Japan, Kuwait, Malaysia,
New Zealand, Qatar, Saudi
Arabia, Singapore, South Korea
or Taiwan as fully vaccinated.
Changes in UK rules are
most likely to affect students,
who are now returning in large
numbers to British universities
or travelling to Britain to start
new courses. The change will
mean they will have to pay
extra for quarantine.
?`ZddfVdhZeY4`HZ_Raa
[RSTVceZWZTReZ`_+ ?9246@
?=BQ =4F34;78
The Director General of
World Health
Organisation (WHO), Tedros
Adhanom Ghebreyesus, on
Wednesday thanked Union
Health Minister Mansukh
Mandaviya for resuming ship-
ments of covid-19 vaccines for
COVAX, a multilateral initia-
tive aimed at fostering global
access to coronavirus vac-
cines from October.
Taking it to twitter Tedros
said, “Thank you Health
Minister Mansukh Mandviya
for announcing India will
resume crucial COVID19 vac-
cine shipments to COVAX in
October. This is an important
development in support of
reaching the 40% vaccina-
tion target in all countries by
the end of the year.”
Mandaviya on Monday
had said that India will resume
exports of covid-19 vaccines
from October in order to
meet its commitment for
global supplies through
COVAX. The Minister had
further said that with the
production of covid-19 vac-
cines being accelerated, the
central government will
receive over 30 crore doses in
October followed by 100
crores additional doses in the
next three months.
COVAX, the vaccines pil-
lar of the Access to covid-19
Tools Accelerator, is co-con-
vened by the Coalition for
Epidemic Preparedness
Innovations (CEPI), Gavi, the
Vaccine Alliance and World
Health Organization (WHO),
working in partnership with
Unicef, vaccine manufacturers
across developed and devel-
oping countries and World
Bank, among others.
The COVAX earlier this
month cut the forecast for the
availability of doses for 2021
by 25% citing export restric-
tions on Serum Institute of
India (SII). The major reasons
for the reduction in the num-
ber of doses that COVAX
expected to receive in 2021
were export restrictions and
uncertainty around the
resumption of exports from
SII, a key COVAX supplier,
and increased challenges at
manufacturing sites that sup-
ply COVAX.
There are 11 vaccines in
the COVAX portfolio, includ-
ing Covishield.
F736_aPXbTb
7TP[cWX]´bSTRXbX^]
c^Tg_^acePRRX]T
2WP]VTbX]D:
ad[TbPaT^bc
[XZT[hc^PUUTRc
8]SXP]bcdST]cb
?=BQ =4F34;78
The Supreme Court on
Wednesday rejected a plea
filed by Shree Padmanabha
Swamy Temple Trust, run by
the Travancore royal family,
seeking to exempt it from the
audit of 25 years as ordered by
the top court last year. A bench
headed by Justice U U Lalit said
the audit should be completed
as early as possible, preferably
within three months.
“It is clear that the audit
contemplated was not intend-
ed to be confined to the tem-
ple only but with respect to the
trust. This direction has to be
seen in light of the reports of
the amicus curiae in the case as
recorded in order dated 2015,”
said the bench, also comprising
Justices S Ravindra Bhat and
Bela M Trivedi. The apex court,
however, refrained from pass-
ing any order on the plea of the
Trust to exempt it from the
administrative supervision of
the Administrative Committee
constituted by it saying that it
requires factual analysis.
The Administrative
Committee of the Shree
Padmanabhaswamy Temple in
Kerala had on September 17
told the apex court that it is in
great financial stress and the
offerings are not sufficient to
meet the expenses, while seek-
ing an audit of the temple-relat-
ed trust run by the Travancore
royal family.
All temples in Kerala are
closed and while this temple’s
monthly expenses are C1.25
crore, “we are able to hardly get
60-70 lakh rupees. Therefore,
we have sought certain direc-
tions,” senior advocate R
Basant, appearing for the com-
mittee, had said. The temple is
in great financial stress and “we
are not able to function”, Basant
had said, alleging that the Trust
is trying to avoid its obligation
by not making their record
available for audit.
The Trust has 2.87 crore in
cash and 1.95 crore in assets as
per the 2013 auditors’ report
and that is why the entire
thing has to be gone into to find
out how much money it has, he
had said. The Trust is consti-
tuted as per court’s order and
it must contribute to the tem-
ple, Basant had told the bench.
Senior advocate Arvind
Datar, appearing for the Trust,
had argued that it is a public
Trust made by the Royal fam-
ily and has no role in admin-
istration. The Trust was just
mentioned by the Amicus
Curiae in the case, not as part
of the petition, he said.
B2]XgTb?PSP]PQWPcT_[T
cadbc_[TPc^TgT_cUa^PdSXc
BT]X^aPSe^RPcT
0aeX]S3PcPa
P__TPaX]VU^acWT
CadbcWPSPaVdTS
cWPcXcXbP_dQ[XR
CadbcPSTQhcWT
A^hP[UPX[hP]SWPb
]^a^[TX]
PSX]XbcaPcX^]
A094B7:D0AQ =4F34;78
Canada has suspended
flights from India until
September 26. The flights may
be resumed from September 27
but it would depend on the
results of Covid-19 tests con-
ducted on arrival in Canada on
passengers travelling from New
Delhi on three flights on
Wednesday. Air Canada has
nonstops on Delhi-Toronto
and Delhi-Vancouver routes.
Air India flies to Canada direct
from Delhi.
“As Canada prepares for
the return of direct flights
from India to Canada,
Transport Canada has
announced an extension of the
Notice to Airmen (NOTAM)
that restricts all direct com-
mercial and private passenger
flights to Canada from India
until September 26, 2021, at
23:59 EDT. As a first step, on
September 22, 2021, three
direct flights from India will
arrive in Canada and all pas-
sengers on these flights will be
tested for COVID-19 upon
arrival to ensure that the new
measures are working,” the
Canada government said.
If a high number of posi-
tive Covid-19 results are found,
the planned lifting of the flight
ban on September 27 will be
reconsidered.
Once the restriction on
direct flights expires, travellers
eligible to enter Canada will be
able to board direct flights
from India to Canada must
have proof of a negative
COVID-19 molecular test from
the approved
Genestrings Laboratory at the
Delhi airport taken within 18
hours of the scheduled depar-
ture of their direct flight to
Canada.
“Prior to boarding, air
operators will be checking the
travellers’ test results ensuring
they are eligible to come to
Canada, and that fully vacci-
nated travellers have uploaded
their information into the
ArriveCAN mobile app or
website. Travellers who are
unable to meet these require-
ments will be denied boarding,”
it said.
“After the resumption of
direct flights, travellers who
are eligible to enter Canada
who depart India for Canada
via an indirect route will con-
tinue to be required to obtain,
within 72 hours of departure,
a valid negative COVID-19
molecular test from a third
country – other than India –
before continuing their journey
to Canada,” it added.
?=BQ =4F34;78
Demanding a Supreme
Court-monitored probe
into the large drugs haul in
Gujarat and in the alleged
bribery case involving e-com-
merce firm Amazon, the
Congress on Wednesday said
Prime Minister Narendra Modi
should answer the nation on
these “very serious” issues of
national security.
“Theseissuesareconcerned
with the country’s security and
thoseinvolvedintheseissuesare
guiltyofseditionandthatiswhy
the prime minister will have to
answer the nation,” Congress
general secretary and chief
spokesperson Randeep
Surjewala said, a day after the
Directorate of Revenue
Intelligence (DRI) seized
2,988.21 kg heroin worth crores
ofrupeesfromtwocontainersat
the Adani-operated Mundra
port in Gujarat’s Kutch district
and subsequently.
Those involved in these
casesare“traitors”,Surjewalasaid
adding “Should this matter now
not be investigated by a special
commission of sitting judges of
theSupremeCourtandaspecial
SIT be put at their disposal?”
He also rejected suggestions
of seeking a CBI probe, saying,
“How can CBI probe those
who are its bosses?” He said the
shocking revelations in the two
cases have shaken the con-
science of the country.
On the Amazon case, he
said it has now come out that
the e-commerce giant spent Rs
8,546 crore in “legal fees”,
whereas India’s Law Ministry’s
annual budget is only C1,100
crore.
“The so-called alleged
bribery of C8,546 crore was
being given to whom in the
Modi Government? Who
received the money? Was this
money given to annihilate the
trade and business of crores of
small shopkeepers, MSMEs and
traders so that e-commerce
companies like Amazon could
take away their businesses and
livelihood,” he asked.
2^]VbTTZbB2[TS
_a^QTX]c^SadV
bTXidaTUa^6dYPaPc
2P]PSPbdb_T]SbU[XVWcb
Ua^8]SXPcX[[BT_cTQTa!%
?C8Q =4F34;78
The Supreme Court on
Wednesday asked both
the Uttar Pradesh
Government and officials of
Allahabad High Court to sit
together and jointly submit
the suggestions for regulating
the matters of bail applica-
tions during the pendency of
the appeals of the convicted
persons.
The top court said that if
the suggestions are not given,
then it may formulate some
guidelines on its own.
A bench of Justices Sanjay
Kishan Kaul and B R Gavai
said that Allahabad High
Court registry has 20-25 page
suggestions which are like
counter-suggestions to those
already given by Uttar
Pradesh government.
The top court was
informed that Allahabad
High Court had filed the sug-
gestions last evening.
“State Government has
said something and now you
(Allahabad High Court) have
said something. They have
given suggestions and now
you have given counter-sug-
gestions of 20-25 pages. How
are we supposed to zero in on
the most suitable ones? If
you are unable to give sug-
gestions then we will formu-
late some guidelines on our
own,” the bench said.
Additional Advocate
General Garima Prashad,
appearing for Uttar Pradesh,
said that sometime be
given to them as now they
have come to know about the
thinking of the High Court
and they will sit together and
compile the most suitable sug-
gestions.
The bench said that the
High Court may itself issue
some directions which may
meet its expectation and both
the UP government and reg-
istry staff of the High Court
can sit together and sort out
the problem.
It posted the matter for
further hearing on October 5.
The top court is hearing
18 criminal appeals of the
convicts in heinous offences
seeking bail on the ground
that they have spent seven or
more years in jail and be
granted bail as their appeals
against the convictions are yet
to be listed for regular hear-
ing in the high court due to
the long pendency.
The High Court has given
a slew of suggestions to the
top court like in cases of seri-
ous and grave offences, rights
of the victim and his family
should be considered before
granting bail to an accused.
?=BQ =4F34;78
With 2 more FIRs on
Wednesday, the CBI has
so far re-registered as many as
40 cases related to post poll vio-
lence in West Bengal following
the Calcutta high court orders.
Out of the two new cases ,
the first was earlier registered
at Jhargram police station in
Jhargram district as FIR
No.55/2021 dated March 21,
2021.
The case was lodged on the
allegations that the accused,
residents of Pindrakuli in the
district, attacked the victim
on the same day with sharp
weapons due to their alleged
political rivalry, while the vic-
tim was sitting in a tea stall.
The victim was admitted to
Jhargram Super Speciality
Hospital. Later, the victim suc-
cumbed to the injuries.
The other case was earlier
registered at Narendrapur
police station in South 24
Parganas district as FIR No.
588/2021 dated May 6 on the
allegations that the accused
and others attacked the house
of the complainant on May 5
this year due to alleged politi-
cal rivalry.
It was further alleged that
the victim (complainant’s hus-
band) who tried to intervene
with the miscreants, was
attacked. The victim was
rushed to the May 6, he suc-
cumbed to injuries.
The CBI is taking over
cases of post-poll violence in
West Bengal in compliance
with the orders of Calcutta
High Court passed in connec-
tion with a clutch of writ peti-
tions.
The HC had passed the
orders on August 19 and took
over the investigation of these
cases earlier registered at dif-
ferent police stations of West
Bengal on various allegations.
CBI has so far registered 40
cases and Investigation is con-
tinuing in these cases.
%,ILOHVWZRPRUH
),5VLQ%HQJDO
SRVWSROOYLROHQFH
8UPWXVW]dQTa
^U_^bXcXeT2^eXS
(aTbd[cbPaT
U^d]ScWT
_[P]]TS[XUcX]V^U
cWTU[XVWcQP]^]
BT_cTQTa!
fX[[QT
aTR^]bXSTaTS
:RUNWRJHWKHUWRVXJJHVWFRQYLFWV¶EDLO
SOHDV6WR83*RYW$OODKDEDG+
?=BQ =4F34;78
Children with Down’s syn-
drome have a lower
chance of survival from acute
lymphoblastic leukemia
(ALL), a particular high-risk
form of blood cancer, than
children without the disabil-
ity, new research published in
Lancet Haematology has said.
In other words, children
at higher risk of their cancer
coming back usually receive
more intensive treatment. But
that’s not possible for children
with Down, as they tend to
have more side effects from
treatment. The syndrome is a
genetic disorder – but the
possible effect of DNA
changes in leukemia cells in
Down’s Syndrome was still
unknown.
In a new study, scientists
from the Princess Máxima
Center and the Erasmus
Medical Center compared the
effect of therapy in leukemia
patients with and without
Down’s Syndrome . The
international study, involving
researchers from the United
Kingdom, Germany,
Scandinavia and Australia,
was In the Netherlands, the
study was funded by the
Princess Máxima Center
Foundation and the
Children’s Oncological Center
Rotterdam Foundation.
To account for differences
in known risk factors, data
from 136 leukemia patients
with Down’s Syndrome were
matched with those from 407
children who did not have
Down’s Syndrome . The
matched ‘duos’ had the same
age, ALL subtype, and blood
results at diagnosis. That’s
how the researchers knew
that any differences that
remained were linked to
Down’s Syndrome .
Their analysis showed
that the levels of leukemia
cells decreased equally well in
both groups of children after
the first month of treatment.
But the scientists
discovered an important dif-
ference in longer-term out-
come between children with
and without Down’s
Syndrome in the so-called
Ikaros form of ALL.
A DNA error in the
Ikaros gene leads to a more
aggressive form of the disease
in all children with leukemia.
But children who also had
Down’s Syndrome had an
even worse outcome than
children without the disabil-
ity, the researchers found.
Naomi Michels, PhD stu-
dent in the Den Boer group,
also part of the Oncode
Institute, was involved in the
study. ‘The Ikaros gene main-
ly increases the risk of cancer
coming back,’ she said.
‘Children with Down’s
Syndrome and Ikaros ALL
were more likely to see their
leukemia return within five
years of treatment.’ This was
the case in 37 per cent of these
children, compared with 13
per cent of Ikaros ALL
patients who did not have
Down syndrome. In other
types of ALL, there was no
notable difference between
children with and without
Down syndrome.
The researchers believe
the difference has to do with
an interaction between the
genetic changes in Down’s
Syndrome and the Ikaros
gene. Michels: ‘We need to
continue the search for treat-
ments with fewer side effects
– such as targeted therapies
and forms of immunotherapy
– in order to be able to bet-
ter treat children with Down
syndrome who have this high-
risk form of ALL.’
2WX[SaT]fXcW3^f]´bBh]Sa^TWPeT
[^fTaRWP]RT^UbdaeXeP[Ua^0;;)BcdSh
80=BQ =4F34;78
The Co-founder and Joint
Managing Director of
Hyderabad-based Bharat
Biotech, Suchitra Ella has said
that vaccines should not be a
barrier to enter into any nation.
Amid the ongoing row
over new UK travel restrictions
that consider fully Indian vac-
cinated as unvaccinated and
prescribes 10-day quarantine,
she said, Vaccines must not be
entry barriers for nations.
Underlining that India has
supplied billions of doses of
Covid-19 vaccine the world
over, Suchitra Ella tweeted,
Our vaccines will prove yet
again that they are world class.
According to the new UK
rules, Indian travellers who
have received both doses of the
Covishield vaccine manufac-
tured by the Serum Institute of
India (SII) will be considered
unvaccinated and will have to
undergo self-isolation for 10
days, though the UK has revised
its travel policy to include
Covishield as an approved vac-
cine after India raised strong
objections.
Bharat Biotech Co-founder
tweeted, Our vaccines will
prove yet again, are world class.
India has supplied billions of
doses world over. Covid-19
taught us enough life lessons,
vaccines must not be entry bar-
riers for nations, when NRA
approved  licensed, crossed
800 mn doses, no small achieve-
ment.
India's mass vaccination
program is being run with
mainly two vaccines Covishield
and Covaxin. Hyderabad-based
Bharat Biotech has developed
Covaxin in collaboration with
the Indian Council of Medical
Research. Covishield has been
developed by researchers at
the University of Oxford and
pharma giant AstraZeneca.
However, the WHO chief
scientist Dr Saumya
Swaminathan has said that all
countries are supposed to follow
the WHO recommendations.
EPRRX]Tdbc]^c
QTT]cahQPaaXTaU^a
]PcX^]b)1WPaPc
1X^cTRW2^5^d]STa
80=BQ =4F34;78
President Ram Nath Kovind
reiterated on Wednesday
that India has been at the fore-
front of the global efforts to
forge a decisive and coordinat-
ed response to the Covid-19
pandemic to ensure collective
healthand economic well-being.
Kovind also stated that
under the world’s largest vacci-
nation campaign, Indians have
received more than 800 million
doses so far.
The President was speaking
after accepting the credentials
from Ambassadors/High
Commissioners of Iceland,
Gambia, Spain, Brunei
Darussalam and Sri Lanka in a
virtual ceremony, a commu-
nique from the Rashtrapati
Bhavan said.
Kovind added that India’s
engagement in the United
Nations and other multilateral
fora has resulted in mutually
beneficial partnerships.
“India remains committed
to a just and equitable global
order, keeping in mind the
interests of the developing coun-
tries and the under-represent-
ed,” he said.
8]SXPPcU^aTUa^]c^U
V[^QP[aTb_^]bTc^
2^eXSRaXbXb)?aTi
]PcX^]$
347A03D=kC7DAB30H kB4?C414A!!!
C;:8C20B4)B29D=:B
?;40B52´60A76EC
=Tf3T[WX)CWTBd_aTT2^dac
^]FTS]TbSPhaTUdbTSc^
T]cTacPX]cf^bT_PaPcTP__TP[b^U
cWT2WWPccXbVPaW6^eTa]T]c
PVPX]bc^aSTab^UcWT7XVW2^dac
VaP]cX]VPbcPh^]X]eTbcXVPcX^]X]
P]58AaTVXbcTaTSPVPX]bcbT]X^a
19?[TPSTaP]SU^aTa2WXTU
X]XbcTaAPP]BX]VWP]ScWT
_Pachb_^ZTbP]BPQXc?PcaP
U^acWTXacfTTcbX]R^]]TRcX^]fXcW
cWTP[[TVTSUPZTc^^[ZXcRPbT
6EC?A24BB70BC01834
1H2DAC38A42C8=B)B2
=Tf3T[WX)CWT6^eTa]T]c
_a^RTbbWPbc^PQXSTQhR^dac
SXaTRcX^]bcWTBd_aTT2^dac
bPXS^]FTS]TbSPhfWX[T_d[[X]V
d_:TaP[PPdcW^aXcXTbU^a]^c
STRXSX]VcWT_a^_^bP[_TacPX]X]V
c^_aTPcdaTaT[TPbT^Ucf^
R^]eXRcbfW^PaTbTaeX]V[XUTcTa
P]SWPeTQTT]X]YPX[U^a!'hTPab
X]R[dSX]VaTXbbX^]
B210B44:B0D384=24
5A2988=10A8BBD4
=Tf3T[WX)CWTBd_aTT2^dac
1Pa0bb^RXPcX^]B210WPb
faXccT]c^2WXTU9dbcXRT^U8]SXP
298=EAPP]PdaVX]VcWPcP]
PdSXT]RTQTVXeT]c^Xcb4gTRdcXeT
2^XccTTTQTabc^SXbRdbb
XbbdTbbdRWPbT[TePcX^]^UP_Tg
R^dac[PfhTabPb7XVW2^dac
YdSVTbcWTXaSTbXV]PcX^]Pb
bT]X^abP]SP[[^cT]c^U
RWPQTabX]cWT_aTXbTbWTaT
DB86=43C8?AE4
;8E4BC2:B42CA
=Tf3T[WX)CWT3T_PacT]c^U
0]XP[7dbQP]SahP]S3PXahX]V
3073P]S1X[[T[X]SP6PcTb
5^d]SPcX^]WPeTbXV]TSPd[cX
hTPa^Dc^f^aZc^VTcWTa^]
bdbcPX]PQ[hX_a^eX]V8]SXP³b
[XeTbc^RZbTRc^ac^bd__^accWT
]PcX^]³bU^^SP]S]dcaXcX^]P[
bTRdaXchP]S_a^cTRccWT
TR^]^XRfT[[QTX]V^U
bP[[bRP[T[XeTbc^RZ_a^SdRTab
8=B7AC
B0D60AB4=6D?C0Q :;:0C0
Bengal Chief Minister
Mamata Banerjee once
again invoked the “Khela”
(game) slogan while addressing
an audience in the
Bhawanipore Assembly by-
elections. Attacking the BJP
she said “khelbo, lorbo, BJP ke
harabo … Bharat theke tariya
charbo (we will play, fight and
defeat the BJP and banish it
from India),” the Chief Minister
said attacking the Centre and
the other saffron Governments
of the country
including the one running in
Tripura.
The Chief Minister who
was defeated from Nandgram
seat is seeking election from
Bhawanipore her home con-
stituency from where she won
in 2011 and 2016 before leav-
ing this seat for Nandigram in
2021.
Bhawanipore was earlier
vacated by sitting MLA
Sobhandeb Chattopadhyay to
let Banerjee contest from this
seat.The TMC had trailed to
the BJP from this Assembly
segment in 2019 parliamentary
elections.
Hitting the BJP with its
own weapon Banerjee ques-
tioned the BJP’s Government’s
clamping of restrictive orders in
Tripura apparently to stop
YMC national general secretary
Abhishek Banerjee from orga-
nizing rallies in that
State.
Referring to the oft repeat-
ed allegations by saffron lead-
ers that “Mamata Banerjee
Government does not allow
Durga Pujas, Laxmi Pujas in
Bengal … but now they have
imposed Section 144 in Tripura
till November 4 … now I am
asking how will Durga Pujas,
Laxmi Pujas or even the Kali
Puja will take place in Tripura
… so Are you not stopping the
Pujas in that State.”
Aware that her “outsider”
plank had yielded results dur-
ing the April-May Assembly
elections Banerjee once again
raised the issue saying “the BJP
is once again bringing outsiders
to Bhawanipore to defeat me ...
but I am the daughter of this
area … the people will never
jettison me … the BJP had
brought all kinds of people
from all over the country but all
of them were discarded by the
voters … again the outsiders
who are coming to Bengal will
get a befitting reply.”
Listing her exploits the
Chief Minister said how her
Government had dug 3.5 lakh
ponds all over the state to har-
vest rain water and how she has
been working round the clock
to introduce the people-friend-
ly policies like “Swasthya Saathi
(health insurance for all), Sabuj
Saathi (free cycles to school stu-
dents), C10 lakh worth
Students’ Credit Cards,
Kanyashree (scheme for girl
students,” Banerjee said the
Centre was allowing the two
ports of Bengal to lapse into
non-use.
“But we are constructing a
third port at Tajpur near
Digha,” she said adding if she
is allowed to remain the Chief
Minister more developments
will follow. “If I am defeated
Someone else will be the Chief
Minister but that is not all …
my question is I want to per-
form … I want to work for you
and so I have come once again
to you,” she said.
HV¶]]a]RjWZXYe`fde3;A+ 5ZUZ
B0D60AB4=6D?C0Q :;:0C0
Alleged post-poll violence
claimed yet another victim
when the BJP’s candidate for
the Magrahat West Assembly
seat Dhurjati Saha succumbed
to his injuries on Wednesday.
The saffron outfit imme-
diately said that it will petition
the National Human Rights
Commission seeking inter-
vention and demanded that the
ongoing court-monitored CBI
investigation into the post-
election violation be extended
to cover the Wednesday’s inci-
dent.
Saha was attacked on the
counting day as the election
results started pouring in. “He
was trailing during the count-
ing and when he came out of
the counting station Trinamool
Congress goons led by local
TMC MLA Ghyasuddin Molla
attacked him giving him head
injuries … the next day he was
hospitalized ... and finally he
succumbed to his injuries
today,” Saha’s family members
alleged demanding CBI inves-
tigation into the case.
BJP MP Arjun Singh who
visited the hospital too said, “he
was beaten up by the hench-
men of local TMC MLA after
counting trends showed he
(Saha) was trailing. He had to
be admitted to the hospital the
next day… we are bringing it to
the notice of the NHRC and
will demand a CBI investiga-
tion.”
After leaving incommuni-
cado for the most part of the
day Molla later told in the
evening that he had nothing to
do with the incident.
New Bengal BJP president
Dr Sukanto Majumdar said
“this is the instance of a demo-
cratic government being run by
Mamata Banerjee … where
even as candidate is not spared
… the TMC goons promoted
by the State Government has
killed Dhurjati Saha who was
a dedicated and honest party
man … this the blackest day in
the Bengal’s politics.”
The death of Saha takes
place amid ongoing CBI inves-
tigation into the post-poll vio-
lence in Bengal.
A five-member bench of
the Calcutta High Court acting
upon a recommendation of
the NHRC had earlier ordered
a court-monitored CBI inves-
tigation into the incidents of
violence.
The death of the BJP can-
didate comes at a time when a
petition --- seeking quashing of
the High Court order --- filed
by the State Government is
pending before the Supreme
Court. In the petition the State
has claimed that it had acted on
58 percent of the reported
cases of violence.
Besides it has also said
that most of the violence took
place during when the Election
Commission was at the helm
and not the TMC
Government.
On whether the
Wednesday’s incident could
have any impact on the Apex
Court decision a set of lawyers
said “we cannot say that it won’t
… the Supreme Court will
take into account everything
legal and factual.”
%-3FDQGLGDWHLQMXUHGLQ
SRVWSROOYLROHQFHGLHV
78C:0=370A8Q 90D
The Jammu  Kashmir
administration headed by
Lt-Gov Manoj Sinha on
Wednesday issued orders of
dismissal of six more employ-
ees, three each from Kashmir
and Jammu divisions for hav-
ing terror links and working as
Over Ground Workers
(OGW).
At least eleven (11)
employees including two sons
of Hizbul Mujahideen founder
Syed Salahuddin were also dis-
missed from their services by
the UT administration on July
10, 2021.
According to official
sources, two police constables,
two school teachers, a range
officer in the Forest department
and a junior assistant in the
Public Works Department were
dismissed from their services
after a designated committee
recommended their cases
under Article 311(2)(c) of the
Constitution.
The dismissal orders were
issued by the
Commissioner/Secretary to the
General Administration
department on Wednesday.
According to these orders,
two police constables identified
as Showkat Ahmad Khan hail-
ing from Budgam and Jaffer
Hussain Butt from Kishtwar
were dismissed from their ser-
vices with immediate effect.
According to police
records, Jaffer Hussain Butt
was arrested by the police and
chargesheeted by the National
Investigation Agency (NIA) in
a case on gun-running while
khan is alleged to have been
involved in looting of weapons
from an MLC’s house. He was
posted as a PSO with a
Legislative Council member.
He was detained under the PSA
in 2019. According to police,
Jaffer, currently on bail,is
alleged to have provided his car
to Hizbul Mujahideen terrorists
and facilitated their safe move-
ment, a fact which is explained
in the NIA chargesheet.
Another Government
employee Abdul Hamid Wani,
a resident of Bijbehara in
Anantnag, who was working as
a teacher had a history of
working as a district comman-
der of the now-defunct terror-
ist outfit, Allah Tigers. He
managed his employment
without any selection process.
Banned Jamaat-e-Islami (JeI)
cadre had played a key role in
inducting him in the govern-
ment services. As per police
records Wani was among the
key speakers and organisers
during the 2016 agitations fol-
lowing the death of Burhan
Wani, the poster boy of banned
terror group Hizbul
Mujahideen.
According to official
sources, Junior assistant Mohd
Rafi Butt, also a resident of
Kishtwar and posted in the
Road and Building
Department, was sacked for
providing logistical support to
Hizbul Mujahideen terrorists in
Kishtwar and for providing
them a safe environment to
execute terror plans.
His name also figures in an
FIR registered by the NIA. He
was arrested and is at present
on bail.
Liyaqat Ali Kakroo, a res-
ident of Baramulla in North
Kashmir and a teacher by pro-
fession since 1983, was arrest-
ed in 2001 which “revealed that
he was a locally trained terror-
ist”. An explosive substance
was recovered from his pos-
session and he was booked
under the Public Safety Act
(PSA) for two years in 2002. He
was subsequently acquitted by
the court in both cases.
Tariq Mehmood Kohli, a
resident of Poonch and posted
as a range officer in the Forest
Department, was also sacked
for allegedly being involved in
smuggling of illegal arms,
ammunition, explosives,
including hard drugs and Fake
Indian Currency Notes (FICN)
from Pakistan, the officials
said. He is alleged to have
remained in touch with active
militants and is recorded as an
OGW in police records.
%9:6^ecT_[^hTTbbPRZTSU^acTaa^a[X]Zb
Tca^f^aZTabRT[TQaPcTPUcTaCd]]T[1^aX]VPRWX]T³DA90´Qa^ZTcWa^dVWPccWTBWXePYX]PVPaBcPcX^]Ua^1P]VP[^aT2P]c^]T]cBcPcX^]X]1T]VP[dad^]FTS]TbSPh
?C8
TQTab^UcWTCaPSTab´5TSTaPcX^]bcPVTP_a^cTbcSdaX]VcWT9Pd1P]SWbcXaPVPX]bccWT^_T]X]V^U]TfbW^fa^^bP]S
aTcPX[TabW^_b^UAT[XP]RTPacX]9Pd^]FTS]TbSPh ?C8
?C8Q :I78:34:4A
Various Muslim organisations on
Wednesday urged Catholic Bishop
Joseph Kallarangatt to withdraw his con-
troversial love and narcotic jehad state-
ment, saying no religious leaders should
make such immature remarks.
Their meeting held here to discuss the
issue also said that the Bishop of Pala,
through the statement, was aiming at the
Muslim community.
Addressing the media after the meet-
ing, Indian Union Muslim League leader
Panakkad Sadiq Ali Shihab Thangal,
who chaired the session, said no religious
leader should make such immature state-
ments or comments.
Such remarks would not help main-
tain communal harmony and strengthen
the secular credentials of the state,
Thangal said and urged the Government
to strongly and effectively intervene in the
issue.
He said the leaders of Muslim com-
munity did not make any immature
response to the Bishop's statement.
Thirteen Muslim religious organisa-
tions attended the meeting.
Veteran IUML leader and Lok Sabha
MP E T Muhammed Basheer said he sup-
ports the demand of various political par-
ties to convene an all-party meeting to dis-
cuss the issue.
In the wake of the Bishop's contro-
versial love and narcotic jihad remarks
a few days ago, leaders of various religions
met at Thiruvananthapuram on Monday
last and called for steps to strengthen the
secular fabric of Kerala society.
Thrissur: India's first-ever
mosque and the oldest in the
sub-continent is all set to wel-
come back devotees and gen-
eral public after regaining its
past glory and grandeur.
The classic beauty and
humble style of the Cheraman
Juma Masjid, dating back to
629 AD, was restored after a
painstaking renovation and
conservation process spread
over nearly 30 months under
the state-run Muziris Heritage
Project (MHP). Located at
Kodungallur taluk in this cen-
tral Kerala district, the heritage
structure was recreated in tune
with its original character and
aesthetics, at a cost of C1.14
crore, P M Noushad, Managing
Director of MHP, said.
Besides the renovation
and conservation initiative,
which started in May 2019, a
two-storey Islamic Heritage
Museum was also constructed
in the mosque campus spend-
ing nearly Rs one crore and its
internal refurbishment is going
on now, he noted. After sub-
mitting the letter of completion
to the government, the MHP
authorities are now awaiting
Chief Minister Pinarayi
Vijayan's date to reopen the
oldest mosque for visitors. It is
expected to happen any day..
We are waiting for a convenient
day of the Chief Minister for
the inaugural function. If the
Covid-19 situation is com-
pletely under control, it may
happen within the next two
week, Noushad said. PTI
8]SXPb^[STbc
^b`dTbTcc^
aT^_T]PUcTa
aT]^ePcX^]
db[X^aVP]XbPcX^]bPbZ
2PcW^[XR1XbW^_c^fXcWSaPf
WXb²]PaR^cXRYTWPS³aTPaZ
?C8Q ?0C=0
Rashtriya Janata Dal presi-
dent Lalu Prasad on
Wednesday reiterated the
demand for a caste census and
favoured “breaking” the 50 per
cent ceiling on reservations if
the population of SCs, STs and
OBCs was found to be more
than half of the total.
Prasad, who has been con-
valescing in Delhi after his
release from jail earlier this
year, made the remarks while
addressing a training camp of
his party workers organised
here to which he got connect-
ed online.
“I was the first one to raise
the demand for caste census. I
had made the demand on the
floor of the Parliament,” said
the multiple-term former MP
and the railway minister in the
UPA-1 Government.
The former Bihar Chief
Minister, who has ended up
spending a long time behind
bars following his conviction in
fodder scam cases, said “my
demand is for the welfare of all,
SCs and STs included. Quotas
have been decided taking into
account a census conducted
before Independence. We must
have a fresh estimate of the
population of different social
segments”.
“The existing quotas have
been insufficient. And even
these are rarely filled, resulting
in huge backlogs. Let there be
a fresh caste census and all get
quotas in proportion to their
population. If it needs breaking
of the 50 per cent barrier, so be
it,” said Prasad, who owes his
rise in politics to the Mandal
churn of the 1990s.
Prasad's younger son and
heir apparent Tejashwi Yadav,
who is the leader of the oppo-
sition in state assembly, had
recently met Prime Minister
Narendra Modi to broach the
issue of caste census as part of
a delegation headed by Chief
Minister Nitish Kumar – an
arch rival of the RJD supremo.
The Centre's contention
that only enumeration of SCs
and STs was proposed has trig-
gered demands that the same
be done for OBCs as well. A
cap of 50 per cent on quotas has
been fixed by an order of the
Supreme Court.
Prasad, who is in his late
70s and suffers from multiple
ailments, spoke for less than 30
minutes and the audience were
left pining for his wit and
repartee that had made him a
legend in his heydays.
He, nonetheless, sought to
assure his foot soldiers that his
health was improving and he
will soon be in Bihar, touring
all districts to energise the
rank and file.
DVWHFHQVXVDPXVWOHW
FDSEHEURNHQLIUHTXLUHG/DOX
Lucknow: Samajwadi Party chief
Akhilesh Yadav on Wednesday
accused the Yogi Adityanath
Government of usurping the credit of
his developmental work in Uttar
Pradesh and failing to even read the
BJP manifesto, forget about keeping its
poll promises.
In a statement, he also charged the
saffron party Government with weak-
ening the democracy of the country by
“sustained attack on various institu-
tions”.
“The BJP has no shame (laaz) that
it did not read even a single page of its
'sankalp patra' of 2017 Assembly elec-
tions and failed to implement any of
the promises,” Yadav said, adding
ahead of the assembly polls, they have
now begun beating their own trum-
pet through advertisements.
This attitude of breaking promis-
es (wadakhilaphi) is a form of cor-
ruption. Spending State resources
without doing any work of public
interest is betrayal with the people, he
said. The SP president alleged that the
saffron party would try to “manipu-
late” voting at the booth level during
the elections early next year and
asked party workers to be cautious of
it.
Arrears of sugarcane growers ride
in electricity rates, problems of weavers
and unemployed youths, atrocity
against women and rising crime graph
are the hallmarks of the BJP rule in UP,
he said.
Yadav also attacked the Union
Government accusing it of weakening
the country's economy by demoneti-
sation and enforcing GST.
The Government which weaved
a dream of five trillion economy is con-
spiring to confuse people with the help
of advertisements, he said.
2:@XQcdQ[U^SbUTYd
V_b_ebg_b[Y^E@*
1[XYUcXIQTQf
Jaipur: In his first Cabinet meeting after undergoing
angioplasty last month, Rajasthan Chief Minister
Ashok Gehlot Wednesday reviewed his administra-
tion's public outreach programme which is slated to
be launched on October 2.
The Prashashan Sharon ke Sang and Prashasan
Gaon ke Sang (the administration with cities and vil-
lages) focuses on works like lease allotment and a min-
ister Wednesday said various relaxations will be given
to people during the campaign. It was Gehlot's first
Cabinet meeting after he recovered to good health fol-
lowing his angioplasty at the SMS Government hos-
pital here last month. After the Cabinet meeting,
Transport Minister Pratap Singh Khachariyawas told
reporters that the preparations for the scheme were
reviewed and the Chief Minister instructed the min-
isters to visit districts during the campaign.
The Rajasthan Government is focusing on the
development of the State and welfare of people. For
this, Prashasan Sharon ke Sang and Prashasan Gaon
ke Sang campaign will be launched from October 2
across the State for works like lease allotment etc, he
said. PTI
*HKORWFKDLUVILUVW
DELQHWPHHW
DIWHUDQJLRSODVW
ATeXTfbb^^]c^QT[Pd]RWTSfT[UPaTbRWTT
Bengaluru: Karnataka logged 847 new
Covid-19 cases and 20 deaths on
Wednesday, taking the total number of
infections to 29,70,208 and the toll to
37,668.
The day also saw 946 discharges, tak-
ing the total number of recoveries in the
State so far to 29,18,890.
Out of 847 new cases reported on
Wednesday, 312 were from Bengaluru
Urban, as the city saw 219 discharges and
six deaths.
The total number of active cases in the
state is at 13,621 While the positivity
rate for the day stood at 0.57 per cent, the
Case Fatality Rate (CFR) was 2.36 per cent,
a health department bulletin said.
Coming behind Bengaluru Urban in
number of deaths was Dakshina Kannada
(5) and Udupi (2), followed by others.
Among new cases, Dakshina Kannada
accounted for 108, Mysuru 74, Shivamogga
52, Udupi 48, Hassan 46, followed by oth-
ers. PTI
'#]Tf2^eXS
RPbTb!STPcWb
X]:Pa]PcPZP
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23
Pioneer dehradun-english-edition-2021-09-23

More Related Content

What's hot

Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28
DunEditorial
 
11122021 first india new delhi
11122021  first india new delhi11122021  first india new delhi
11122021 first india new delhi
FIRST INDIA
 
Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11
DunEditorial
 
Pioneer dehradun-english-edition-2021-04-11
Pioneer dehradun-english-edition-2021-04-11Pioneer dehradun-english-edition-2021-04-11
Pioneer dehradun-english-edition-2021-04-11
DunEditorial
 
Pioneer dehradun-english-edition-2021-05-20
Pioneer dehradun-english-edition-2021-05-20Pioneer dehradun-english-edition-2021-05-20
Pioneer dehradun-english-edition-2021-05-20
DunEditorial
 
16062021 first india ahmedabad
16062021 first india ahmedabad16062021 first india ahmedabad
16062021 first india ahmedabad
FIRST INDIA
 
Pioneer dehradun-e-paper-06-06-2020
Pioneer dehradun-e-paper-06-06-2020Pioneer dehradun-e-paper-06-06-2020
Pioneer dehradun-e-paper-06-06-2020
DunEditorial
 
Pioneer dehradun-english-edition-2020-12-08
Pioneer dehradun-english-edition-2020-12-08Pioneer dehradun-english-edition-2020-12-08
Pioneer dehradun-english-edition-2020-12-08
DunEditorial
 
Pioneer dehradun-e-paper-23-05-2020
Pioneer dehradun-e-paper-23-05-2020Pioneer dehradun-e-paper-23-05-2020
Pioneer dehradun-e-paper-23-05-2020
DunEditorial
 
28102021 first india ahmedabad (2)
28102021 first india ahmedabad (2)28102021 first india ahmedabad (2)
28102021 first india ahmedabad (2)
FIRST INDIA
 
28102021 first india lucknow
28102021 first india lucknow28102021 first india lucknow
28102021 first india lucknow
FIRST INDIA
 
Pioneer Dehradun-english-edition-2020-12-02
Pioneer Dehradun-english-edition-2020-12-02Pioneer Dehradun-english-edition-2020-12-02
Pioneer Dehradun-english-edition-2020-12-02
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24
DunEditorial
 
Pioneer dehradun-english-edition-2021-05-30
Pioneer dehradun-english-edition-2021-05-30Pioneer dehradun-english-edition-2021-05-30
Pioneer dehradun-english-edition-2021-05-30
DunEditorial
 
28102021 first india jaipur
28102021 first india jaipur28102021 first india jaipur
28102021 first india jaipur
FIRST INDIA
 
Pioneer dehradun-english-edition-2021-06-12
Pioneer dehradun-english-edition-2021-06-12Pioneer dehradun-english-edition-2021-06-12
Pioneer dehradun-english-edition-2021-06-12
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18
DunEditorial
 

What's hot (20)

Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28Pioneer dehradun-english-edition-2021-09-28
Pioneer dehradun-english-edition-2021-09-28
 
11122021 first india new delhi
11122021  first india new delhi11122021  first india new delhi
11122021 first india new delhi
 
Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19Pioneer dehradun-english-edition-2021-09-19
Pioneer dehradun-english-edition-2021-09-19
 
Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20Pioneer dehradun-english-edition-2021-09-20
Pioneer dehradun-english-edition-2021-09-20
 
Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11Pioneer dehradun-english-edition-2021-09-11
Pioneer dehradun-english-edition-2021-09-11
 
Pioneer dehradun-english-edition-2021-04-11
Pioneer dehradun-english-edition-2021-04-11Pioneer dehradun-english-edition-2021-04-11
Pioneer dehradun-english-edition-2021-04-11
 
Pioneer dehradun-english-edition-2021-05-20
Pioneer dehradun-english-edition-2021-05-20Pioneer dehradun-english-edition-2021-05-20
Pioneer dehradun-english-edition-2021-05-20
 
16062021 first india ahmedabad
16062021 first india ahmedabad16062021 first india ahmedabad
16062021 first india ahmedabad
 
Pioneer dehradun-e-paper-06-06-2020
Pioneer dehradun-e-paper-06-06-2020Pioneer dehradun-e-paper-06-06-2020
Pioneer dehradun-e-paper-06-06-2020
 
Pioneer dehradun-english-edition-2020-12-08
Pioneer dehradun-english-edition-2020-12-08Pioneer dehradun-english-edition-2020-12-08
Pioneer dehradun-english-edition-2020-12-08
 
Pioneer dehradun-e-paper-23-05-2020
Pioneer dehradun-e-paper-23-05-2020Pioneer dehradun-e-paper-23-05-2020
Pioneer dehradun-e-paper-23-05-2020
 
28102021 first india ahmedabad (2)
28102021 first india ahmedabad (2)28102021 first india ahmedabad (2)
28102021 first india ahmedabad (2)
 
28102021 first india lucknow
28102021 first india lucknow28102021 first india lucknow
28102021 first india lucknow
 
Pioneer Dehradun-english-edition-2020-12-02
Pioneer Dehradun-english-edition-2020-12-02Pioneer Dehradun-english-edition-2020-12-02
Pioneer Dehradun-english-edition-2020-12-02
 
Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24Pioneer dehradun-english-edition-2021-09-24
Pioneer dehradun-english-edition-2021-09-24
 
Pioneer dehradun-english-edition-2021-05-30
Pioneer dehradun-english-edition-2021-05-30Pioneer dehradun-english-edition-2021-05-30
Pioneer dehradun-english-edition-2021-05-30
 
28102021 first india jaipur
28102021 first india jaipur28102021 first india jaipur
28102021 first india jaipur
 
Pioneer dehradun-english-edition-2021-06-12
Pioneer dehradun-english-edition-2021-06-12Pioneer dehradun-english-edition-2021-06-12
Pioneer dehradun-english-edition-2021-06-12
 
Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22Pioneer dehradun-english-edition-2021-09-22
Pioneer dehradun-english-edition-2021-09-22
 
Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18Pioneer dehradun-english-edition-2021-09-18
Pioneer dehradun-english-edition-2021-09-18
 

Similar to Pioneer dehradun-english-edition-2021-09-23

23092021 first india jaipur
23092021 first india jaipur23092021 first india jaipur
23092021 first india jaipur
FIRST INDIA
 
Pioneer dehradun-e-paper-05-06-2020
Pioneer dehradun-e-paper-05-06-2020Pioneer dehradun-e-paper-05-06-2020
Pioneer dehradun-e-paper-05-06-2020
DunEditorial
 
10012022 first india jaipur
10012022 first india jaipur10012022 first india jaipur
10012022 first india jaipur
FIRST INDIA
 
Pioneer Dehradun-english-edition-2021-01-06
Pioneer Dehradun-english-edition-2021-01-06Pioneer Dehradun-english-edition-2021-01-06
Pioneer Dehradun-english-edition-2021-01-06
DunEditorial
 
Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12
DunEditorial
 
23122022_First India Jaipur (1).pdf
23122022_First India Jaipur (1).pdf23122022_First India Jaipur (1).pdf
23122022_First India Jaipur (1).pdf
FIRST INDIA
 
17032022 first india ahmedabad-min
17032022 first india ahmedabad-min17032022 first india ahmedabad-min
17032022 first india ahmedabad-min
FIRST INDIA
 
Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10
DunEditorial
 
First india jaipur edition-06 may 2020
First india jaipur edition-06 may 2020First india jaipur edition-06 may 2020
First india jaipur edition-06 may 2020
FIRST INDIA
 
First india jaipur edition-28 august 2020
First india jaipur edition-28 august 2020First india jaipur edition-28 august 2020
First india jaipur edition-28 august 2020
FIRST INDIA
 
Pioneer Dehradun-english-edition-2020-11-20
Pioneer Dehradun-english-edition-2020-11-20Pioneer Dehradun-english-edition-2020-11-20
Pioneer Dehradun-english-edition-2020-11-20
DunEditorial
 
22 February 2023 CURRENT AFFAIRS.pptx
22  February 2023 CURRENT AFFAIRS.pptx22  February 2023 CURRENT AFFAIRS.pptx
Pioneer dehradun-english-edition-2021-03-27
Pioneer dehradun-english-edition-2021-03-27Pioneer dehradun-english-edition-2021-03-27
Pioneer dehradun-english-edition-2021-03-27
DunEditorial
 
15 september 2021 current affairs
15 september 2021 current affairs15 september 2021 current affairs
Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21
DunEditorial
 
First india jaipur edition-02 may 2020
First india jaipur edition-02 may 2020First india jaipur edition-02 may 2020
First india jaipur edition-02 may 2020
FIRST INDIA
 
Pioneer dehradun-english-edition-2021-06-11
Pioneer dehradun-english-edition-2021-06-11Pioneer dehradun-english-edition-2021-06-11
Pioneer dehradun-english-edition-2021-06-11
DunEditorial
 
05012023_First India Jaipur.pdf
05012023_First India Jaipur.pdf05012023_First India Jaipur.pdf
05012023_First India Jaipur.pdf
FIRST INDIA
 
First india jaipur edition-14 september 2020
First india jaipur edition-14 september 2020First india jaipur edition-14 september 2020
First india jaipur edition-14 september 2020
FIRST INDIA
 
Pioneer dehradun-e-paper-19-05-2020
Pioneer dehradun-e-paper-19-05-2020Pioneer dehradun-e-paper-19-05-2020
Pioneer dehradun-e-paper-19-05-2020
DunEditorial
 

Similar to Pioneer dehradun-english-edition-2021-09-23 (20)

23092021 first india jaipur
23092021 first india jaipur23092021 first india jaipur
23092021 first india jaipur
 
Pioneer dehradun-e-paper-05-06-2020
Pioneer dehradun-e-paper-05-06-2020Pioneer dehradun-e-paper-05-06-2020
Pioneer dehradun-e-paper-05-06-2020
 
10012022 first india jaipur
10012022 first india jaipur10012022 first india jaipur
10012022 first india jaipur
 
Pioneer Dehradun-english-edition-2021-01-06
Pioneer Dehradun-english-edition-2021-01-06Pioneer Dehradun-english-edition-2021-01-06
Pioneer Dehradun-english-edition-2021-01-06
 
Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12Pioneer Dehradun english-edition-2020-12-12
Pioneer Dehradun english-edition-2020-12-12
 
23122022_First India Jaipur (1).pdf
23122022_First India Jaipur (1).pdf23122022_First India Jaipur (1).pdf
23122022_First India Jaipur (1).pdf
 
17032022 first india ahmedabad-min
17032022 first india ahmedabad-min17032022 first india ahmedabad-min
17032022 first india ahmedabad-min
 
Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10Pioneer Dehradun-english-edition-2020-12-10
Pioneer Dehradun-english-edition-2020-12-10
 
First india jaipur edition-06 may 2020
First india jaipur edition-06 may 2020First india jaipur edition-06 may 2020
First india jaipur edition-06 may 2020
 
First india jaipur edition-28 august 2020
First india jaipur edition-28 august 2020First india jaipur edition-28 august 2020
First india jaipur edition-28 august 2020
 
Pioneer Dehradun-english-edition-2020-11-20
Pioneer Dehradun-english-edition-2020-11-20Pioneer Dehradun-english-edition-2020-11-20
Pioneer Dehradun-english-edition-2020-11-20
 
22 February 2023 CURRENT AFFAIRS.pptx
22  February 2023 CURRENT AFFAIRS.pptx22  February 2023 CURRENT AFFAIRS.pptx
22 February 2023 CURRENT AFFAIRS.pptx
 
Pioneer dehradun-english-edition-2021-03-27
Pioneer dehradun-english-edition-2021-03-27Pioneer dehradun-english-edition-2021-03-27
Pioneer dehradun-english-edition-2021-03-27
 
15 september 2021 current affairs
15 september 2021 current affairs15 september 2021 current affairs
15 september 2021 current affairs
 
Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21Pioneer Dehradun-english-edition-2021-01-21
Pioneer Dehradun-english-edition-2021-01-21
 
First india jaipur edition-02 may 2020
First india jaipur edition-02 may 2020First india jaipur edition-02 may 2020
First india jaipur edition-02 may 2020
 
Pioneer dehradun-english-edition-2021-06-11
Pioneer dehradun-english-edition-2021-06-11Pioneer dehradun-english-edition-2021-06-11
Pioneer dehradun-english-edition-2021-06-11
 
05012023_First India Jaipur.pdf
05012023_First India Jaipur.pdf05012023_First India Jaipur.pdf
05012023_First India Jaipur.pdf
 
First india jaipur edition-14 september 2020
First india jaipur edition-14 september 2020First india jaipur edition-14 september 2020
First india jaipur edition-14 september 2020
 
Pioneer dehradun-e-paper-19-05-2020
Pioneer dehradun-e-paper-19-05-2020Pioneer dehradun-e-paper-19-05-2020
Pioneer dehradun-e-paper-19-05-2020
 

More from DunEditorial

Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-08
Pioneer dehradun-english-edition-2021-09-08Pioneer dehradun-english-edition-2021-09-08
Pioneer dehradun-english-edition-2021-09-08
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-07
Pioneer dehradun-english-edition-2021-09-07Pioneer dehradun-english-edition-2021-09-07
Pioneer dehradun-english-edition-2021-09-07
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-06
Pioneer dehradun-english-edition-2021-09-06Pioneer dehradun-english-edition-2021-09-06
Pioneer dehradun-english-edition-2021-09-06
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-04
Pioneer dehradun-english-edition-2021-09-04Pioneer dehradun-english-edition-2021-09-04
Pioneer dehradun-english-edition-2021-09-04
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-03
Pioneer dehradun-english-edition-2021-09-03Pioneer dehradun-english-edition-2021-09-03
Pioneer dehradun-english-edition-2021-09-03
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-02
Pioneer dehradun-english-edition-2021-09-02Pioneer dehradun-english-edition-2021-09-02
Pioneer dehradun-english-edition-2021-09-02
DunEditorial
 
Pioneer dehradun-english-edition-2021-09-01
Pioneer dehradun-english-edition-2021-09-01Pioneer dehradun-english-edition-2021-09-01
Pioneer dehradun-english-edition-2021-09-01
DunEditorial
 
Pioneer dehradun-english-edition-2021-08-31
Pioneer dehradun-english-edition-2021-08-31Pioneer dehradun-english-edition-2021-08-31
Pioneer dehradun-english-edition-2021-08-31
DunEditorial
 

More from DunEditorial (20)

Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29Pioneer dehradun-english-edition-2021-09-29
Pioneer dehradun-english-edition-2021-09-29
 
Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27Pioneer dehradun-english-edition-2021-09-27
Pioneer dehradun-english-edition-2021-09-27
 
Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26Pioneer dehradun-english-edition-2021-09-26
Pioneer dehradun-english-edition-2021-09-26
 
Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25Pioneer dehradun-english-edition-2021-09-25
Pioneer dehradun-english-edition-2021-09-25
 
Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17Pioneer dehradun-english-edition-2021-09-17
Pioneer dehradun-english-edition-2021-09-17
 
Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16Pioneer dehradun-english-edition-2021-09-16
Pioneer dehradun-english-edition-2021-09-16
 
Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15Pioneer dehradun-english-edition-2021-09-15
Pioneer dehradun-english-edition-2021-09-15
 
Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14Pioneer dehradun-english-edition-2021-09-14
Pioneer dehradun-english-edition-2021-09-14
 
Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13Pioneer dehradun-english-edition-2021-09-13
Pioneer dehradun-english-edition-2021-09-13
 
Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12Pioneer dehradun-english-edition-2021-09-12
Pioneer dehradun-english-edition-2021-09-12
 
Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10Pioneer dehradun-english-edition-2021-09-10
Pioneer dehradun-english-edition-2021-09-10
 
Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09Pioneer dehradun-english-edition-2021-09-09
Pioneer dehradun-english-edition-2021-09-09
 
Pioneer dehradun-english-edition-2021-09-08
Pioneer dehradun-english-edition-2021-09-08Pioneer dehradun-english-edition-2021-09-08
Pioneer dehradun-english-edition-2021-09-08
 
Pioneer dehradun-english-edition-2021-09-07
Pioneer dehradun-english-edition-2021-09-07Pioneer dehradun-english-edition-2021-09-07
Pioneer dehradun-english-edition-2021-09-07
 
Pioneer dehradun-english-edition-2021-09-06
Pioneer dehradun-english-edition-2021-09-06Pioneer dehradun-english-edition-2021-09-06
Pioneer dehradun-english-edition-2021-09-06
 
Pioneer dehradun-english-edition-2021-09-04
Pioneer dehradun-english-edition-2021-09-04Pioneer dehradun-english-edition-2021-09-04
Pioneer dehradun-english-edition-2021-09-04
 
Pioneer dehradun-english-edition-2021-09-03
Pioneer dehradun-english-edition-2021-09-03Pioneer dehradun-english-edition-2021-09-03
Pioneer dehradun-english-edition-2021-09-03
 
Pioneer dehradun-english-edition-2021-09-02
Pioneer dehradun-english-edition-2021-09-02Pioneer dehradun-english-edition-2021-09-02
Pioneer dehradun-english-edition-2021-09-02
 
Pioneer dehradun-english-edition-2021-09-01
Pioneer dehradun-english-edition-2021-09-01Pioneer dehradun-english-edition-2021-09-01
Pioneer dehradun-english-edition-2021-09-01
 
Pioneer dehradun-english-edition-2021-08-31
Pioneer dehradun-english-edition-2021-08-31Pioneer dehradun-english-edition-2021-08-31
Pioneer dehradun-english-edition-2021-08-31
 

Recently uploaded

03062024_First India Newspaper Jaipur.pdf
03062024_First India Newspaper Jaipur.pdf03062024_First India Newspaper Jaipur.pdf
03062024_First India Newspaper Jaipur.pdf
FIRST INDIA
 
27052024_First India Newspaper Jaipur.pdf
27052024_First India Newspaper Jaipur.pdf27052024_First India Newspaper Jaipur.pdf
27052024_First India Newspaper Jaipur.pdf
FIRST INDIA
 
role of women and girls in various terror groups
role of women and girls in various terror groupsrole of women and girls in various terror groups
role of women and girls in various terror groups
sadiakorobi2
 
Do Linguistics Still Matter in the Age of Large Language Models.pptx
Do Linguistics Still Matter in the Age of Large Language Models.pptxDo Linguistics Still Matter in the Age of Large Language Models.pptx
Do Linguistics Still Matter in the Age of Large Language Models.pptx
Slator- Language Industry Intelligence
 
ys jagan mohan reddy political career, Biography.pdf
ys jagan mohan reddy political career, Biography.pdfys jagan mohan reddy political career, Biography.pdf
ys jagan mohan reddy political career, Biography.pdf
VoterMood
 
01062024_First India Newspaper Jaipur.pdf
01062024_First India Newspaper Jaipur.pdf01062024_First India Newspaper Jaipur.pdf
01062024_First India Newspaper Jaipur.pdf
FIRST INDIA
 
31052024_First India Newspaper Jaipur.pdf
31052024_First India Newspaper Jaipur.pdf31052024_First India Newspaper Jaipur.pdf
31052024_First India Newspaper Jaipur.pdf
FIRST INDIA
 
2024 is the point of certainty. Forecast of UIF experts
2024 is the point of certainty. Forecast of UIF experts2024 is the point of certainty. Forecast of UIF experts
2024 is the point of certainty. Forecast of UIF experts
olaola5673
 
AI and Covert Influence Operations: Latest Trends
AI and Covert Influence Operations: Latest TrendsAI and Covert Influence Operations: Latest Trends
AI and Covert Influence Operations: Latest Trends
CI kumparan
 
Draft-1-Resolutions-Key-Interventions-.pdf
Draft-1-Resolutions-Key-Interventions-.pdfDraft-1-Resolutions-Key-Interventions-.pdf
Draft-1-Resolutions-Key-Interventions-.pdf
bhavenpr
 
Resolutions-Key-Interventions-28-May-2024.pdf
Resolutions-Key-Interventions-28-May-2024.pdfResolutions-Key-Interventions-28-May-2024.pdf
Resolutions-Key-Interventions-28-May-2024.pdf
bhavenpr
 
Preview of Court Document for Iseyin community
Preview of Court Document for Iseyin communityPreview of Court Document for Iseyin community
Preview of Court Document for Iseyin community
contact193699
 
Future Of Fintech In India | Evolution Of Fintech In India
Future Of Fintech In India | Evolution Of Fintech In IndiaFuture Of Fintech In India | Evolution Of Fintech In India
Future Of Fintech In India | Evolution Of Fintech In India
TheUnitedIndian
 
Chapter-8th-Recent Developments in Indian Politics-PPT.pptx
Chapter-8th-Recent Developments in Indian Politics-PPT.pptxChapter-8th-Recent Developments in Indian Politics-PPT.pptx
Chapter-8th-Recent Developments in Indian Politics-PPT.pptx
ssuserec98a3
 
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdfSharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
bhavenpr
 
Mizzima Weekly Analysis & Insight Issue 1
Mizzima Weekly Analysis & Insight Issue 1Mizzima Weekly Analysis & Insight Issue 1
Mizzima Weekly Analysis & Insight Issue 1
Mizzima Media
 
Hogan Comes Home: an MIA WWII crewman is returned
Hogan Comes Home: an MIA WWII crewman is returnedHogan Comes Home: an MIA WWII crewman is returned
Hogan Comes Home: an MIA WWII crewman is returned
rbakerj2
 
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptxHISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
aditiyad2020
 
Short history indo pak 1965 war 1st pd.ppt
Short history indo pak 1965 war 1st pd.pptShort history indo pak 1965 war 1st pd.ppt
Short history indo pak 1965 war 1st pd.ppt
pawan543822
 
Codes n Conventionss copy (1).paaaaaaptx
Codes n Conventionss copy (1).paaaaaaptxCodes n Conventionss copy (1).paaaaaaptx
Codes n Conventionss copy (1).paaaaaaptx
ZackSpencer3
 

Recently uploaded (20)

03062024_First India Newspaper Jaipur.pdf
03062024_First India Newspaper Jaipur.pdf03062024_First India Newspaper Jaipur.pdf
03062024_First India Newspaper Jaipur.pdf
 
27052024_First India Newspaper Jaipur.pdf
27052024_First India Newspaper Jaipur.pdf27052024_First India Newspaper Jaipur.pdf
27052024_First India Newspaper Jaipur.pdf
 
role of women and girls in various terror groups
role of women and girls in various terror groupsrole of women and girls in various terror groups
role of women and girls in various terror groups
 
Do Linguistics Still Matter in the Age of Large Language Models.pptx
Do Linguistics Still Matter in the Age of Large Language Models.pptxDo Linguistics Still Matter in the Age of Large Language Models.pptx
Do Linguistics Still Matter in the Age of Large Language Models.pptx
 
ys jagan mohan reddy political career, Biography.pdf
ys jagan mohan reddy political career, Biography.pdfys jagan mohan reddy political career, Biography.pdf
ys jagan mohan reddy political career, Biography.pdf
 
01062024_First India Newspaper Jaipur.pdf
01062024_First India Newspaper Jaipur.pdf01062024_First India Newspaper Jaipur.pdf
01062024_First India Newspaper Jaipur.pdf
 
31052024_First India Newspaper Jaipur.pdf
31052024_First India Newspaper Jaipur.pdf31052024_First India Newspaper Jaipur.pdf
31052024_First India Newspaper Jaipur.pdf
 
2024 is the point of certainty. Forecast of UIF experts
2024 is the point of certainty. Forecast of UIF experts2024 is the point of certainty. Forecast of UIF experts
2024 is the point of certainty. Forecast of UIF experts
 
AI and Covert Influence Operations: Latest Trends
AI and Covert Influence Operations: Latest TrendsAI and Covert Influence Operations: Latest Trends
AI and Covert Influence Operations: Latest Trends
 
Draft-1-Resolutions-Key-Interventions-.pdf
Draft-1-Resolutions-Key-Interventions-.pdfDraft-1-Resolutions-Key-Interventions-.pdf
Draft-1-Resolutions-Key-Interventions-.pdf
 
Resolutions-Key-Interventions-28-May-2024.pdf
Resolutions-Key-Interventions-28-May-2024.pdfResolutions-Key-Interventions-28-May-2024.pdf
Resolutions-Key-Interventions-28-May-2024.pdf
 
Preview of Court Document for Iseyin community
Preview of Court Document for Iseyin communityPreview of Court Document for Iseyin community
Preview of Court Document for Iseyin community
 
Future Of Fintech In India | Evolution Of Fintech In India
Future Of Fintech In India | Evolution Of Fintech In IndiaFuture Of Fintech In India | Evolution Of Fintech In India
Future Of Fintech In India | Evolution Of Fintech In India
 
Chapter-8th-Recent Developments in Indian Politics-PPT.pptx
Chapter-8th-Recent Developments in Indian Politics-PPT.pptxChapter-8th-Recent Developments in Indian Politics-PPT.pptx
Chapter-8th-Recent Developments in Indian Politics-PPT.pptx
 
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdfSharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
Sharjeel-Imam-Judgement-CRLA-215-2024_29-05-2024.pdf
 
Mizzima Weekly Analysis & Insight Issue 1
Mizzima Weekly Analysis & Insight Issue 1Mizzima Weekly Analysis & Insight Issue 1
Mizzima Weekly Analysis & Insight Issue 1
 
Hogan Comes Home: an MIA WWII crewman is returned
Hogan Comes Home: an MIA WWII crewman is returnedHogan Comes Home: an MIA WWII crewman is returned
Hogan Comes Home: an MIA WWII crewman is returned
 
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptxHISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
HISTORY- XII-Theme 3 - Kinship, Caste and Class.pptx
 
Short history indo pak 1965 war 1st pd.ppt
Short history indo pak 1965 war 1st pd.pptShort history indo pak 1965 war 1st pd.ppt
Short history indo pak 1965 war 1st pd.ppt
 
Codes n Conventionss copy (1).paaaaaaptx
Codes n Conventionss copy (1).paaaaaaptxCodes n Conventionss copy (1).paaaaaaptx
Codes n Conventionss copy (1).paaaaaaptx
 

Pioneer dehradun-english-edition-2021-09-23

  • 1. H>64B7B8=670??8=C43 3DE824270=24;;A =Tf3T[WX)3T[WXCTRW]^[^VXRP[ D]XeTabXchEXRT2WP]RT[[^a H^VTbWBX]VWWPbQTT] P__^X]cTSPbcWTEXRT 2WP]RT[[^a^U3T[WXD]XeTabXch X]Xbcah^U4SdRPcX^]^UUXRXP[b bPXS^]FTS]TbSPhBX]VWfW^ fX[[QTcWT!aSEXRT2WP]RT[[^a ^U3DfX[[bdRRTTSH^VTbW ChPVXfW^fPbbdb_T]STS[Pbc Rc^QTa 19? 14=60;20=3830C4 140C4=1HC24=384B :^[ZPcP)019?[TPSTa^UFTbc 1T]VP[fW^[^bc0bbTQ[h T[TRcX^]Ua^PbTPcX]B^dcW!# ?PaVP]PbP]SfPbP[[TVTS[h PbbPd[cTSQhC2f^aZTabX] PhSXTSPcPW^b_XcP[WXb UPX[hTQTabbPXS 20?BD;4 0?Q :01D; Attackers struck Taliban vehicles in an eastern Afghanistan on Wednesday, witnesses said, killing at least two fighters and three civilians in the latest violence since the group’s takeover of the country in mid-August. In one attack, gunmen opened fire on a Taliban vehi- cle at a local gas station in the provincial capital of Jalalabad, killing two fighters and a gas station attendant, witnesses said. A child was also killed, they added. Another child was killed and two Taliban were wound- ed in a separate attack — a bombing of another vehicle. Another bombing of a Taliban vehicle in Jalalabad also wounded a person nearby, although it was unclear if that person was a Taliban official or not. The witnesses spoke on condition of anonymity for fear of retribution. No one claimed immediate responsibility for Wednesday’s attacks, although the Islamic State group, which is head- quartered in eastern Afghanistan, took responsibil- ity for similar attacks in Jalalabad last week that killed eight. ?C8Q =4F34;78 Shares of Zee Entertainment Enterprises Limited on Wednesday zoomed nearly 32 per cent after announcement of a merger with Sony Pictures. Leading media firms Zee Entertainment and Sony Pictures on Wednesday said they have received in-principle approval for a merger that will combine both companies’ lin- ear networks, digital assets, production operations and pro- gramme libraries. The stock jumped 31.86 per cent to close at C337.10 on the BSE. During the day, it ral- lied 39 per cent to its 52-week high of C355.40. On the NSE, it zoomed 30.50 per cent to close at C333.70. The company’s mar- ket valuation also jumped C7,823.98 crore to C32,378.98 crore on the BSE. Buying was also there in other group stocks, with Zee Learn zooming 14.30 per cent and Zee Media Corporation gaining 4.92 per cent on the BSE. Detailed report on P9 Brasilia: Brazil’s Health Minister Marcelo Queiroga tested positive for Covid-19 hours after accompanying President Jair Bolsonaro to the United Nations General Assembly (UNGA) in New York on Tuesday, the Government said. Queiroga will remain in New York in quarantine, the Government’s communications office said. “The Minister is doing well,” the statement said. It added that the rest of the del- egation tested negative for the virus. Bolsonaro, a vaccine skep- tic, defied UN rules that asked all those attending the Assembly to be vaccinated. He has bragged about not getting vaccinated. Agencies 0178;0B7=0A08=Q 0;;070103 Amidst chanting of mantras and following all the ritu- als Akhara Parishad chief Mahant Narendra Giri was given Bhoo Samadhi on Baghambari Gaddi Ashram premises under a lemon tree as per his wish, on Wednesday afternoon. Office-bearers of all 13 Akharas were present there at the time of the Bhoo Samadhi. Prior to the Samadhi, his body was taken to the mortu- ary of SRN Hospital for post- mortem examination, and then was taken to the Sangam for bathing it with the sacred waters of the Ganga, the Yamuna and the Saraswati. The mortal remains, placed in a flower bedecked lorry, were moved around the city to let people pay their homage to the Brahmaleen seer before the Samadhi. Thousands of sants, disci- ples and devotees marched through the route raising slo- gans for the Mahant. The van was stationed at Bare Hanuman Mandir near the Sangam for Darshan. Narendra Giri was the Mahant of this temple. Though the detailed post- mortem report is awaited, what had been briefed suggested that the the cause of death was suffocation. A ‘V’ mark was seen on the neck of the Mahant. Under video camera watch, a panel of five doctors performed autopsy. ?=BQ =4F34;78 The Supreme Court on Wednesday put the Government on notice in two separate matters related to girls. Maintaining that induc- tion of women to the NDA cannot be postponed by one year, the Supreme Court allowed female candidates to take the exam in November this year and not wait till May 2022 as requested by the Government. Hearing a separate matter, the apex court directed the Centre to file an affidavit with- in two weeks on the issue of induction of girls in the Rashtriya Indian Military College (RIMC) in Dehradun saying the issue cannot be delayed further. Refusing to accept the Centre’s request to allow women candidates to appear for the National Defence Academy (NDA) entrance from next year, the apex court said it doesn’t want women to be denied their right. The Centre had told the top court that a notification allowing women candidates to appear for the NDA exam will be out by May next year. A Study Group has been con- stituted by the Defence ser- vices, comprising experts to expeditiously formulate a com- prehensive curriculum for women cadets at NDA, it had said, adding that a Board of Officers has been convened to give a holistic and futuristic proposal for training of women Cadets at NDA incorporating all relevant aspects. A Bench headed by Justice SK Kaul said the armed forces are the best response team to deal with emergency situa- tions and it is hopeful that nec- essary arrangements will be put in place to pave the way for the induction of women in NDA without delay. Additional Solicitor General Aishwarya Bhati, appearing for the Centre, stat- ed that the Study Group has been constituted by the Defence services to examine the changes in curriculum, infrastructure, fitness training, accommodation facilities, etc, and sought for skipping the upcoming NDA entrance examination, scheduled to be held on November 14. ?=BQ =4F34;78 As he left for his three-day US tour, Prime Minister Narendra Modi on Wednesday said his interaction with world leaders, including President Joe Biden, will strengthen the Indo-US Comprehensive Global Strategic Partnership and consolidate ties with Japan and Australia. Issuing a statement before leaving for the US, Modi said he will conclude his visit with an address at the United Nations General Assembly (UNGA) focusing on the press- ing global challenges, including the Covid-19 pandemic, the need to combat terrorism, cli- mate change and other impor- tant issues. The PMO tweeted his pic- ture just before Modi boarded the plane for the US where he will take part in a wide range of programmes. He will be accompanied by National Security Adviser (NSA) Ajit Doval and External Affairs Minister S Jaishankar besides Foreign Secretary Harsh Shringla and some other top officials there. “I will be visiting the USA from 22-25 September, 2021, at the invitation of His Excellency President Joe Biden of the United States of America. During my visit, I will review the India-US Comprehensive Global Strategic Partnership with President Biden and exchange views on regional and global issues of mutual interest,” said the PM. “I am also looking forward to meeting Vice-President Kamala Harris to explore opportunities for cooperation between our two nations par- ticularly in the area of science and technology,” he said. ?=BQ =4F34;78 The Centre on Wednesday informed the Supreme Court that an amount of C50,000 will be given by the States as ex-gratia to the kin of all those who died of Covid-19 and also to those who die of the disease in future. The ex-gra- tia assistance will also be given to the kin of those who died of the virus due to involvement in Covid-19 relief operations or activities associated with the preparedness for dealing with the pandemic, the Centre said. In an affidavit, the Centre said the National Disaster Management Authority (NDMA) has made these rec- ommendations. The ex-gratia assistance will be subject to the cause of death being certified as Covid- 19 as per the guidelines issued by the Ministry of Health and Family Welfare and the ICMR, the Government said. It added that the ex-gratia assistance will be provided by States from the State Disaster Response Fund. On September 3, the top court had expressed displeasure over delay in framing of guide- lines for issuance of death cer- tificates to the families of those who died of Covid-19. The SC had in its June 30 verdict directed the NDMA to recom- mend within six weeks the guidelines for ex-gratia to the family of the Covid victims. On June 30, Justice Ashok Bhushan-headed bench ordered the Centre to imple- ment the mandated ex-gratia to Covid victims, which was can- celled by the Government, when Covid started spreading. Before the first lockdown, as per NDMA guidelines, C4 lakh was granted as ex-gratia when a calamity is declared as a national disaster. But after declaring the lockdown, an order was issued to cancel the ex-gratia provision. The Prime Minister- chaired NDMA received flak from the SC for it. The SC also ordered steps to simplify guidelines for issuance of “death certifi- cates/official documents stating the exact cause of death, that is, ‘Death due to Covid-19’” for enabling dependents to get benefits of welfare schemes. ?=BQ =4F34;78 Pakistan allowed India to use its airspace for Prime Minister Narendra Modi to travel to the US. The PM’s plane avoided Afghanistan as it has closed its airspace for any commercial use since the Taliban took control. India had sought permis- sion from Pakistan regarding the usage of Pakistan’s airspace for Modi’s flight to the US, for which Islamabad gave a nod. In the past, Islamabad had denied this access when President Ram Nath Kovind and Modi travelled abroad in 2019. This move was to protest against abrogation of Article 370 giving special status to Jammu Kashmir. 2PaRPbb^UPfWP[TPcEPbPXQTPRWX]?P[VWPaSXbcaXRc^]FTST]TbSPh ?C8 Dubai: Sunrisers Hyderabad pacer T Natarajan tested posi- tive for Covid-19 but the team’s IPL match against Delhi Capitals on Wednesday went ahead as scheduled after the remaining contingent was found to be negative. Left-arm pacer Natarajan, who is com- ing back from a knee surgery, has been isolated along with six close contacts which also include out of favour India all- rounder Vijay Shankar. “Sunrisers Hyderabad play- er T Natarajan tested positive for Covid-19 at a scheduled RT-PCR test. The player has isolated himself from the rest of the squad,” a BCCI release stated. P12 C!e`4`gZUgZTeZ^d¶Z_+8`ge ([JUDWLDDLGDOVRWRIDPLORIWKRVHZKRIDOOSUHWRFRURQDYLUXVLQIXWXUH6WROG ?=BQ =4F34;78 Aday after New Delhi slammed the UK for adopting a “discriminatory” policy against Covishield and warned of “reciprocal mea- sures,” the British Government on Wednesday added it to the list of approved Covid-19 vac- cines but kept India out of the eligible countries list flagging the vaccine’s certification. Fully vaccinated Indians will thus still have to undergo a 10-day self isolation or quarantine after their arrival in Britain. The Oxford/AstraZeneca Covid-19 vaccine, manufac- tured by the Serum Institute of India, was recently excluded from a list of eligible Covid-19 vaccines recognised under Britain’s reviewed internation- al travel norms, effective from October 4. The updated UK travel guidelines now said, “Formulations of the four list- ed vaccines, such as AstraZeneca Covishield, AstraZeneca Vaxzevria and Modern Takeda, qualify as approved vaccines.” The site explains that from 4 am, October 4, those who have taken vaccines from a “rel- evant public health body” in specific countries will be con- sidered “fully vaccinated”. That list does not include India. This suggests that Indians vaccinated with two doses of Covishield, produced by SII, will still need to quarantine even though India is now on the Amber list. ?PZXbcP][Tcb^SXcaPeT[ eXPXcbPXab_PRTc^DB 0DKDQW1DUHQGUD*LUL JLYHQ%KRR6DPDGKL 2 µG^RcdVV_ `__VT`WDR_e KVV6_edYRcVd k``^RWeVc^VcXVc hZeYD`_jAZTefcVd R__`f_TV^V_e Rje``WRcD4R]]`hdh`^V_ e`eRV?52 ViR^Z_?`gZedV]W 3cRkZ]9VR]eYZ_ T`_ecRTed4`gZU RWeVcF?82gZdZe BA7´b=PcPaPYP]cTbcb2^eXS_^bXcXeT]^ TUUTRc^]8?; PcRWPbaTbc^UcTPUX]T 0ccPRZb^]CP[XQP] eTWXR[TbZX[[$X]0U FcVT`X_ZdVdgRTTZ_V SfeVVad:_UZR`fe`W V]ZXZS]VT`f_ecZVd]Zde W]RXXZ_X[RSTVceZWZTReZ`_ ?aXTX]XbcTa=PaT]SaP^SXST_PacbUa^=Tf3T[WXU^aWXbeXbXcc^cWTDB0 ?C8 0ZWPaPBPSWdb_TaU^aPaXcdP[SdaX]V³1W^^BPPSWX´^U^acP[aTPX]b^U0ZWX[ 1WPaPcXhP0ZWPaP?PaXbWPS_aTbXST]cPWP]c=PaT]SaP6XaXPWPaPYPc1PVWPQPaX 6PSSXPcWX]?aPhPVaPY^]FTS]TbSPh ?C8 D:]^Sc^2^eXbWXT[SQdc8]SXP]bbcX[[UPRT³`dPaP]cX]T´ =8:00;8:Q 270=3860A7 In what is being seen as Capt Amarinder Singh’s decision to break away from the party he served for decades, the for- mer Punjab Chief Minister on Wednesday announced his decision to pitch a strong candidate against “Super CM” Navjot Singh Sidhu. His assertion came almost simultaneously with a tweet from his OSD saying, “Reverting Back in a Big Bang,” with Capt Amarinder’ picture and superimposed caption — Capt 2022. Virtually raising a banner of revolt, Amarinder criti- cised Rahul Gandhi and Priyanka Gandhi for their “inexperience”, adding “their advisers are misguiding them”. Also taking a dig at Sidhu Company over charges of no action against the Badals and SAD leader Bikram Majithia, Amarinder chal- lenged them to “throw the Akalis leaders behind bars if they can”. At the same time, he came down heavily on his bête noire Sidhu for “interfering” in his successor Chharanit Singh Channi’s domain by “dictating the terms”. Not sparing even Congress supremo Sonia Gandhi, Amarinder declared that he had offered to quit as Punjab CM three weeks back she had asked him to contin- ue. DSWDLQUHYROWVWRSXW XSµVWURQJFDQGLGDWH¶WR GDVK6LGKX¶V0KRSHV 86YLVLWWRERRVW VWUDWHJLFWLHV30 /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $ 8bbdT !% 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D=C7DAB30HB4?C414A !!! *?064B !C! DA@CE# 32?024ABA4BCA82C BA7C # m m H@C=5) 4=EHB5278=0ADBB80?0:44C C0;810=558280;B05;4034AB 7?EB1F31D G19DD?G?B; G9D8J?I1 ! F9F139DI @A:?:@?' B=D8B0=0;CAD8BC =C0BF8=3;4A
  • 2. ]PcX^]! 347A03D=kC7DAB30H kB4?C414A!!! $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV ?=BQ 347A03D= Ecologically sustainable aqua- culture based on symbiotic technology is set to revolu- tionise the coastal aquaculture industry in the country. The aquaculture based on symbiot- ic technology is a guaranteed way for achieving Prime Minister Narendra Modi's vision for doubling the aqua farmers' income, said Tamil Nadu J Jayalalithaa Fisheries University (TNJFU) vice-chan- cellor G Sugumar. He was speaking after inaugurating the project on standardised pond- based culture technique for commercially important marine finfishes and pond-based recir- culated aquaculture system (RAS) for vannamei shrimp at Chippikulam near Thoothukudi. Sugumar said the initiative launched by Kings Infra in association with the university to promote the pro- ject would help the aquaculture farming practice to be truly sus- tainable in the country. The recirculated aquaculture sys- tem (RAS) empowers farmers to utilise water to the maximum sustainable levels by eliminating possible wastage by converting the same to another resource. Speaking on the occasion, chairman and managing direc- tor of Kings Infra, Shaji Baby John said the company aims at training over 5,000 farmers in the coastal region by utilising the technology being devel- oped under this joint collabo- rative project. Stressing on the importance of doubling farmers' income for the growth of the economy he said the ecologi- cally sustainable aquaculture provides the best possibility for the coastal farmers to realise the dream of augmenting their income. The joint venture would develop a standard tech- nology on developing the framework for sustainable aqua- culture technology in a step-by- step manner incorporating the necessary scientific inputs and technical requirements. The next stage would be creating a knowledge-sharing platform for extending the developed tech- nology to the farming commu- nity and also to provide on-farm training, he added. The Kochi-based Kings Infra has been advocating the need for an environmentally sustainable aquaculture for the past many years. Sustainable aquaculture has considerable scope for growth as 49 per cent of global demand for human consumption of fish is con- tributed by aquaculture. Aquaculture shrimp con- tributed 74 per cent value of the Indian seafood exports worth Rs 43,717 crore exports in FY 2021. Z_Xd:_WcRe`ScZ_XWRc^Vcd f_UVcdfdeRZ_RS]VRbfRTf]efcV ?=BQ AA:44 The Roorkee mayor Gaurav Goel sprayed insecticide in various wards of the munic- ipal corporation as part of the measures being taken against dengue in the city. He said that the special cleaning and awareness cam- paign against dengue will con- tinue to prevent the rise of dengue in the city. He also spoke about the general steps to be taken by the public to pre- vent breeding of the dengue causing mosquitoes. Municipal councillors and officials were also present on the occasion. 5RRUNHH0DRUKHDGV DQWLGHQJXHGULYH ?=BQ AA:44 Discussions were held on the smart city concept on the third day of a five-day online faculty development workshop spon- sored by the All India Council for Technical Education (AICTE) at the Faculty of Engineering and Technology of Gurukul Kangri Vishwavidyalaya in Haridwar. On day three of the workshop, deliberation was made on Smart City concept of the government of India. Department of Electronics and Communication head and the workshop convener Vipul Sharma said that lectures were held in three sessions on the third day of the workshop. C]Qbd3YdiS_^SU`dc TYcSeccUTY^g_b[cX_` ?=BQ 347A03D= The anti-drug task force (ADTF) of Dehradun police nabbed two persons with 14.42 kilogrammes of Ganja on Wednesday. The duo allegedly used to sell the con- traband mostly to school and college students. The police informed that the two accused are 19 and 26 years old and belong to Darbhanga in Bihar. They were caught during the checking of vehicles in the morning near the Mata Mandir area in Ajabpur. According to the police, the accused told during the inves- tigation that they both bring Ganja from Bihar at cheaper rates and then sell it here to school and college students and some labourers for more profit. The officials informed the police that they have registered a case against both the offend- ers in Nehru Colony police sta- tion and that they will be pre- sented in the court soon. 3ROLFHQDEGXRZLWK NJ*DQMD ?=BQ 270=3860A7 Haryana Chief Minister Manohar Lal Khattar will inaugurate 71 Har-Hith stores on October 7 in the state. “These stores have been set up in 19 districts across the state and will be inaugurated by the Chief Minister through video conferencing,” said an official spokesman. He said that there is a lot of enthusiasm among the youth towards the Har-Hith retail store scheme in Haryana. The Chief Minister has directed to give priority to the families identified through the Parivar Pehchan Patra scheme in the Har-Hith Stores scheme. If the beneficiaries identified under the Chief Minister Antyodaya Parivar Utthan Yojana take a loan under this scheme, then the government will bear the interest of one year on their loan, the spokesman informed. The Chief Minister on Wednesday presided over a review meeting regarding the Har-Hith Retail Store scheme. So far ,1258 youth have applied under this scheme. After completion of all these formalities, 71 Har-Hith stores will start functioning from October 7. Giving details, the spokesman said that under the Har-Hith retail store scheme of the Chief Minister to promote business, employment and modern market in rural areas of the state, 1258 applications have been received so far, out of which 982 have been sur- veyed and 509 who have been found eligible have been given the benefit of this scheme. Of these, agreements have been signed with 151. Out of these, 95 applicants have taken Mudra loan and 56 applicants have applied with their own money. During the meeting, the Chief Minister directed the officers to make a plan to open 5000 booths of Vita. He said that there should be a Vita booth at every bus stand, rail- way station, hospital, market etc. He also directed to make portable cabins and open booths so that more and more people get employment. The Chief Minister also directed that the products of other companies should also be kept at these booths so that the quality of our products can be improved according to the competition. Apart from this, efforts should be made to open Vita booths in Chandigarh as well, he said. +DUDQD0WR LQDXJXUDWH+DU+LWK VWRUHVRQ2FWREHU ?=BQ 270=3860A7 On the occasion of world car free day, Himachal Chief Minister Manohar Lal Khattar, his Cabinet Ministers, BJP MLAs and senior officers rode bicycles from the Chief Minister's official residence to the Civil Secretariat, Sector 1 here on Wednesday. The Civil Secretariat is nearly two km from the Chief Minister's official residence in Chandigarh. While Khattar came to office by bicycle, he went back home on an e- scooter to give a message of environmental protection to the public. In the past also, the Chief Minister had been seen riding a bicycle to his office. While talking to the medi- apersons on the occasion, the Chief Minister said that he had decided to not use his official car for the entire day. I came to the office by bicycle, complet- ed my work in the office till the afternoon and returned to my residence by e-scooter wearing a helmet. Even after the lunch break, I came to the office by e-scooter and participated in the cabinet meeting, he said. The Chief Minister said that before 2000, the Environment Transport Association used to observe green transport week in the middle of June and fixed Tuesday as annual car free day. As many as 46 countries agreed to observe world car free day on September 22, 2000. It is being observed continuously since then. But now due to environmental awareness, the number of countries observing this day is increasing, he said. Khattar said that the pur- pose of this day is to create awareness about environmen- tal protection among the peo- ple, to make them aware about the harm caused to the envi- ronment by excessive use of motor vehicles and to encour- age them to use public trans- port or cycle or even walking. While calling upon the people of the state to protect the environment, he said that the environment is getting pollut- ed due to the continual increase in the number of vehicles. People have considered vehicles as status symbols, due to which employees and officers use vehicles as the main mode of commuting even when they stay close to their offices, the Chief Minister said. He called upon people to take a pledge to adopt a car-pooling system or to travel on foot or cycle to nearby places. He further informed that Haryana Government is promoting to establish oxyvans in the state and for this, about 3 crore saplings are also being planted by the forest department. Students are being motivated towards plantation, he added. The Chief Minister also informed that while taking steps to reduce pollution levels, till now plying of CNG buses was being encouraged in Gurugram, but now the emphasis will be laid on run- ning e-buses and e-autos there too. He also inaugurated an awareness exhibition on e- vehicles organized at the Civil Secretariat here. While taking a round of the exhibition, he inquired about the 'World Car- Free Day’ as well as charging stations set up by Haryana Government, various schemes to promote e-vehicles and schemes like subsidy, Oxyvan, CNG buses in Gurugram, vehi- cle-scrap policy etc. Subsidy will be given for purchasing e-vehicles Khattar said that in order to encourage more usage of e-vehi- cles in the state, the Haryana Government will give subsidy to the people for purchasing e- vehicles. Electric vehicle poli- cy chalked out by the State Government will be launched soon, he said. The policy pro- poses to waive off road tax, reg- istration fee, state toll tax and provide an incentive of upto at least Rs one lakh for new vehi- cles. The Chief Minister said that the government has also formulated a vehicle-scrap pol- icy for the discontinuation of vehicles older than the pre- scribed period in the NCR region. 7PahP]P2bWd]bRPaU^aPSPh_TSP[bc^2XeX[ BTRaTcPaXPcP]SaTcda]bW^TQhTbR^^cTa ?=BQ 270=3860A7 Haryana Government on Wednesday appointed Justice Somnath Aggarwal (retd.) of Punjab and Haryana High Court as Commission of Inquiry to ensure fair and transparent investigation into the incident of lathicharge on farmers at Bastara Toll Plaza in Karnal on August 28. A decision to this regard was taken in the meeting of the state cabinet held under Chief Minister Manohar Lal Khattar. The Commission of Inquiry will inquire into the circumstances leading up to and including the action by the Police at Karnal on August 28 and the use of force against the demonstrators, an official spokesman said. He said that the Commission will also ascertain persons responsible for said situation and further will inquire into the role of IAS Ayush Sinha, the then Karnal sub divisional magistrate, in the police action on farmers. Justice Somnath Aggarwal (retd) had in the past headed Haryana Backward Classes Commission. Haryana Police had lath- icharged a group of farmers at Karnal’s Bastara toll plaza on August 28 while they were heading to protest against a BJP meeting where Chief Minister Manohar Lal and senior BJP leaders were present. 7PahP]PP__^X]cb2^XbbX^] ^U8]`dXahc^_a^QTX]c^:Pa]P[ [PcWXRWPaVT^]UPaTab ?=BQ 270=3860A7 Haryana Home and Urban Local Bodies Minister, Anil Vij on Wednesday direct- ed the concerned officers to immediately open alternate routes from Haryana to Delhi due to closure of Singhu bor- der and Tikri border due to the ongoing farmers' agitation for ten months now. Vij while presiding over a meeting of senior officers here, asked them to start the repair work of alternate routes so that the general public does not face any kind of problem while commuting to Delhi on these routes from Haryana. The government also released the list of alter- nate routes which will be repaired from Thursday onwards. While giving instructions to the officers, the Home Minister said that keeping in mind the conve- nience of the people, the alter- nate routes will have to be repaired at the earliest and work in this regard will start from Thursday itself. He said that short term tenders will be issued soon. Vij also asked the officials that the work being done by NHAI on NH-44 should be started immediately so that there is no problem in the movement of people. On this, Vij assured the concerned officers that if there is any problem in start- ing this work, the help of police will also be provided to NHAI. Similarly, he said that HSIIDC roads are the main alternative routes from Sonepat to Delhi and they should be repaired at the ear- liest. Also, regarding the Kundli-Manesar-Palwal (KMP) Expressway, he direct- ed the officers concerned that there must be a provision of public toilets at KMP. Earlier speaking on the issue of farmers’ unions not attending the meeting of the state-level committee on clear- ing road blockade due to agi- tation, Vij said that the Supreme Court will be apprized about the matter and Home Minister Amit Shah has already been informed about the same. Vij said that the case is slated to come up for hearing on September 24, while an early hearing has also been sought. He said that an affidavit has also been filed regarding efforts being made and the present situation and now fur- ther course of action will be taken as per the court orders. Notably, the farmers’ leaders did not attend the meeting convened by Haryana Government’s high-powered committee on Sunday over clearing the blockade on national highway-44 on the Kundli-Singhu border. Following the directions of the Supreme Court, the State Government had last week constituted a state-level com- mittee comprising Additional Chief Secretary, Home, Rajeev Arora as chairman to hold talks with farmers’ organiza- tions. EXYbPXScWPccWT Bd_aTT2^dacfX[[ QTP__aXiTSPQ^dc cWTPccTaP]S7^T X]XbcTa0XcBWPW WPbP[aTPShQTT] X]U^aTSPQ^dc cWTbPT 0[cTa]PcTa^dcTbUa^7PahP]P c^3T[WXfX[[QTaT_PXaTS)7ah 7^TX]XbcTa0]X[EXY CWTcTRW]^[^VhXb PVdPaP]cTTS fPhU^aPRWXTeX]V ?aXTX]XbcTa =PaT]SaP^SXb eXbX^]U^a S^dQ[X]VcWTP`dP UPaTabX]R^T 3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO$UHD'HKUDGXQ 8WWDUDNKDQG([HFXWLYH(GLWRU1DYLQ8SDGKD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH) 6HFWRU12,'$*DXWDP%XGK1DJDU83 3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
  • 3. dccPaPZWP]S 347A03D=kC7DAB30H kB4?C414A!!! ?=BQ 347A03D= The Pradesh Congress Committee (PCC) Ganesh Godiyal has accepted that pres- sure is on the Congress party after BJP and Aam Aadmi Party (AAP) have announced the names of the persons who would be the face of their par- ties in the upcoming assembly elections in Uttarakhand. He however added that the works and developmental activities during the term of the Congress government in the state are the face of the Congress party. The PCC president said this when asked by The Pioneer about pressure on the Congress to declare its face in Uttarakhand since the BJP has declared that Chief Minister Puskhkar Singh Dhami would be its face while AAP has made Colonel (Retd) Ajay Kothiyal its CM candidate. Launching an attack on the CM Dhami for going on an overdrive of announcing sops without making provision for the budget, Godiyal said that the economy of the state is in shambles. He said that the Comptroller and Auditor General (CAG) in its report has mentioned that in the last four and half years the burden of debt on Uttarakhand has increased by a whopping Rs 39,000 Crores. Godiyal said that the situation is such that the State Government in order to pay salaries and pensions has to borrow money. He said that the CM is making only the announcements and weaving a web of lies to fool the people of the state. The PCC president said that the Congress party is taking the services of econo- mists and other experts for drafting its manifesto and the document would have the party’s plan to revive the econ- omy of the state. Godiyal claimed that rampant corrup- tion has occurred in the pur- chase of medical equipment. He said that the CM Dhami should get this and the scams of Kumbh testing and higher education investigated failing which it would become clear that he is protecting the cul- prits. when asked to comment on the statement of former Chief Minister Harish Rawat that he want that someone from Dalit community is made the CM of Uttarakhand , Godiyal said that any person who is suited to lead the state should be made the CM. He added that Congress party has always worked for developing leadership among Dalits and downtrodden sections of the society and had made a Dalit PCC president, speaker of Vidhan Sabha and Rajya Sabha MP. ?=BQ ?0DA8 The registrar of Govind Ballabh Pant institute of Engineering and Technology at Ghurdauri in Pauri district, Sandeep Kumar has been sus- pended by the institute’s board of governers. The board’s vice chairperson and additional chief secretary Radha Raturi stated in the letter that Sandeep Kumar is being suspended with immediate effect since dis- ciplinary action is being con- templated against him due to allegations of irregularities. Kumar is accused of tampering with records pertaining to his appointment in the institute, misleading the board of gov- erners during his selection to the post of registrar in the insti- tute, financial irregularities and not handing over files and records of the institute which were in his custody apart from alleged ìrregularities in the procurement of goods, work and services in the institute. It is also mentioned in the letter that the board reserves the right to add any further alle- gation that is appropriate in the light of information obtained during inquiry. During the period of suspension, Kumar will not do any official work. The newly appointed registrar professor Y Singh confirmed the suspension of Sandeep Kumar. Pauri district magis- trate Vijay Kumar Jogdande is the administrator of the insti- tute. The president of joint employees association Bharat Singh Negi said that the asso- ciation and the local people had undertaken an agitation against the irregularities allegedly orchestrated by Sandeep Kumar and had also met the chief minister seeking an inquiry. Kumar was appointed in the institute to the post of training and placement officer in 2006. He was appointed as in-charge registrar in 2016 and again in 2017 before being appointed the full-time regis- trar of the institute in 2019. ?=BQ 347A03D= The state health department reported 23 new cases of the novel Coronavirus (Covid- 19) and 16 recoveries from the disease in Uttarakhand on Wednesday. Death of no patient was reported from the disease on the day. The cumu- lative count of Covid-19 patients in the state is now at 3,43,428 while a total of 3,29,695 patients have recov- ered from the disease so far. In the state, 7391 people have lost their lives to Covid -19 till date. The recovery percentage from the disease is at 96 while the sample positivity rate on Wednesday was 0.13 per cent. The state health depart- ment reported six new patients of Covid -19 from Dehradun, four each from Pauri and Pithoragarh, three from Uttarkashi, two from Chamoli and one each from Haridwar and Tehri on Wednesday. No new cases of the disease were reported from Almora, Bageshwar, Rudraprayag and Udham Singh Nagar districts on the day. The state now has 256 active cases of Covid-19. Dehradun with 126 cases is at the top of the table of active cases while Pauri has 30 active cases. Tehri has only one active case of the disease now. In the ongoing vaccination drive 58,241 people were vaccinated in 953 sessions in the state held on Wednesday. As per the data of the state health department 72,77,865 people in the state have received the first dose of vaccine while 28,76,500 have received both doses of the vac- cine. ?=BQ 347A03D= The Health Minister of Uttarakhand Dhan Singh Rawat called upon the union health and family welfare minister, Mansukh Mandavia in New Delhi on Wednesday. In the meeting Rawat request- ed that an All India Institute of Medical Sciences (AIIMS) should be opened in the Kumaon region of the state. He said that the people of Kumaon division have been demanding a super speciality centre in their area for quite some time and the demand can be fulfilled by opening an AIIMS in the region. Rawat told the Union minister that the state health department has made necessary prepara- tions to tackle the probable third wave of the pandemic of Covid-19. He said that work on set- ting up four new medical col- leges and upgradation of health centres is going on in the state. Rawat told Mandavia that one crore vaccine doses have been administered in the state and the target to completely vaccinate the entire 18 plus population would be achieved in the month of December. Rawat was accompanied by the health secretary Amit Singh Negi and the Principal of Government Doon Medical College (GDMC) Dr Ashutosh Sayana in the meet- ing with the minister. ?=BQ 9B780C7 Abear was shot dead by Forest department officials in Joshimath late on Tuesday night in the ongoing human- wildlife conflict situation in this part of Chamoli district. While it is being stated that the bear was shot in self-defense, some observers opine that the department personnel did not conduct its tranquilisation effi- ciently which led to the fatal incident. Black bear sightings are not uncommon in Joshimath though they have increased near human settlements in recent times due to various fac- tors including improper garbage disposal. Late on Tuesday night, a bear reached the inhabited area of Sinhdhar. The locals informed the forest depart- ment about the bear. The department personnel reached the area along with a team equipped to tranquilise the animal. However, the bear ran away downhill as the person- nel neared it. The bear was hid- ing in a field with the person- nel approached it again to tranquilise it. After the tran- quiliser dart was shot, the agi- tated bear rushed forward and one of the department person- nel crowding the site shot it. Forest range officer Chetna Kandpal said that the bear was a female. Her body was buried after post mortem examina- tion. The department will con- tinue to patrol the area, she added. ?=BQ 347A03D= The Congress party has demanded termination of the membership of Purola MLA Rajkumar from the Uttarakhand Assembly. Rajkumar had recently joined the BJP. The Leader of Congress Legislature Party (CLP) Pritam Singh submitted a petition to Vidhan Sabha sec- retary Mukesh Singhal on Wednesday in which the demand was made. In the peti- tion Singh said that Rajkumar contested the assembly election of the year 2017 on the symbol of Indian National Congress from Purola assembly con- stituency and was elected to the fourth assembly of the state. He said that on September 12, 2021 Rajkumar joined the BJP in Delhi in presence of BJP leaders Dharmendra Pradhan, Anil Baluni, Madan Kaushik and others. In his petition Pritam Singh further added that since Rajkumar has left the Congress party on his own he becomes ineligible for the membership of the house under the provisions of tenth schedule of the constitution. He demanded that the member- ship of Rajkumar should be ter- minated and the seat repre- sented by him should be declared vacant. The CLP leader added that Rajkumar should be barred from attend- ing the proceedings of the house in the capacity of its member till action on the peti- tion is taken. ?=BQ 347A03D= In a significant development the union ministry of health has given its approval to the Gandhi Centenary Eye Hospital (GCEH) for setting up an eye collection centre. The hospital would be the first centre in the state to have this facility. The director general (DG) state health services, Dr Tripti Bahuguna has directed the hospital authorities to start the centre before November 1 this year. The GCEH has been granted permission for starting the eye collection centre under the National Programme for Control of Blindness. The director National Health Mission, Dr Saroj Naithani said that the necessary infra- structure and facilities would be developed in the GCEH for the centre. Terming the permission as a great achievement, Dr Naithani said the people resid- ing in the areas near to Dehradun especially Garhwal division would get the benefit of eye transplant. She clarified that the GCEH would only act as the eye collection centre and the collected eye ball would be kept at the eye banks of All India Institute of Medical Sciences (AIIMS), Rishikesh or Himalayan hospital Jollygrant, Dehradun. It is worth men- tioning here that there are more than 40,000 people with vision impairment. In India cornea transplant is done in about 50,000 people. ?=BQ ;0:B0A Bharatiya Kisan Union (BKU) leader Rakesh Tikait said that despite governmental pressure, the protesting farm- ers are not relenting. Addressing a Mahapanchayat of protesters at Laksar in Haridwar district on Wednesday, he said that the agitation will continue till the farm laws are repealed. Tikait said that Prime Minister Narendar Modi had promised to double the income of farmers by 2022 but farmers are far from achieving this. He said that the Bharatiya Janata Party has failed to ful- fill its promise of providing employment to the youths. He also alleged that Modi and Union Minister Amit Shah were close to the Ambanis and Adanis. Stating that farmers are suffering due to various irregularities he opined that traders will also go hungry if the farmers lack money to continue farming. Referring to the coming Assembly elections in Uttarakhand and Uttar Pradesh, Tikait said that the people of these two states will give a befitting reply to politi- cians not working for their welfare. During his address, Tikait focused considerably on polit- ical and other issues along with agricultural issues. µ4`_Xf_UVcacVddfcVe` R__`f_TVWRTVZ_FYR_U BPhbcWPc2^]VaTbbWPb P[fPhbf^aZTSU^a STeT[^_X]V[TPSTabWX_ P^]V3P[XcbP]S S^f]ca^SST]bTRcX^]b *KXUGDXULLQVWLWXWH UHJLVWUDUVXVSHQGHGIRU DOOHJHGLUUHJXODULWLHV 3_fYT!)*#^UgSQcUc !bUS_fUbYUcY^Eµ[XQ^T ?=BQ 347A03D= The Nainital district admin- istration has directed municipal bodies to install separate bins in marketplaces for the proper disposal of used face masks. The chief develop- ment officer (CDO) Sandeep Tiwari told The Pioneer that the usage of face masks has increased considerably in the past two years due to the Covid- 19 pandemic but their dispos- al with the regular garbage can cause damage to human health and the environment. He said that the administration wants people to develop a habit to dis- pose of their face masks sepa- rately as their usage may poten- tially increase with time. Many people throw used face masks in garbage bins and in open areas which can be harmful to humans as well as the environment. The admin- istration is considering used masks as a bio-hazard and working for their proper dis- posal across the district. As an initiative, I have recently direct- ed the municipal bodies to set up separate bins in crowded locations in their respective areas for the disposal of the used masks within one week, said the CDO. He informed that the municipal bodies of Nainital and Haldwani have been direct- ed primarily to install the sep- arate bins for masks disposal and others will follow it after- wards. Tiwari stated that the administration is also consid- ering making incinerators avail- able in the municipal offices for proper masks disposal to avoid any further possibility of the spread of any kind of infection. Till then, the used masks will be disposed of like biomedical waste, said Tiwari. =PX]XcP[23SXaTRcbX]bcP[[PcX^]^U bT_PaPcTQX]bU^adbTSPbZbSXb_^bP[ 1TPabW^cSTPS X]Q^cRWTS caP]`dX[XbPcX^] PccT_c 2^]VSTP]SbSXb`dP[XUXRPcX^]^USTUTRc^a APYZdPa´b0bbTQ[hTQTabWX_ 2;?[TPSTa?aXcP BX]VWbdQXcb _TcXcX^] 'KDQ6LQJK GHPDQGV$,,06 IRU.XPDRQUHJLRQ TTcbD]X^] X]XbcTaP]SPeXP X]=Tf3T[WX (HFROOHFWLRQ FHQWUHWRFRPH XSLQ'RRQ :RQ¶WUHOHQWWLOOIDUP ODZVDUHUHSHDOHG %.8OHDGHU7LNDLW ?=BQ 1064B7F0A The authorities have ordered closure of the government high school at Bilauna for three days after a class VIII student tested positive for Covid-19. The chief education officer (CEO) has issued an order to close the school for three days and conduct Covid tests of all students who came in contact with the positive student in this school situated near Bageshwar city. The student found infected hasbeenkeptinhomeisolation. The school management informedthedepartmentaloffi- cials about the student of Bilauna's government high school being found Covid pos- itive. The CEO Padmendra Saklanihasinstructedtheschool managementtoclosetheschool for the next three days and san- itizetheschoolbuildingproperly. BRW^^[R[^bTSU^acWaTTSPhb PUcTabcdST]ccTbcb_^bXcXeT ?=BQ 347A03D= In view of the increasing number of dengue patients in the city which has risen above 15 patients, the municipal com- missioner Abhishek Ruhela has directed the health section of the Municipal Corporation of Dehradun (MCD) to keep a complete record of the fogging being done by the sanitation workers. Recently, many locals from different locations have approached the commissioner for regular fogging in their areas as a preventive measure against dengue as many stated that fogging is not being done in several areas of the city for weeks. On the other hand, the officials of the health section have been claiming constantly that fogging is being done reg- ularly across the city. According to them, the workers are car- rying out regular fogging in areas like Indiranagar, Vasant Vihar and Seemadwar where most of the dengue patients have been found so far and fog- ging in other areas is being done in regular intervals. Due to this, Ruhela has directed the officials of the sanitation section to maintain a complete record of when and at which place, the fog- ging is being done by the cor- poration. He said that the corpora- tion will take public feedback on the fogging and the report on regular fogging will help in maintaining transparency too. =e^YSY`QS_]]YccY_^Ub TYbUSdcd_[UU`V_WWY^WbUS_bT ?=BQ 347A03D= The Dehradun Mayor Sunil Uniyal 'Gama' inspected the ongoing construction works under Atal Mission for Rejuvenation and Urban Transformation (AMRUT) in the Kaulagarh area on Wednesday. Along with the officials of Peyjal Nigam, 'Gama' also inspected the sewage treatment plant of the minimal liquid discharge (MLD) system. The officials informed the mayor that com- pletion of this treatment plant which is being constructed with a budget of Rs seven crore will considerably min- imise waterlogging in the near- by areas during monsoon. They said that the plant will be ready by March next year. ‘Gama’ asked the officials to complete the work as soon as possible to avoid any inconve- nience to locals. µ*DPD¶LQVSHFWV$0587 ZRUNLQ.DXODJDUK ?=BQ 347A03D= In view of the Pulse Polio drive on Sunday, the Dehradun district administra- tion has directed the health department officials tocarry out a detailed homework and work plan to maximise the polio vac- cination in the areas where chil- dren are more vulnerable to be deprived of the vaccination. In a virtual meeting with the offi- cials of various departments including health, education, Panchayati Raj and women empowerment and child devel- opment, the additional district magistrate (ADM) Shiv Kumar Barnwal directed to ensure the implementation of Covid-19 guidelines in all the vaccination centres. He asked the officials to minimise the physical contact with the children as much as possible during the vaccination and if required, parents should be asked to help in giving polio drops. The ADM also asked the health department to allot the duty to staff for the polio drive without causing any disruption in the ongoing Covid vaccina- tion drive. The district immunisation officer Dinesh Chauhan also informed during the meeting that polio vaccination will be administered in every health centre of every block of the dis- trict this Sunday except Chakrata and Kalsi. Subsequently,hesaid,theseven- day door to door polio vaccina- tion drive will be started from Monday too. He also informed that vaccination will be admin- istered in a total of 1,245 booths including 1,169 permanent booths, 56 transit booths and 20 mobile booths with the help of 249 supervisors. Besides this, 1,002 teams with the help of 334 supervisors will conduct the door to door drive across the district, added Chauhan. 14=TYbUSdcXUQdXTU`d d_g_b[_^]QhY]YcY^W `_Y_fQSSY^QdY_^ ?=BQ =08=8C0; Hearing the case for release of a Pakistani citizen arrested on charges of spying, the Uttarakhand High Court maintained the sentence hand- ed out to Lahore resident Abid Ali alias Ajit Singh. Handing out its judgement, the single bench of Justice Ravindra Maithani directed the govern- ment to cancel his bail bond and take him in custody, adding that there was ade- quate proof against Ali and that he had violated the Passport Act. On January 25, 2010 dur- ing the Kumbh Mela in Haridwar, the police had arrest- ed Ali in Roorkee under the Official Secrets Act, Foreigners Act and Passport Act. The police found maps of army installations in Meerut, Dehradun, Roorkee and other locations, one pen drive and various documents pertaining to sensitive information. On raiding his accommodation in Macchi Mohalla, the police had found about a dozen SIM cards concealed behind a switch board and the ceiling fan. Finding him guilty, the lower court had sentenced him to seven years imprisonment in December 2012. His counsel had filed an appeal or his release but did not state correct facts about his address and other details. A Court in Haridwar had issued orders for his release but the jail superintendent sub- mitted an application in the court and the office of the senior superintendent of police stating that the person was a foreign citizen and that a per- sonal bond and other formal- ities had to be fulfilled before his release. The Government filed a special appeal against the order of the lower court stating that the same should be cancelled as there was ample evidence of Ali spying. CXZPXc^_X]TScWPc caPSTabfX[[P[b^V^ Wd]VahXUcWTUPaTab [PRZ^]Thc^ R^]cX]dTUPaX]V 8]8]SXPR^a]TP caP]b_[P]cXbS^]T X]PQ^dc$ _T^_[T +PDLQWDLQVVHQWHQFH LQ3DNHVSLRQDJHFDVH
  • 4. ]PcX^]# 347A03D=kC7DAB30H kB4?C414A!!! ?=BQ =4F34;78 There are no issues with the CoWin app or the vaccine certification process, National Health Authority CEO RS Sharma said on Tuesday, a few minutes after a revised UK advisory accepted Covishield as a valid vaccine but said double- jabbed Indians still have to quarantine because of “vacci- nation certification issues”. “There are no issues on CoWin with certification... sys- tem is entirely WHO compli- ant. We continue to have dis- cussions with the International Civil Aviation Organisation. The UK High Commissioner visited me on September 2. They wanted to understand the system... technical aspects,” Dr Sharma told NDTV. “A resource has been allo- cated and two further conver- sations have happened with their team. These were techni- cal-level conversations,” he explained. The British High Commission said: “We are engaging with the Government of India to explore how we can expand UK recognition of cer- tification to people vaccinated by a relevant public health body in India.” The UK’s updated travel advisory now says: “Formulations of the four list- ed (i.e., recognised in the UK) vaccines, such as AstraZeneca Covishield, AstraZeneca Vaxzevria... qualify as approved vaccines”. Serum Institute CEO Adar Poonawalla, whose facility manufactures (and then ships back to the UK) Covishield said that he was “delighted” with the recognition but warned “the matter for travel and quaran- tine is not resolved” The rules also consider who have received jabs under public health bodies in Australia, Antigua and Barbuda, Barbados, Bahrain, Brunei,Canada, Dominica, Israel, Japan, Kuwait, Malaysia, New Zealand, Qatar, Saudi Arabia, Singapore, South Korea or Taiwan as fully vaccinated. Changes in UK rules are most likely to affect students, who are now returning in large numbers to British universities or travelling to Britain to start new courses. The change will mean they will have to pay extra for quarantine. ?`ZddfVdhZeY4`HZ_Raa [RSTVceZWZTReZ`_+ ?9246@ ?=BQ =4F34;78 The Director General of World Health Organisation (WHO), Tedros Adhanom Ghebreyesus, on Wednesday thanked Union Health Minister Mansukh Mandaviya for resuming ship- ments of covid-19 vaccines for COVAX, a multilateral initia- tive aimed at fostering global access to coronavirus vac- cines from October. Taking it to twitter Tedros said, “Thank you Health Minister Mansukh Mandviya for announcing India will resume crucial COVID19 vac- cine shipments to COVAX in October. This is an important development in support of reaching the 40% vaccina- tion target in all countries by the end of the year.” Mandaviya on Monday had said that India will resume exports of covid-19 vaccines from October in order to meet its commitment for global supplies through COVAX. The Minister had further said that with the production of covid-19 vac- cines being accelerated, the central government will receive over 30 crore doses in October followed by 100 crores additional doses in the next three months. COVAX, the vaccines pil- lar of the Access to covid-19 Tools Accelerator, is co-con- vened by the Coalition for Epidemic Preparedness Innovations (CEPI), Gavi, the Vaccine Alliance and World Health Organization (WHO), working in partnership with Unicef, vaccine manufacturers across developed and devel- oping countries and World Bank, among others. The COVAX earlier this month cut the forecast for the availability of doses for 2021 by 25% citing export restric- tions on Serum Institute of India (SII). The major reasons for the reduction in the num- ber of doses that COVAX expected to receive in 2021 were export restrictions and uncertainty around the resumption of exports from SII, a key COVAX supplier, and increased challenges at manufacturing sites that sup- ply COVAX. There are 11 vaccines in the COVAX portfolio, includ- ing Covishield. F736_aPXbTb 7TP[cWX]´bSTRXbX^] c^Tg_^acePRRX]T 2WP]VTbX]D: ad[TbPaT^bc [XZT[hc^PUUTRc 8]SXP]bcdST]cb ?=BQ =4F34;78 The Supreme Court on Wednesday rejected a plea filed by Shree Padmanabha Swamy Temple Trust, run by the Travancore royal family, seeking to exempt it from the audit of 25 years as ordered by the top court last year. A bench headed by Justice U U Lalit said the audit should be completed as early as possible, preferably within three months. “It is clear that the audit contemplated was not intend- ed to be confined to the tem- ple only but with respect to the trust. This direction has to be seen in light of the reports of the amicus curiae in the case as recorded in order dated 2015,” said the bench, also comprising Justices S Ravindra Bhat and Bela M Trivedi. The apex court, however, refrained from pass- ing any order on the plea of the Trust to exempt it from the administrative supervision of the Administrative Committee constituted by it saying that it requires factual analysis. The Administrative Committee of the Shree Padmanabhaswamy Temple in Kerala had on September 17 told the apex court that it is in great financial stress and the offerings are not sufficient to meet the expenses, while seek- ing an audit of the temple-relat- ed trust run by the Travancore royal family. All temples in Kerala are closed and while this temple’s monthly expenses are C1.25 crore, “we are able to hardly get 60-70 lakh rupees. Therefore, we have sought certain direc- tions,” senior advocate R Basant, appearing for the com- mittee, had said. The temple is in great financial stress and “we are not able to function”, Basant had said, alleging that the Trust is trying to avoid its obligation by not making their record available for audit. The Trust has 2.87 crore in cash and 1.95 crore in assets as per the 2013 auditors’ report and that is why the entire thing has to be gone into to find out how much money it has, he had said. The Trust is consti- tuted as per court’s order and it must contribute to the tem- ple, Basant had told the bench. Senior advocate Arvind Datar, appearing for the Trust, had argued that it is a public Trust made by the Royal fam- ily and has no role in admin- istration. The Trust was just mentioned by the Amicus Curiae in the case, not as part of the petition, he said. B2]XgTb?PSP]PQWPcT_[T cadbc_[TPc^TgT_cUa^PdSXc BT]X^aPSe^RPcT 0aeX]S3PcPa P__TPaX]VU^acWT CadbcWPSPaVdTS cWPcXcXbP_dQ[XR CadbcPSTQhcWT A^hP[UPX[hP]SWPb ]^a^[TX] PSX]XbcaPcX^] A094B7:D0AQ =4F34;78 Canada has suspended flights from India until September 26. The flights may be resumed from September 27 but it would depend on the results of Covid-19 tests con- ducted on arrival in Canada on passengers travelling from New Delhi on three flights on Wednesday. Air Canada has nonstops on Delhi-Toronto and Delhi-Vancouver routes. Air India flies to Canada direct from Delhi. “As Canada prepares for the return of direct flights from India to Canada, Transport Canada has announced an extension of the Notice to Airmen (NOTAM) that restricts all direct com- mercial and private passenger flights to Canada from India until September 26, 2021, at 23:59 EDT. As a first step, on September 22, 2021, three direct flights from India will arrive in Canada and all pas- sengers on these flights will be tested for COVID-19 upon arrival to ensure that the new measures are working,” the Canada government said. If a high number of posi- tive Covid-19 results are found, the planned lifting of the flight ban on September 27 will be reconsidered. Once the restriction on direct flights expires, travellers eligible to enter Canada will be able to board direct flights from India to Canada must have proof of a negative COVID-19 molecular test from the approved Genestrings Laboratory at the Delhi airport taken within 18 hours of the scheduled depar- ture of their direct flight to Canada. “Prior to boarding, air operators will be checking the travellers’ test results ensuring they are eligible to come to Canada, and that fully vacci- nated travellers have uploaded their information into the ArriveCAN mobile app or website. Travellers who are unable to meet these require- ments will be denied boarding,” it said. “After the resumption of direct flights, travellers who are eligible to enter Canada who depart India for Canada via an indirect route will con- tinue to be required to obtain, within 72 hours of departure, a valid negative COVID-19 molecular test from a third country – other than India – before continuing their journey to Canada,” it added. ?=BQ =4F34;78 Demanding a Supreme Court-monitored probe into the large drugs haul in Gujarat and in the alleged bribery case involving e-com- merce firm Amazon, the Congress on Wednesday said Prime Minister Narendra Modi should answer the nation on these “very serious” issues of national security. “Theseissuesareconcerned with the country’s security and thoseinvolvedintheseissuesare guiltyofseditionandthatiswhy the prime minister will have to answer the nation,” Congress general secretary and chief spokesperson Randeep Surjewala said, a day after the Directorate of Revenue Intelligence (DRI) seized 2,988.21 kg heroin worth crores ofrupeesfromtwocontainersat the Adani-operated Mundra port in Gujarat’s Kutch district and subsequently. Those involved in these casesare“traitors”,Surjewalasaid adding “Should this matter now not be investigated by a special commission of sitting judges of theSupremeCourtandaspecial SIT be put at their disposal?” He also rejected suggestions of seeking a CBI probe, saying, “How can CBI probe those who are its bosses?” He said the shocking revelations in the two cases have shaken the con- science of the country. On the Amazon case, he said it has now come out that the e-commerce giant spent Rs 8,546 crore in “legal fees”, whereas India’s Law Ministry’s annual budget is only C1,100 crore. “The so-called alleged bribery of C8,546 crore was being given to whom in the Modi Government? Who received the money? Was this money given to annihilate the trade and business of crores of small shopkeepers, MSMEs and traders so that e-commerce companies like Amazon could take away their businesses and livelihood,” he asked. 2^]VbTTZbB2[TS _a^QTX]c^SadV bTXidaTUa^6dYPaPc 2P]PSPbdb_T]SbU[XVWcb Ua^8]SXPcX[[BT_cTQTa!% ?C8Q =4F34;78 The Supreme Court on Wednesday asked both the Uttar Pradesh Government and officials of Allahabad High Court to sit together and jointly submit the suggestions for regulating the matters of bail applica- tions during the pendency of the appeals of the convicted persons. The top court said that if the suggestions are not given, then it may formulate some guidelines on its own. A bench of Justices Sanjay Kishan Kaul and B R Gavai said that Allahabad High Court registry has 20-25 page suggestions which are like counter-suggestions to those already given by Uttar Pradesh government. The top court was informed that Allahabad High Court had filed the sug- gestions last evening. “State Government has said something and now you (Allahabad High Court) have said something. They have given suggestions and now you have given counter-sug- gestions of 20-25 pages. How are we supposed to zero in on the most suitable ones? If you are unable to give sug- gestions then we will formu- late some guidelines on our own,” the bench said. Additional Advocate General Garima Prashad, appearing for Uttar Pradesh, said that sometime be given to them as now they have come to know about the thinking of the High Court and they will sit together and compile the most suitable sug- gestions. The bench said that the High Court may itself issue some directions which may meet its expectation and both the UP government and reg- istry staff of the High Court can sit together and sort out the problem. It posted the matter for further hearing on October 5. The top court is hearing 18 criminal appeals of the convicts in heinous offences seeking bail on the ground that they have spent seven or more years in jail and be granted bail as their appeals against the convictions are yet to be listed for regular hear- ing in the high court due to the long pendency. The High Court has given a slew of suggestions to the top court like in cases of seri- ous and grave offences, rights of the victim and his family should be considered before granting bail to an accused. ?=BQ =4F34;78 With 2 more FIRs on Wednesday, the CBI has so far re-registered as many as 40 cases related to post poll vio- lence in West Bengal following the Calcutta high court orders. Out of the two new cases , the first was earlier registered at Jhargram police station in Jhargram district as FIR No.55/2021 dated March 21, 2021. The case was lodged on the allegations that the accused, residents of Pindrakuli in the district, attacked the victim on the same day with sharp weapons due to their alleged political rivalry, while the vic- tim was sitting in a tea stall. The victim was admitted to Jhargram Super Speciality Hospital. Later, the victim suc- cumbed to the injuries. The other case was earlier registered at Narendrapur police station in South 24 Parganas district as FIR No. 588/2021 dated May 6 on the allegations that the accused and others attacked the house of the complainant on May 5 this year due to alleged politi- cal rivalry. It was further alleged that the victim (complainant’s hus- band) who tried to intervene with the miscreants, was attacked. The victim was rushed to the May 6, he suc- cumbed to injuries. The CBI is taking over cases of post-poll violence in West Bengal in compliance with the orders of Calcutta High Court passed in connec- tion with a clutch of writ peti- tions. The HC had passed the orders on August 19 and took over the investigation of these cases earlier registered at dif- ferent police stations of West Bengal on various allegations. CBI has so far registered 40 cases and Investigation is con- tinuing in these cases. %,ILOHVWZRPRUH ),5VLQ%HQJDO SRVWSROOYLROHQFH 8UPWXVW]dQTa ^U_^bXcXeT2^eXS (aTbd[cbPaT U^d]ScWT _[P]]TS[XUcX]V^U cWTU[XVWcQP]^] BT_cTQTa! fX[[QT aTR^]bXSTaTS :RUNWRJHWKHUWRVXJJHVWFRQYLFWV¶EDLO SOHDV6WR83*RYW$OODKDEDG+ ?=BQ =4F34;78 Children with Down’s syn- drome have a lower chance of survival from acute lymphoblastic leukemia (ALL), a particular high-risk form of blood cancer, than children without the disabil- ity, new research published in Lancet Haematology has said. In other words, children at higher risk of their cancer coming back usually receive more intensive treatment. But that’s not possible for children with Down, as they tend to have more side effects from treatment. The syndrome is a genetic disorder – but the possible effect of DNA changes in leukemia cells in Down’s Syndrome was still unknown. In a new study, scientists from the Princess Máxima Center and the Erasmus Medical Center compared the effect of therapy in leukemia patients with and without Down’s Syndrome . The international study, involving researchers from the United Kingdom, Germany, Scandinavia and Australia, was In the Netherlands, the study was funded by the Princess Máxima Center Foundation and the Children’s Oncological Center Rotterdam Foundation. To account for differences in known risk factors, data from 136 leukemia patients with Down’s Syndrome were matched with those from 407 children who did not have Down’s Syndrome . The matched ‘duos’ had the same age, ALL subtype, and blood results at diagnosis. That’s how the researchers knew that any differences that remained were linked to Down’s Syndrome . Their analysis showed that the levels of leukemia cells decreased equally well in both groups of children after the first month of treatment. But the scientists discovered an important dif- ference in longer-term out- come between children with and without Down’s Syndrome in the so-called Ikaros form of ALL. A DNA error in the Ikaros gene leads to a more aggressive form of the disease in all children with leukemia. But children who also had Down’s Syndrome had an even worse outcome than children without the disabil- ity, the researchers found. Naomi Michels, PhD stu- dent in the Den Boer group, also part of the Oncode Institute, was involved in the study. ‘The Ikaros gene main- ly increases the risk of cancer coming back,’ she said. ‘Children with Down’s Syndrome and Ikaros ALL were more likely to see their leukemia return within five years of treatment.’ This was the case in 37 per cent of these children, compared with 13 per cent of Ikaros ALL patients who did not have Down syndrome. In other types of ALL, there was no notable difference between children with and without Down syndrome. The researchers believe the difference has to do with an interaction between the genetic changes in Down’s Syndrome and the Ikaros gene. Michels: ‘We need to continue the search for treat- ments with fewer side effects – such as targeted therapies and forms of immunotherapy – in order to be able to bet- ter treat children with Down syndrome who have this high- risk form of ALL.’ 2WX[SaT]fXcW3^f]´bBh]Sa^TWPeT [^fTaRWP]RT^UbdaeXeP[Ua^0;;)BcdSh 80=BQ =4F34;78 The Co-founder and Joint Managing Director of Hyderabad-based Bharat Biotech, Suchitra Ella has said that vaccines should not be a barrier to enter into any nation. Amid the ongoing row over new UK travel restrictions that consider fully Indian vac- cinated as unvaccinated and prescribes 10-day quarantine, she said, Vaccines must not be entry barriers for nations. Underlining that India has supplied billions of doses of Covid-19 vaccine the world over, Suchitra Ella tweeted, Our vaccines will prove yet again that they are world class. According to the new UK rules, Indian travellers who have received both doses of the Covishield vaccine manufac- tured by the Serum Institute of India (SII) will be considered unvaccinated and will have to undergo self-isolation for 10 days, though the UK has revised its travel policy to include Covishield as an approved vac- cine after India raised strong objections. Bharat Biotech Co-founder tweeted, Our vaccines will prove yet again, are world class. India has supplied billions of doses world over. Covid-19 taught us enough life lessons, vaccines must not be entry bar- riers for nations, when NRA approved licensed, crossed 800 mn doses, no small achieve- ment. India's mass vaccination program is being run with mainly two vaccines Covishield and Covaxin. Hyderabad-based Bharat Biotech has developed Covaxin in collaboration with the Indian Council of Medical Research. Covishield has been developed by researchers at the University of Oxford and pharma giant AstraZeneca. However, the WHO chief scientist Dr Saumya Swaminathan has said that all countries are supposed to follow the WHO recommendations. EPRRX]Tdbc]^c QTT]cahQPaaXTaU^a ]PcX^]b)1WPaPc 1X^cTRW2^5^d]STa 80=BQ =4F34;78 President Ram Nath Kovind reiterated on Wednesday that India has been at the fore- front of the global efforts to forge a decisive and coordinat- ed response to the Covid-19 pandemic to ensure collective healthand economic well-being. Kovind also stated that under the world’s largest vacci- nation campaign, Indians have received more than 800 million doses so far. The President was speaking after accepting the credentials from Ambassadors/High Commissioners of Iceland, Gambia, Spain, Brunei Darussalam and Sri Lanka in a virtual ceremony, a commu- nique from the Rashtrapati Bhavan said. Kovind added that India’s engagement in the United Nations and other multilateral fora has resulted in mutually beneficial partnerships. “India remains committed to a just and equitable global order, keeping in mind the interests of the developing coun- tries and the under-represent- ed,” he said. 8]SXPPcU^aTUa^]c^U V[^QP[aTb_^]bTc^ 2^eXSRaXbXb)?aTi
  • 5. ]PcX^]$ 347A03D=kC7DAB30H kB4?C414A!!! C;:8C20B4)B29D=:B ?;40B52´60A76EC =Tf3T[WX)CWTBd_aTT2^dac ^]FTS]TbSPhaTUdbTSc^ T]cTacPX]cf^bT_PaPcTP__TP[b^U cWT2WWPccXbVPaW6^eTa]T]c PVPX]bc^aSTab^UcWT7XVW2^dac VaP]cX]VPbcPh^]X]eTbcXVPcX^]X] P]58AaTVXbcTaTSPVPX]bcbT]X^a 19?[TPSTaP]SU^aTa2WXTU X]XbcTaAPP]BX]VWP]ScWT _Pachb_^ZTbP]BPQXc?PcaP U^acWTXacfTTcbX]R^]]TRcX^]fXcW cWTP[[TVTSUPZTc^^[ZXcRPbT 6EC?A24BB70BC01834 1H2DAC38A42C8=B)B2 =Tf3T[WX)CWT6^eTa]T]c _a^RTbbWPbc^PQXSTQhR^dac SXaTRcX^]bcWTBd_aTT2^dac bPXS^]FTS]TbSPhfWX[T_d[[X]V d_:TaP[PPdcW^aXcXTbU^a]^c STRXSX]VcWT_a^_^bP[_TacPX]X]V c^_aTPcdaTaT[TPbT^Ucf^ R^]eXRcbfW^PaTbTaeX]V[XUTcTa P]SWPeTQTT]X]YPX[U^a!'hTPab X]R[dSX]VaTXbbX^] B210B44:B0D384=24 5A2988=10A8BBD4 =Tf3T[WX)CWTBd_aTT2^dac 1Pa0bb^RXPcX^]B210WPb faXccT]c^2WXTU9dbcXRT^U8]SXP 298=EAPP]PdaVX]VcWPcP] PdSXT]RTQTVXeT]c^Xcb4gTRdcXeT 2^XccTTTQTabc^SXbRdbb XbbdTbbdRWPbT[TePcX^]^UP_Tg R^dac[PfhTabPb7XVW2^dac YdSVTbcWTXaSTbXV]PcX^]Pb bT]X^abP]SP[[^cT]c^U RWPQTabX]cWT_aTXbTbWTaT DB86=43C8?AE4 ;8E4BC2:B42CA =Tf3T[WX)CWT3T_PacT]c^U 0]XP[7dbQP]SahP]S3PXahX]V 3073P]S1X[[T[X]SP6PcTb 5^d]SPcX^]WPeTbXV]TSPd[cX hTPa^Dc^f^aZc^VTcWTa^] bdbcPX]PQ[hX_a^eX]V8]SXP³b [XeTbc^RZbTRc^ac^bd__^accWT ]PcX^]³bU^^SP]S]dcaXcX^]P[ bTRdaXchP]S_a^cTRccWT TR^]^XRfT[[QTX]V^U bP[[bRP[T[XeTbc^RZ_a^SdRTab 8=B7AC B0D60AB4=6D?C0Q :;:0C0 Bengal Chief Minister Mamata Banerjee once again invoked the “Khela” (game) slogan while addressing an audience in the Bhawanipore Assembly by- elections. Attacking the BJP she said “khelbo, lorbo, BJP ke harabo … Bharat theke tariya charbo (we will play, fight and defeat the BJP and banish it from India),” the Chief Minister said attacking the Centre and the other saffron Governments of the country including the one running in Tripura. The Chief Minister who was defeated from Nandgram seat is seeking election from Bhawanipore her home con- stituency from where she won in 2011 and 2016 before leav- ing this seat for Nandigram in 2021. Bhawanipore was earlier vacated by sitting MLA Sobhandeb Chattopadhyay to let Banerjee contest from this seat.The TMC had trailed to the BJP from this Assembly segment in 2019 parliamentary elections. Hitting the BJP with its own weapon Banerjee ques- tioned the BJP’s Government’s clamping of restrictive orders in Tripura apparently to stop YMC national general secretary Abhishek Banerjee from orga- nizing rallies in that State. Referring to the oft repeat- ed allegations by saffron lead- ers that “Mamata Banerjee Government does not allow Durga Pujas, Laxmi Pujas in Bengal … but now they have imposed Section 144 in Tripura till November 4 … now I am asking how will Durga Pujas, Laxmi Pujas or even the Kali Puja will take place in Tripura … so Are you not stopping the Pujas in that State.” Aware that her “outsider” plank had yielded results dur- ing the April-May Assembly elections Banerjee once again raised the issue saying “the BJP is once again bringing outsiders to Bhawanipore to defeat me ... but I am the daughter of this area … the people will never jettison me … the BJP had brought all kinds of people from all over the country but all of them were discarded by the voters … again the outsiders who are coming to Bengal will get a befitting reply.” Listing her exploits the Chief Minister said how her Government had dug 3.5 lakh ponds all over the state to har- vest rain water and how she has been working round the clock to introduce the people-friend- ly policies like “Swasthya Saathi (health insurance for all), Sabuj Saathi (free cycles to school stu- dents), C10 lakh worth Students’ Credit Cards, Kanyashree (scheme for girl students,” Banerjee said the Centre was allowing the two ports of Bengal to lapse into non-use. “But we are constructing a third port at Tajpur near Digha,” she said adding if she is allowed to remain the Chief Minister more developments will follow. “If I am defeated Someone else will be the Chief Minister but that is not all … my question is I want to per- form … I want to work for you and so I have come once again to you,” she said. HV¶]]a]RjWZXYe`fde3;A+ 5ZUZ B0D60AB4=6D?C0Q :;:0C0 Alleged post-poll violence claimed yet another victim when the BJP’s candidate for the Magrahat West Assembly seat Dhurjati Saha succumbed to his injuries on Wednesday. The saffron outfit imme- diately said that it will petition the National Human Rights Commission seeking inter- vention and demanded that the ongoing court-monitored CBI investigation into the post- election violation be extended to cover the Wednesday’s inci- dent. Saha was attacked on the counting day as the election results started pouring in. “He was trailing during the count- ing and when he came out of the counting station Trinamool Congress goons led by local TMC MLA Ghyasuddin Molla attacked him giving him head injuries … the next day he was hospitalized ... and finally he succumbed to his injuries today,” Saha’s family members alleged demanding CBI inves- tigation into the case. BJP MP Arjun Singh who visited the hospital too said, “he was beaten up by the hench- men of local TMC MLA after counting trends showed he (Saha) was trailing. He had to be admitted to the hospital the next day… we are bringing it to the notice of the NHRC and will demand a CBI investiga- tion.” After leaving incommuni- cado for the most part of the day Molla later told in the evening that he had nothing to do with the incident. New Bengal BJP president Dr Sukanto Majumdar said “this is the instance of a demo- cratic government being run by Mamata Banerjee … where even as candidate is not spared … the TMC goons promoted by the State Government has killed Dhurjati Saha who was a dedicated and honest party man … this the blackest day in the Bengal’s politics.” The death of Saha takes place amid ongoing CBI inves- tigation into the post-poll vio- lence in Bengal. A five-member bench of the Calcutta High Court acting upon a recommendation of the NHRC had earlier ordered a court-monitored CBI inves- tigation into the incidents of violence. The death of the BJP can- didate comes at a time when a petition --- seeking quashing of the High Court order --- filed by the State Government is pending before the Supreme Court. In the petition the State has claimed that it had acted on 58 percent of the reported cases of violence. Besides it has also said that most of the violence took place during when the Election Commission was at the helm and not the TMC Government. On whether the Wednesday’s incident could have any impact on the Apex Court decision a set of lawyers said “we cannot say that it won’t … the Supreme Court will take into account everything legal and factual.” %-3FDQGLGDWHLQMXUHGLQ SRVWSROOYLROHQFHGLHV 78C:0=370A8Q 90D The Jammu Kashmir administration headed by Lt-Gov Manoj Sinha on Wednesday issued orders of dismissal of six more employ- ees, three each from Kashmir and Jammu divisions for hav- ing terror links and working as Over Ground Workers (OGW). At least eleven (11) employees including two sons of Hizbul Mujahideen founder Syed Salahuddin were also dis- missed from their services by the UT administration on July 10, 2021. According to official sources, two police constables, two school teachers, a range officer in the Forest department and a junior assistant in the Public Works Department were dismissed from their services after a designated committee recommended their cases under Article 311(2)(c) of the Constitution. The dismissal orders were issued by the Commissioner/Secretary to the General Administration department on Wednesday. According to these orders, two police constables identified as Showkat Ahmad Khan hail- ing from Budgam and Jaffer Hussain Butt from Kishtwar were dismissed from their ser- vices with immediate effect. According to police records, Jaffer Hussain Butt was arrested by the police and chargesheeted by the National Investigation Agency (NIA) in a case on gun-running while khan is alleged to have been involved in looting of weapons from an MLC’s house. He was posted as a PSO with a Legislative Council member. He was detained under the PSA in 2019. According to police, Jaffer, currently on bail,is alleged to have provided his car to Hizbul Mujahideen terrorists and facilitated their safe move- ment, a fact which is explained in the NIA chargesheet. Another Government employee Abdul Hamid Wani, a resident of Bijbehara in Anantnag, who was working as a teacher had a history of working as a district comman- der of the now-defunct terror- ist outfit, Allah Tigers. He managed his employment without any selection process. Banned Jamaat-e-Islami (JeI) cadre had played a key role in inducting him in the govern- ment services. As per police records Wani was among the key speakers and organisers during the 2016 agitations fol- lowing the death of Burhan Wani, the poster boy of banned terror group Hizbul Mujahideen. According to official sources, Junior assistant Mohd Rafi Butt, also a resident of Kishtwar and posted in the Road and Building Department, was sacked for providing logistical support to Hizbul Mujahideen terrorists in Kishtwar and for providing them a safe environment to execute terror plans. His name also figures in an FIR registered by the NIA. He was arrested and is at present on bail. Liyaqat Ali Kakroo, a res- ident of Baramulla in North Kashmir and a teacher by pro- fession since 1983, was arrest- ed in 2001 which “revealed that he was a locally trained terror- ist”. An explosive substance was recovered from his pos- session and he was booked under the Public Safety Act (PSA) for two years in 2002. He was subsequently acquitted by the court in both cases. Tariq Mehmood Kohli, a resident of Poonch and posted as a range officer in the Forest Department, was also sacked for allegedly being involved in smuggling of illegal arms, ammunition, explosives, including hard drugs and Fake Indian Currency Notes (FICN) from Pakistan, the officials said. He is alleged to have remained in touch with active militants and is recorded as an OGW in police records. %9:6^ecT_[^hTTbbPRZTSU^acTaa^a[X]Zb Tca^f^aZTabRT[TQaPcTPUcTaCd]]T[1^aX]VPRWX]T³DA90´Qa^ZTcWa^dVWPccWTBWXePYX]PVPaBcPcX^]Ua^1P]VP[^aT2P]c^]T]cBcPcX^]X]1T]VP[dad^]FTS]TbSPh ?C8 TQTab^UcWTCaPSTab´5TSTaPcX^]bcPVTP_a^cTbcSdaX]VcWT9Pd1P]SWbcXaPVPX]bccWT^_T]X]V^U]TfbW^fa^^bP]S aTcPX[TabW^_b^UAT[XP]RTPacX]9Pd^]FTS]TbSPh ?C8 ?C8Q :I78:34:4A Various Muslim organisations on Wednesday urged Catholic Bishop Joseph Kallarangatt to withdraw his con- troversial love and narcotic jehad state- ment, saying no religious leaders should make such immature remarks. Their meeting held here to discuss the issue also said that the Bishop of Pala, through the statement, was aiming at the Muslim community. Addressing the media after the meet- ing, Indian Union Muslim League leader Panakkad Sadiq Ali Shihab Thangal, who chaired the session, said no religious leader should make such immature state- ments or comments. Such remarks would not help main- tain communal harmony and strengthen the secular credentials of the state, Thangal said and urged the Government to strongly and effectively intervene in the issue. He said the leaders of Muslim com- munity did not make any immature response to the Bishop's statement. Thirteen Muslim religious organisa- tions attended the meeting. Veteran IUML leader and Lok Sabha MP E T Muhammed Basheer said he sup- ports the demand of various political par- ties to convene an all-party meeting to dis- cuss the issue. In the wake of the Bishop's contro- versial love and narcotic jihad remarks a few days ago, leaders of various religions met at Thiruvananthapuram on Monday last and called for steps to strengthen the secular fabric of Kerala society. Thrissur: India's first-ever mosque and the oldest in the sub-continent is all set to wel- come back devotees and gen- eral public after regaining its past glory and grandeur. The classic beauty and humble style of the Cheraman Juma Masjid, dating back to 629 AD, was restored after a painstaking renovation and conservation process spread over nearly 30 months under the state-run Muziris Heritage Project (MHP). Located at Kodungallur taluk in this cen- tral Kerala district, the heritage structure was recreated in tune with its original character and aesthetics, at a cost of C1.14 crore, P M Noushad, Managing Director of MHP, said. Besides the renovation and conservation initiative, which started in May 2019, a two-storey Islamic Heritage Museum was also constructed in the mosque campus spend- ing nearly Rs one crore and its internal refurbishment is going on now, he noted. After sub- mitting the letter of completion to the government, the MHP authorities are now awaiting Chief Minister Pinarayi Vijayan's date to reopen the oldest mosque for visitors. It is expected to happen any day.. We are waiting for a convenient day of the Chief Minister for the inaugural function. If the Covid-19 situation is com- pletely under control, it may happen within the next two week, Noushad said. PTI 8]SXPb^[STbc ^b`dTbTcc^ aT^_T]PUcTa aT]^ePcX^] db[X^aVP]XbPcX^]bPbZ 2PcW^[XR1XbW^_c^fXcWSaPf WXb²]PaR^cXRYTWPS³aTPaZ ?C8Q ?0C=0 Rashtriya Janata Dal presi- dent Lalu Prasad on Wednesday reiterated the demand for a caste census and favoured “breaking” the 50 per cent ceiling on reservations if the population of SCs, STs and OBCs was found to be more than half of the total. Prasad, who has been con- valescing in Delhi after his release from jail earlier this year, made the remarks while addressing a training camp of his party workers organised here to which he got connect- ed online. “I was the first one to raise the demand for caste census. I had made the demand on the floor of the Parliament,” said the multiple-term former MP and the railway minister in the UPA-1 Government. The former Bihar Chief Minister, who has ended up spending a long time behind bars following his conviction in fodder scam cases, said “my demand is for the welfare of all, SCs and STs included. Quotas have been decided taking into account a census conducted before Independence. We must have a fresh estimate of the population of different social segments”. “The existing quotas have been insufficient. And even these are rarely filled, resulting in huge backlogs. Let there be a fresh caste census and all get quotas in proportion to their population. If it needs breaking of the 50 per cent barrier, so be it,” said Prasad, who owes his rise in politics to the Mandal churn of the 1990s. Prasad's younger son and heir apparent Tejashwi Yadav, who is the leader of the oppo- sition in state assembly, had recently met Prime Minister Narendra Modi to broach the issue of caste census as part of a delegation headed by Chief Minister Nitish Kumar – an arch rival of the RJD supremo. The Centre's contention that only enumeration of SCs and STs was proposed has trig- gered demands that the same be done for OBCs as well. A cap of 50 per cent on quotas has been fixed by an order of the Supreme Court. Prasad, who is in his late 70s and suffers from multiple ailments, spoke for less than 30 minutes and the audience were left pining for his wit and repartee that had made him a legend in his heydays. He, nonetheless, sought to assure his foot soldiers that his health was improving and he will soon be in Bihar, touring all districts to energise the rank and file. DVWHFHQVXVDPXVWOHW FDSEHEURNHQLIUHTXLUHG/DOX Lucknow: Samajwadi Party chief Akhilesh Yadav on Wednesday accused the Yogi Adityanath Government of usurping the credit of his developmental work in Uttar Pradesh and failing to even read the BJP manifesto, forget about keeping its poll promises. In a statement, he also charged the saffron party Government with weak- ening the democracy of the country by “sustained attack on various institu- tions”. “The BJP has no shame (laaz) that it did not read even a single page of its 'sankalp patra' of 2017 Assembly elec- tions and failed to implement any of the promises,” Yadav said, adding ahead of the assembly polls, they have now begun beating their own trum- pet through advertisements. This attitude of breaking promis- es (wadakhilaphi) is a form of cor- ruption. Spending State resources without doing any work of public interest is betrayal with the people, he said. The SP president alleged that the saffron party would try to “manipu- late” voting at the booth level during the elections early next year and asked party workers to be cautious of it. Arrears of sugarcane growers ride in electricity rates, problems of weavers and unemployed youths, atrocity against women and rising crime graph are the hallmarks of the BJP rule in UP, he said. Yadav also attacked the Union Government accusing it of weakening the country's economy by demoneti- sation and enforcing GST. The Government which weaved a dream of five trillion economy is con- spiring to confuse people with the help of advertisements, he said. 2:@XQcdQ[U^SbUTYd V_b_ebg_b[Y^E@* 1[XYUcXIQTQf Jaipur: In his first Cabinet meeting after undergoing angioplasty last month, Rajasthan Chief Minister Ashok Gehlot Wednesday reviewed his administra- tion's public outreach programme which is slated to be launched on October 2. The Prashashan Sharon ke Sang and Prashasan Gaon ke Sang (the administration with cities and vil- lages) focuses on works like lease allotment and a min- ister Wednesday said various relaxations will be given to people during the campaign. It was Gehlot's first Cabinet meeting after he recovered to good health fol- lowing his angioplasty at the SMS Government hos- pital here last month. After the Cabinet meeting, Transport Minister Pratap Singh Khachariyawas told reporters that the preparations for the scheme were reviewed and the Chief Minister instructed the min- isters to visit districts during the campaign. The Rajasthan Government is focusing on the development of the State and welfare of people. For this, Prashasan Sharon ke Sang and Prashasan Gaon ke Sang campaign will be launched from October 2 across the State for works like lease allotment etc, he said. PTI *HKORWFKDLUVILUVW DELQHWPHHW DIWHUDQJLRSODVW ATeXTfbb^^]c^QT[Pd]RWTSfT[UPaTbRWTT Bengaluru: Karnataka logged 847 new Covid-19 cases and 20 deaths on Wednesday, taking the total number of infections to 29,70,208 and the toll to 37,668. The day also saw 946 discharges, tak- ing the total number of recoveries in the State so far to 29,18,890. Out of 847 new cases reported on Wednesday, 312 were from Bengaluru Urban, as the city saw 219 discharges and six deaths. The total number of active cases in the state is at 13,621 While the positivity rate for the day stood at 0.57 per cent, the Case Fatality Rate (CFR) was 2.36 per cent, a health department bulletin said. Coming behind Bengaluru Urban in number of deaths was Dakshina Kannada (5) and Udupi (2), followed by others. Among new cases, Dakshina Kannada accounted for 108, Mysuru 74, Shivamogga 52, Udupi 48, Hassan 46, followed by oth- ers. PTI '#]Tf2^eXS RPbTb!STPcWb X]:Pa]PcPZP