cell-Free Systems.pdf
•
0 likes•60 views
Cell-free protein expression systems allow for the production of proteins without living cells. The gene encoding the poly(ethylene terephthalate) hydrolase protein from Ideonella sakaiensis was identified, and its amino acid sequence is available in a database. This protein shows promise for metabolizing PET plastic. A plasmid was designed to allow for expression of this protein using a cell-free expression system called myTXTL from Arbor Biosciences. MyTXTL uses freeze-dried reagents for convenient storage and transport of the system, and is stable for protein expression for up to 12 months.
Report
Share
Report
Share
Download to read offline
Recommended
Recombinant protein expression and purification Lecture
The document discusses recombinant protein expression and engineering. It describes:
1) Cloning or synthesizing the gene of interest, making an expression construct, transfecting cells, purifying the recombinant protein.
2) Factors to consider like the protein's origin (prokaryotic/eukaryotic), required post-translational modifications, and available expression systems.
3) A case study expressing recombinant human alpha-1-acid glycoprotein in E. coli, including vector construction, periplasmic extraction, affinity purification, and yield.
Long Acting Injectables - A New Dimension for Proteins and Peptides
This webinar discusses long-acting injectable microparticle formulations using SynBiosys® technology for sustained release of proteins and peptides. Case studies are presented on the sustained release of exenatide, a sensitive peptide, and a monoclonal antibody from biodegradable microparticles. Both proteins showed intact structure and biological activity for over a month in vitro and in animal studies, demonstrating the potential of this platform for long-term drug delivery of biologics.
Long Acting Injectables - A New Dimension for Proteins and Peptides
Access the recording: https://bit.ly/2xAaMba
Abstract:
Long acting injectables (LAI) have been around for decades for the delivery of small molecules and peptides to treat chronic and site-specific diseases. However, when it comes to more sensitive biological therapeutics the classical polylactide and polylactide/glycolide based systems suffer from several limitations (e.g. uncontrolled release kinetics, in situ pH drop, protein degradation) making them unsuitable. The SynBiosys® biodegradable polymeric microparticle technology combines all the features required for LAI formulations for biologics. In two case studies we will showcase sustained release formulations for peptides and proteins and demonstrate their potential via extensive in vitro and in vivo characterization.
Bl oreactors
1. The document describes using transgenic livestock animals as bioreactors for producing pharmaceutical proteins in their milk.
2. Specifically, it details an experiment where researchers created transgenic sheep that produced the human protein alpha-1-antitrypsin (AAT) in their milk by fusing the AAT gene to the regulatory sequences of the ovine beta-lactoglobulin gene.
3. The transgenic sheep were able to stably pass the transgene to offspring and produced over 1g of fully active, glycosylated human AAT per liter of milk.
Bl oreactors
1. The document describes using transgenic livestock animals as bioreactors for producing pharmaceutical proteins in their milk.
2. Specifically, it details an experiment where researchers created transgenic sheep that produced the human protein alpha-1-antitrypsin (AAT) in their milk by fusing the AAT gene to the regulatory sequences of the ovine beta-lactoglobulin gene.
3. The transgenic sheep were able to stably pass the transgene to offspring and produced over 1g of fully active, glycosylated human AAT per liter of milk.
CRYOPRESERVATION.pptx
This study investigated the effects of vitrification on morphology and mRNA expression of apoptotic genes in sheep immature cumulus oocyte complexes. Immature oocytes were collected from sheep ovaries and divided into groups for cryopreservation using different cryoprotectants. The oocytes were evaluated for morphology before and after vitrification and thawing. Real-time PCR was used to analyze expression of apoptotic genes BAD, BAK, BAX, BID, BOK, BCL2A1, BCL2, MCL1 in fresh and vitrified oocytes. Results showed varying recovery and damage rates among oocytes cryopreserved with different cryoprotectants. Morphological changes included cracked or split zona pell
CRYOPRESERVATION.pptx
This study investigated the effects of vitrification on morphology and mRNA expression of apoptotic genes in sheep immature cumulus oocyte complexes. Immature oocytes were collected from sheep ovaries and divided into groups for cryopreservation using different cryoprotectants. The oocytes were evaluated for morphology before and after vitrification and thawing. Real-time PCR was used to analyze expression of apoptotic genes BAD, BAK, BAX, BID, BOK, BCL2A1, BCL2, MCL1 in fresh and vitrified oocytes. Results showed varying recovery and damage rates among oocytes cryopreserved with different cryoprotectants. Morphological changes included cracked or split zona pell
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Analytical technique for identifying unknown protein. The peptide mass are compared to database containing the theoretical peptide masses of all known protein sequences.
Recommended
Recombinant protein expression and purification Lecture
The document discusses recombinant protein expression and engineering. It describes:
1) Cloning or synthesizing the gene of interest, making an expression construct, transfecting cells, purifying the recombinant protein.
2) Factors to consider like the protein's origin (prokaryotic/eukaryotic), required post-translational modifications, and available expression systems.
3) A case study expressing recombinant human alpha-1-acid glycoprotein in E. coli, including vector construction, periplasmic extraction, affinity purification, and yield.
Long Acting Injectables - A New Dimension for Proteins and Peptides
This webinar discusses long-acting injectable microparticle formulations using SynBiosys® technology for sustained release of proteins and peptides. Case studies are presented on the sustained release of exenatide, a sensitive peptide, and a monoclonal antibody from biodegradable microparticles. Both proteins showed intact structure and biological activity for over a month in vitro and in animal studies, demonstrating the potential of this platform for long-term drug delivery of biologics.
Long Acting Injectables - A New Dimension for Proteins and Peptides
Access the recording: https://bit.ly/2xAaMba
Abstract:
Long acting injectables (LAI) have been around for decades for the delivery of small molecules and peptides to treat chronic and site-specific diseases. However, when it comes to more sensitive biological therapeutics the classical polylactide and polylactide/glycolide based systems suffer from several limitations (e.g. uncontrolled release kinetics, in situ pH drop, protein degradation) making them unsuitable. The SynBiosys® biodegradable polymeric microparticle technology combines all the features required for LAI formulations for biologics. In two case studies we will showcase sustained release formulations for peptides and proteins and demonstrate their potential via extensive in vitro and in vivo characterization.
Bl oreactors
1. The document describes using transgenic livestock animals as bioreactors for producing pharmaceutical proteins in their milk.
2. Specifically, it details an experiment where researchers created transgenic sheep that produced the human protein alpha-1-antitrypsin (AAT) in their milk by fusing the AAT gene to the regulatory sequences of the ovine beta-lactoglobulin gene.
3. The transgenic sheep were able to stably pass the transgene to offspring and produced over 1g of fully active, glycosylated human AAT per liter of milk.
Bl oreactors
1. The document describes using transgenic livestock animals as bioreactors for producing pharmaceutical proteins in their milk.
2. Specifically, it details an experiment where researchers created transgenic sheep that produced the human protein alpha-1-antitrypsin (AAT) in their milk by fusing the AAT gene to the regulatory sequences of the ovine beta-lactoglobulin gene.
3. The transgenic sheep were able to stably pass the transgene to offspring and produced over 1g of fully active, glycosylated human AAT per liter of milk.
CRYOPRESERVATION.pptx
This study investigated the effects of vitrification on morphology and mRNA expression of apoptotic genes in sheep immature cumulus oocyte complexes. Immature oocytes were collected from sheep ovaries and divided into groups for cryopreservation using different cryoprotectants. The oocytes were evaluated for morphology before and after vitrification and thawing. Real-time PCR was used to analyze expression of apoptotic genes BAD, BAK, BAX, BID, BOK, BCL2A1, BCL2, MCL1 in fresh and vitrified oocytes. Results showed varying recovery and damage rates among oocytes cryopreserved with different cryoprotectants. Morphological changes included cracked or split zona pell
CRYOPRESERVATION.pptx
This study investigated the effects of vitrification on morphology and mRNA expression of apoptotic genes in sheep immature cumulus oocyte complexes. Immature oocytes were collected from sheep ovaries and divided into groups for cryopreservation using different cryoprotectants. The oocytes were evaluated for morphology before and after vitrification and thawing. Real-time PCR was used to analyze expression of apoptotic genes BAD, BAK, BAX, BID, BOK, BCL2A1, BCL2, MCL1 in fresh and vitrified oocytes. Results showed varying recovery and damage rates among oocytes cryopreserved with different cryoprotectants. Morphological changes included cracked or split zona pell
Peptide Mass Fingerprinting (PMF) and Isotope Coded Affinity Tags (ICAT)
Analytical technique for identifying unknown protein. The peptide mass are compared to database containing the theoretical peptide masses of all known protein sequences.
Curr Protoc Mol Biol Chen C 2010
This document describes a method for determining the phosphorylation motifs of protein kinases using an arrayed combinatorial peptide library. The procedure involves screening 198 biotinylated peptide substrates in the presence of radiolabeled ATP. The peptides are captured on a streptavidin membrane after phosphorylation, and the membrane is exposed to detect incorporation of radiolabel into each peptide, revealing the kinase's phosphorylation motif. The document provides details on expressing and purifying active kinases, optimizing reaction conditions, performing the peptide array screen in 384-well or 1536-well plates, and analyzing the results to determine the kinase's consensus phosphorylation sequence.
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial
infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian
host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression
vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a
way to get native tPA protein sequence in subsequent purification steps. Further, construct pICZαA-tPA
was developed and electroporated into host to achieve stablert-PA gene by achieving genome integration.
The transformants were screened for phenotypic characters.Mut+
phenotypic colony named Pichia tPA-3
showed expression of rt-PA at 66 kDa on SDS PAGE. Size Exclusion Chromatography (SEC) was
performed, resulting in product peak at same RT as reference standard. (alteplase).Cloning and expression
of rt-PA was successfully achieved in microbial system. Further process optimization at larger scales will
surely provide cost effective alternative to mammalian system forrt-PA production.
CLONING AND EXTRACELLULAR EXPRESSION OF RECOMBINANT TISSUE PLASMINOGEN ACTIVA...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a way to get native tPA protein sequence in subsequent purification steps
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial
infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian
host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression
vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a
way to get native tPA protein sequence in subsequent purification steps. Further, construct pICZαA-tPA
was developed and electroporated into host to achieve stablert-PA gene by achieving genome integration. The transformants were screened for phenotypic characters.Mut+
phenotypic colony named Pichia tPA-3
showed expression of rt-PA at 66 kDa on SDS PAGE. Size Exclusion Chromatography (SEC) was
performed, resulting in product peak at same RT as reference standard. (alteplase).Cloning and expression
of rt-PA was successfully achieved in microbial system. Further process optimization at larger scales will surely provide cost effective alternative to mammalian system forrt-PA production
Cloning and extracellular expression of recombinant tissue plasminogen activa...
This document summarizes research conducted to clone and express recombinant tissue plasminogen activator (rt-PA) using the methylotrophic yeast Pichia pastoris. Specifically, the tissue plasminogen activator gene was cloned into the pICZαA expression vector. This construct was then transformed into Pichia pastoris X33 cells. One transformant, named Pichia tPA-3, showed expression of rt-PA at 66 kDa on SDS-PAGE. Size exclusion chromatography also showed a product peak at the same retention time as a reference tPA standard. Thus, the researchers were able to successfully clone and express rt-PA in the Pichia pastoris system.
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
This document summarizes research conducted to clone and express recombinant tissue plasminogen activator (rt-PA) using the methylotrophic yeast Pichia pastoris. Specifically, the full-length tPA gene was amplified by PCR and cloned into the pICZαA expression vector. This construct was then transformed into Pichia pastoris X33 cells. One transformant, named Pichia tPA-3, showed extracellular expression of rt-PA at 66 kDa on SDS-PAGE after induction with methanol over 144 hours. Size exclusion chromatography of samples from this transformant showed a product peak at the same retention time as a reference tPA standard. Thus, the researchers successfully achieved cloning and extracellular expression of
New technology and workflow for integrated collection, stabilization and puri...
Research into non-invasive prenatal testing (NIPT) and circulating tumor DNA (ctDNA) testing based on circulating cell-free DNA (ccfDNA) is rapidly expanding. However, detection and quantification of ccfDNA is compromised by the release of genomic DNA (gDNA) from lymphocytes due to mechanical lysis or apoptosis during blood collection, storage and transport. PreAnalytiX has developed the PAXgene Blood ccfDNA System, consisting of the PAXgene Blood ccfDNA Tube, a plastic blood collection tube with a unique, non-crosslinking chemistry that preserves extracellular levels of ccfDNA and prevents the release of intracellular DNA from cells into the plasma, and the QIAsymphonyPAXgene Blood ccfDNA Kit for automated ccfDNA extraction from up to 5 ml of plasma. In this slidedeck, this new technology development is presented in comparison to other existing technologies.
CINF 1: Generating Canonical Identifiers For (Glycoproteins And Other Chemica...
Bioinformatics dogma asserts that all-atom representations, capable of encoding details such as disulfide bridging and post-translationally modified amino acids, are too unwieldy to be of practical use. In this presentation, we show how recent advances in computer power, software algorithms and storage technology require us to question this precept. We show how InChI, InChI keys and canonical SMILES can be generated for the largest known proteins, and even for nucleic acid sequences as large as viral and prokaryotic genomes. Indeed, unique identifiers derived from all-atom nucleic acid representations, allow the capture of epigenetic methylation information and circular DNA; feats that are impossible with the one-letter codes used by bioinformaticians. These unique identifiers allow the linking of mature antibodies to the unique identifiers of the plasmids used to express them. Finally, we discuss the possibility of polymer-specific implementations/optimizations of standard InChI, by showing how InChIs and InChI keys may be generated efficiently for specific classes of polymer with over a million atoms.
Ghyslaine ppt
The document summarizes research detecting DNA regions associated with milk protein composition in dairy cattle. The study identified regions on chromosomes 6 and 11 that influence casein and beta-lactoglobulin levels. The chromosome 6 region affected all four casein fractions and explained some genetic variants in casein genes. The chromosome 11 region influenced beta-lactoglobulin levels and explained variants of the beta-lactoglobulin gene. Identifying these DNA regions provides opportunities to use genetic selection to improve milk quality and composition for cheese and other dairy products.
culture cellular
This document provides an overview of microcarrier cell culture principles and methods. Microcarriers allow for increased surface area for cell attachment and growth compared to traditional cell culture methods. They enable higher cell densities and product yields by separating cells from culture medium, improving process control and scalability. Various microcarrier types made from different materials are available for culturing different cell types like mammalian, insect and plant cells. Microcarriers are used to produce vaccines, proteins, antibodies and more in small-scale equipment like spinners and roller bottles as well as large-scale bioreactors like stirred tanks, packed beds and fluidized beds. Careful selection of microcarrier properties, culture conditions and control strategies are required to optimize microcarrier cell culture
Catalog obesity np_final
The document discusses leptin, an adipokine that regulates energy metabolism. Leptin is produced mainly by adipose tissue and acts through the hypothalamus to inhibit food intake and increase energy expenditure. Elevated levels in obesity fail to produce these effects, resulting in leptin resistance. Leptin binds to receptors in the hypothalamus and activates signaling pathways involving JAK2/STAT3 and MAPK/ERK. It controls appetite by regulating neuropeptides in the hypothalamus. The document also provides information on antibodies for detecting leptin.
Fully Characterized, Standardized Human Induced Pluripotent Stem Cell Line an...
This document summarizes a webinar presented by Andrew Gaffney and Erin Knock of STEMCELL Technologies. They discussed STEMCELL's development of the healthy control human iPSC line SCTi003-A and single-use iPSCdirect product, which were manufactured to high quality standards. They also discussed STEMCELL's neural progenitor cells derived from SCTi003-A, which can be expanded over multiple passages while maintaining their ability to differentiate into neurons and astrocytes. The neural progenitor cells demonstrate expected marker expression and can be cryopreserved and re-thawed while retaining their differentiation potential.
Tapboost pegs boston slide ver 2015 06-23
The document describes TAPBOOST, a breakthrough platform that improves protein production. It works by controlling the protein folding and cellular quality control systems. It enhances yields of target proteins like antibodies, enzymes, and fusion proteins. For example, it increased IL13Rα2-Fc production 2000% in 293T cells and 400% in CHO suspension cells. It also increased yields of antibodies like Humira, Avastin, and DP12 by 600%, 420%, and 730% respectively. The platform works across expression systems like mammalian, bacterial, and microbial to increase both expression levels and solubility of difficult to produce proteins.
PEGS Boston slide strategia
The document describes TAPBOOST, a breakthrough protein production platform that enhances protein folding and secretion. It works by controlling the protein folding system and cellular quality control mechanisms in the host cell. The platform can increase yields of various target proteins including antibodies, enzymes, and difficult-to-express proteins. It has been shown to boost production levels by over 2000% for some proteins while also reducing aggregation. The platform works in mammalian, bacterial, and yeast expression systems and provides advantages such as increased productivity for any target protein and easy implementation into existing bioprocesses.
Peptide radioimmunoassay (ria)
This document provides instructions for performing a peptide radioimmunoassay (RIA). It describes the basic principles and components of the RIA kits including a radiolabeled tracer, standards, antiserum, and secondary antibodies. Detailed multi-day protocols are provided for setting up the assay, including reconstituting and diluting components, incubating samples and standards with antiserum and tracer, adding secondary antibodies and serum, and counting and analyzing results. Safety precautions are also described when handling radioactive materials.
Tools for improved Protein Mass Spec Sample preparation by Promega
Proteases, glycosidases, antibody characterization tools, IdeS, IdeZ, mass spec reference protein digests, and new solutions for mass spectrometry analysis. Découvrez nos solutions pour vos analyses en spectrométrie de Masse.
Mourad FERHAT, Ph.D
Chef de Produit Analyse cellulaire
mourad.ferhat@promega.com
Promega France
Accelerating Protein Research
CellFree Sciences offers a cell-free protein expression platform using wheat germ extracts to rapidly produce proteins without cells. Their technology allows scalable and automated protein production from micrograms to grams, and expression of proteins difficult to produce in cell-based systems. They provide reagents, protein synthesizers, and contract research services to support protein research and production needs.
Our Genome-Edited Future: the Promise and the Challenge
This presentation gives some background of genome editing techniques in the broader context. The focus of the Conference is on agriculture to ensure that one specific sector can be addressed in depth. However, the potential applications of genome editing are much broader than just agriculture and
there are a number of topic areas which cannot be covered thoroughly in the limited time available.
Technology transfer for biopharmaceuticals amsterdam 2006
This document discusses the development of a recombinant human albumin formulation. It summarizes:
1) Excipients tested including trehalose, histidine, and octanoate to stabilize the protein. Octanoate at 32mM provided optimal heat stability.
2) Challenges in formulation including proteolysis, N-terminal clipping, and dimer/oligomer formation which are natural processes for albumin.
3) Studies characterizing degradation pathways and strategies to minimize them including gene deletion, formulation excipients, and storage conditions.
4) Process to develop a heat stable formulation through differential scanning calorimetry studies of octanoate concentration.
5) Regulatory approval of the recombinant human albumin
Catalog Peptides 2022 - Каталог пептиди на английски част 1
SUMMARY LIST OF PEPTIDE CODES . 6A
A MODERN WELLNESS CONCEPT of Peptide and Non-Peptide Bioregulatio 7А
REVILAB ML — anti-age multifunctional
peptide products 8А
RĒVILAB SL — peptide complexes
for sublingual administration 12А
PEPTIDE COMPLEXES — complexes in solution,
natural peptides 16А
REVILAB ANTI-A.G.E. — a new dawn for modern
anti-age medicine . 21А
CYTOGENES — peptide bioregulators
based on synthesized peptides . 22А
CYTOMAXES — peptide bioregulators based
on natural peptides . 26А
ULTRASEPT — hygienic antiseptic lotion . 33А
CYTOGENES LINGUAL — peptide bioregulators based
on synthesized peptides in sublingual form . 34А
CYTOMAXES LINGUAL — peptide bioregulators based
on natural peptides in sublingual form . 38А
VOLUSTOM — dietary fiber complex 45А
TREATMENT-AND-PROPHYLACTIC —
для здоровья, красоты и активной жизни 46А
COMPLEX 3D — complex based on
detoxicants and antioxidants . 47А
REVIFORM — program for the correction of weight and shape . 64А
MESOTEL — antioxidant natural anti-aging agents . 66А
ONCOLOGY SURIES — advanced technologies to
combat the disease of the 21st century 68А
AYURVEDA TEA — time-tested tea drinks . 70А
COMPLEX NB — promising anti-aging technologies . 74А
Techchallenge Covid-19 & Bio.Game
The document describes plans to enable COVID-19 testing in Northern Africa using mobile laboratory stations. It proposes a three phase approach: Phase 1 uses qPCR testing in mobile labs to provide results in 2 hours. Phase 2 simplifies the process to use isothermal amplification for results in 1 hour without specialized equipment. Phase 3 further simplifies the process for results in 20 minutes using optimized isothermal reactions without centrifuges or thermocyclers. The goal is to establish testing capacity for up to 1.6 million tests at a cost of less than 25 euros per test.
TheDreamers
The document discusses the avocado market and opportunities for disrupting it. It notes that the global avocado market is large and growing but local European producers cannot meet demand. The Americas are the main producers, while the US and EU are the biggest importers. There is demand for avocado plantlets and sustainable avocados in Europe that is not being met. The document identifies Vegan Vera as the target customer persona and validates her characteristics and pain points through research. It finds that the main problems are sustainability issues not being noticed by consumers, limited expansion of European production due to plant supply bottlenecks, and significant food loss due to avocado perishability. It then presents ideas to address these problems through tissue culture cloning
More Related Content
Similar to cell-Free Systems.pdf
Curr Protoc Mol Biol Chen C 2010
This document describes a method for determining the phosphorylation motifs of protein kinases using an arrayed combinatorial peptide library. The procedure involves screening 198 biotinylated peptide substrates in the presence of radiolabeled ATP. The peptides are captured on a streptavidin membrane after phosphorylation, and the membrane is exposed to detect incorporation of radiolabel into each peptide, revealing the kinase's phosphorylation motif. The document provides details on expressing and purifying active kinases, optimizing reaction conditions, performing the peptide array screen in 384-well or 1536-well plates, and analyzing the results to determine the kinase's consensus phosphorylation sequence.
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial
infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian
host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression
vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a
way to get native tPA protein sequence in subsequent purification steps. Further, construct pICZαA-tPA
was developed and electroporated into host to achieve stablert-PA gene by achieving genome integration.
The transformants were screened for phenotypic characters.Mut+
phenotypic colony named Pichia tPA-3
showed expression of rt-PA at 66 kDa on SDS PAGE. Size Exclusion Chromatography (SEC) was
performed, resulting in product peak at same RT as reference standard. (alteplase).Cloning and expression
of rt-PA was successfully achieved in microbial system. Further process optimization at larger scales will
surely provide cost effective alternative to mammalian system forrt-PA production.
CLONING AND EXTRACELLULAR EXPRESSION OF RECOMBINANT TISSUE PLASMINOGEN ACTIVA...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a way to get native tPA protein sequence in subsequent purification steps
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Tissue plasminogen activator (tPA) has noteworthy application in treatment of acute myocardial
infarctions. This study focuses on expression of rt-PA using microbial systems in order to reduce cost
without compromising on quality as an alternative to commercial (rt-PA)produced by using mammalian
host systems. In the present study, Pichia pastoris X-33strain was used as a host with pICZαA expression
vector to obtain extracellular expression of full length tPA gene. Specific primers were designed in such a
way to get native tPA protein sequence in subsequent purification steps. Further, construct pICZαA-tPA
was developed and electroporated into host to achieve stablert-PA gene by achieving genome integration. The transformants were screened for phenotypic characters.Mut+
phenotypic colony named Pichia tPA-3
showed expression of rt-PA at 66 kDa on SDS PAGE. Size Exclusion Chromatography (SEC) was
performed, resulting in product peak at same RT as reference standard. (alteplase).Cloning and expression
of rt-PA was successfully achieved in microbial system. Further process optimization at larger scales will surely provide cost effective alternative to mammalian system forrt-PA production
Cloning and extracellular expression of recombinant tissue plasminogen activa...
This document summarizes research conducted to clone and express recombinant tissue plasminogen activator (rt-PA) using the methylotrophic yeast Pichia pastoris. Specifically, the tissue plasminogen activator gene was cloned into the pICZαA expression vector. This construct was then transformed into Pichia pastoris X33 cells. One transformant, named Pichia tPA-3, showed expression of rt-PA at 66 kDa on SDS-PAGE. Size exclusion chromatography also showed a product peak at the same retention time as a reference tPA standard. Thus, the researchers were able to successfully clone and express rt-PA in the Pichia pastoris system.
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
This document summarizes research conducted to clone and express recombinant tissue plasminogen activator (rt-PA) using the methylotrophic yeast Pichia pastoris. Specifically, the full-length tPA gene was amplified by PCR and cloned into the pICZαA expression vector. This construct was then transformed into Pichia pastoris X33 cells. One transformant, named Pichia tPA-3, showed extracellular expression of rt-PA at 66 kDa on SDS-PAGE after induction with methanol over 144 hours. Size exclusion chromatography of samples from this transformant showed a product peak at the same retention time as a reference tPA standard. Thus, the researchers successfully achieved cloning and extracellular expression of
New technology and workflow for integrated collection, stabilization and puri...
Research into non-invasive prenatal testing (NIPT) and circulating tumor DNA (ctDNA) testing based on circulating cell-free DNA (ccfDNA) is rapidly expanding. However, detection and quantification of ccfDNA is compromised by the release of genomic DNA (gDNA) from lymphocytes due to mechanical lysis or apoptosis during blood collection, storage and transport. PreAnalytiX has developed the PAXgene Blood ccfDNA System, consisting of the PAXgene Blood ccfDNA Tube, a plastic blood collection tube with a unique, non-crosslinking chemistry that preserves extracellular levels of ccfDNA and prevents the release of intracellular DNA from cells into the plasma, and the QIAsymphonyPAXgene Blood ccfDNA Kit for automated ccfDNA extraction from up to 5 ml of plasma. In this slidedeck, this new technology development is presented in comparison to other existing technologies.
CINF 1: Generating Canonical Identifiers For (Glycoproteins And Other Chemica...
Bioinformatics dogma asserts that all-atom representations, capable of encoding details such as disulfide bridging and post-translationally modified amino acids, are too unwieldy to be of practical use. In this presentation, we show how recent advances in computer power, software algorithms and storage technology require us to question this precept. We show how InChI, InChI keys and canonical SMILES can be generated for the largest known proteins, and even for nucleic acid sequences as large as viral and prokaryotic genomes. Indeed, unique identifiers derived from all-atom nucleic acid representations, allow the capture of epigenetic methylation information and circular DNA; feats that are impossible with the one-letter codes used by bioinformaticians. These unique identifiers allow the linking of mature antibodies to the unique identifiers of the plasmids used to express them. Finally, we discuss the possibility of polymer-specific implementations/optimizations of standard InChI, by showing how InChIs and InChI keys may be generated efficiently for specific classes of polymer with over a million atoms.
Ghyslaine ppt
The document summarizes research detecting DNA regions associated with milk protein composition in dairy cattle. The study identified regions on chromosomes 6 and 11 that influence casein and beta-lactoglobulin levels. The chromosome 6 region affected all four casein fractions and explained some genetic variants in casein genes. The chromosome 11 region influenced beta-lactoglobulin levels and explained variants of the beta-lactoglobulin gene. Identifying these DNA regions provides opportunities to use genetic selection to improve milk quality and composition for cheese and other dairy products.
culture cellular
This document provides an overview of microcarrier cell culture principles and methods. Microcarriers allow for increased surface area for cell attachment and growth compared to traditional cell culture methods. They enable higher cell densities and product yields by separating cells from culture medium, improving process control and scalability. Various microcarrier types made from different materials are available for culturing different cell types like mammalian, insect and plant cells. Microcarriers are used to produce vaccines, proteins, antibodies and more in small-scale equipment like spinners and roller bottles as well as large-scale bioreactors like stirred tanks, packed beds and fluidized beds. Careful selection of microcarrier properties, culture conditions and control strategies are required to optimize microcarrier cell culture
Catalog obesity np_final
The document discusses leptin, an adipokine that regulates energy metabolism. Leptin is produced mainly by adipose tissue and acts through the hypothalamus to inhibit food intake and increase energy expenditure. Elevated levels in obesity fail to produce these effects, resulting in leptin resistance. Leptin binds to receptors in the hypothalamus and activates signaling pathways involving JAK2/STAT3 and MAPK/ERK. It controls appetite by regulating neuropeptides in the hypothalamus. The document also provides information on antibodies for detecting leptin.
Fully Characterized, Standardized Human Induced Pluripotent Stem Cell Line an...
This document summarizes a webinar presented by Andrew Gaffney and Erin Knock of STEMCELL Technologies. They discussed STEMCELL's development of the healthy control human iPSC line SCTi003-A and single-use iPSCdirect product, which were manufactured to high quality standards. They also discussed STEMCELL's neural progenitor cells derived from SCTi003-A, which can be expanded over multiple passages while maintaining their ability to differentiate into neurons and astrocytes. The neural progenitor cells demonstrate expected marker expression and can be cryopreserved and re-thawed while retaining their differentiation potential.
Tapboost pegs boston slide ver 2015 06-23
The document describes TAPBOOST, a breakthrough platform that improves protein production. It works by controlling the protein folding and cellular quality control systems. It enhances yields of target proteins like antibodies, enzymes, and fusion proteins. For example, it increased IL13Rα2-Fc production 2000% in 293T cells and 400% in CHO suspension cells. It also increased yields of antibodies like Humira, Avastin, and DP12 by 600%, 420%, and 730% respectively. The platform works across expression systems like mammalian, bacterial, and microbial to increase both expression levels and solubility of difficult to produce proteins.
PEGS Boston slide strategia
The document describes TAPBOOST, a breakthrough protein production platform that enhances protein folding and secretion. It works by controlling the protein folding system and cellular quality control mechanisms in the host cell. The platform can increase yields of various target proteins including antibodies, enzymes, and difficult-to-express proteins. It has been shown to boost production levels by over 2000% for some proteins while also reducing aggregation. The platform works in mammalian, bacterial, and yeast expression systems and provides advantages such as increased productivity for any target protein and easy implementation into existing bioprocesses.
Peptide radioimmunoassay (ria)
This document provides instructions for performing a peptide radioimmunoassay (RIA). It describes the basic principles and components of the RIA kits including a radiolabeled tracer, standards, antiserum, and secondary antibodies. Detailed multi-day protocols are provided for setting up the assay, including reconstituting and diluting components, incubating samples and standards with antiserum and tracer, adding secondary antibodies and serum, and counting and analyzing results. Safety precautions are also described when handling radioactive materials.
Tools for improved Protein Mass Spec Sample preparation by Promega
Proteases, glycosidases, antibody characterization tools, IdeS, IdeZ, mass spec reference protein digests, and new solutions for mass spectrometry analysis. Découvrez nos solutions pour vos analyses en spectrométrie de Masse.
Mourad FERHAT, Ph.D
Chef de Produit Analyse cellulaire
mourad.ferhat@promega.com
Promega France
Accelerating Protein Research
CellFree Sciences offers a cell-free protein expression platform using wheat germ extracts to rapidly produce proteins without cells. Their technology allows scalable and automated protein production from micrograms to grams, and expression of proteins difficult to produce in cell-based systems. They provide reagents, protein synthesizers, and contract research services to support protein research and production needs.
Our Genome-Edited Future: the Promise and the Challenge
This presentation gives some background of genome editing techniques in the broader context. The focus of the Conference is on agriculture to ensure that one specific sector can be addressed in depth. However, the potential applications of genome editing are much broader than just agriculture and
there are a number of topic areas which cannot be covered thoroughly in the limited time available.
Technology transfer for biopharmaceuticals amsterdam 2006
This document discusses the development of a recombinant human albumin formulation. It summarizes:
1) Excipients tested including trehalose, histidine, and octanoate to stabilize the protein. Octanoate at 32mM provided optimal heat stability.
2) Challenges in formulation including proteolysis, N-terminal clipping, and dimer/oligomer formation which are natural processes for albumin.
3) Studies characterizing degradation pathways and strategies to minimize them including gene deletion, formulation excipients, and storage conditions.
4) Process to develop a heat stable formulation through differential scanning calorimetry studies of octanoate concentration.
5) Regulatory approval of the recombinant human albumin
Catalog Peptides 2022 - Каталог пептиди на английски част 1
SUMMARY LIST OF PEPTIDE CODES . 6A
A MODERN WELLNESS CONCEPT of Peptide and Non-Peptide Bioregulatio 7А
REVILAB ML — anti-age multifunctional
peptide products 8А
RĒVILAB SL — peptide complexes
for sublingual administration 12А
PEPTIDE COMPLEXES — complexes in solution,
natural peptides 16А
REVILAB ANTI-A.G.E. — a new dawn for modern
anti-age medicine . 21А
CYTOGENES — peptide bioregulators
based on synthesized peptides . 22А
CYTOMAXES — peptide bioregulators based
on natural peptides . 26А
ULTRASEPT — hygienic antiseptic lotion . 33А
CYTOGENES LINGUAL — peptide bioregulators based
on synthesized peptides in sublingual form . 34А
CYTOMAXES LINGUAL — peptide bioregulators based
on natural peptides in sublingual form . 38А
VOLUSTOM — dietary fiber complex 45А
TREATMENT-AND-PROPHYLACTIC —
для здоровья, красоты и активной жизни 46А
COMPLEX 3D — complex based on
detoxicants and antioxidants . 47А
REVIFORM — program for the correction of weight and shape . 64А
MESOTEL — antioxidant natural anti-aging agents . 66А
ONCOLOGY SURIES — advanced technologies to
combat the disease of the 21st century 68А
AYURVEDA TEA — time-tested tea drinks . 70А
COMPLEX NB — promising anti-aging technologies . 74А
Similar to cell-Free Systems.pdf (20)
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
CLONING AND EXTRACELLULAR EXPRESSION OF RECOMBINANT TISSUE PLASMINOGEN ACTIVA...
CLONING AND EXTRACELLULAR EXPRESSION OF RECOMBINANT TISSUE PLASMINOGEN ACTIVA...
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Cloning and extracellular expression of recombinant tissue plasminogen activa...
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
Cloning and Extracellular Expression of Recombinant Tissue Plasminogen Activa...
New technology and workflow for integrated collection, stabilization and puri...
New technology and workflow for integrated collection, stabilization and puri...
CINF 1: Generating Canonical Identifiers For (Glycoproteins And Other Chemica...
CINF 1: Generating Canonical Identifiers For (Glycoproteins And Other Chemica...
Fully Characterized, Standardized Human Induced Pluripotent Stem Cell Line an...
Fully Characterized, Standardized Human Induced Pluripotent Stem Cell Line an...
Tools for improved Protein Mass Spec Sample preparation by Promega
Tools for improved Protein Mass Spec Sample preparation by Promega
Our Genome-Edited Future: the Promise and the Challenge
Our Genome-Edited Future: the Promise and the Challenge
Technology transfer for biopharmaceuticals amsterdam 2006
Technology transfer for biopharmaceuticals amsterdam 2006
Catalog Peptides 2022 - Каталог пептиди на английски част 1
Catalog Peptides 2022 - Каталог пептиди на английски част 1
More from ssuser432659
Techchallenge Covid-19 & Bio.Game
The document describes plans to enable COVID-19 testing in Northern Africa using mobile laboratory stations. It proposes a three phase approach: Phase 1 uses qPCR testing in mobile labs to provide results in 2 hours. Phase 2 simplifies the process to use isothermal amplification for results in 1 hour without specialized equipment. Phase 3 further simplifies the process for results in 20 minutes using optimized isothermal reactions without centrifuges or thermocyclers. The goal is to establish testing capacity for up to 1.6 million tests at a cost of less than 25 euros per test.
TheDreamers
The document discusses the avocado market and opportunities for disrupting it. It notes that the global avocado market is large and growing but local European producers cannot meet demand. The Americas are the main producers, while the US and EU are the biggest importers. There is demand for avocado plantlets and sustainable avocados in Europe that is not being met. The document identifies Vegan Vera as the target customer persona and validates her characteristics and pain points through research. It finds that the main problems are sustainability issues not being noticed by consumers, limited expansion of European production due to plant supply bottlenecks, and significant food loss due to avocado perishability. It then presents ideas to address these problems through tissue culture cloning
TUMuchIdeas
The document describes a team's proposal to address shortages of plastic consumables needed for Covid-19 testing in Ghana. The team proposes to 3D print the consumables locally using a production setup that includes four 3D printers, an isopropyl bath, and UV chamber. The solution aims to provide a flexible, local, and effortless way to produce swabs, spin columns, tubes, and pipette tips in a sterile and ready-to-use manner at a total cost of around 1000 euros per production table. The team argues that their local 3D printing approach can ensure availability of supplies and help control the pandemic in Ghana by meeting testing needs.
QT-Quick_Testing
Mexico has struggled to control the COVID-19 pandemic due to low testing. The document discusses that half of COVID-19 tests in Mexico are coming back positive, the highest rate in the world. Mexico has resisted widespread testing and only tests the sickest patients. A deputy health minister said broader testing would be a waste of resources. The country has reported over 252,000 cases and 30,000 deaths since the first case was found in late February.
Cellivization
The document describes a game called The Kyobi X that involves cellularization. It includes sections on the solution prototype, game features, market analysis, and meeting the team. Appendices provide details on the game rules and process as well as results from a questionnaire.
Uresist
This document summarizes a team's work on developing an app and marketplace to address antibiotic overuse and resistance. It outlines:
- The team members and their skills/backgrounds.
- The problem of antibiotic overuse in agriculture, medicine, and food industries leading to resistance.
- The lack of awareness about antibiotic alternatives and side effects.
- The prototype app's features to raise awareness, facilitate discussion, and serve as a marketplace.
- A pilot focused on urinary tract infections, which many women experience recurrently with antibiotics.
- Survey results found most people rely only on antibiotics and lack alternative knowledge.
- Plans for the app's implementation, future capabilities like suggesting
Bio Conteri
The document describes a new portable device called Bio Conteri that can perform microbiological analysis using a smartphone. It was developed by a university team to help address antibiotic resistance and improve healthcare in developing countries. The device consists of a microfluidic chip, optical equipment, machine learning software, and connects to a smartphone. It allows doctors to analyze patient samples on-site to identify bacteria and their antibiotic sensitivities, enabling more accurate prescriptions. The team believes this can help reduce misuse of antibiotics and improve health outcomes. Their goal is to launch the first version of the device and software by 2021 after further development and regulatory approval.
openBIO
OpenBIO is an open source platform for life science research collaboration. It aims to increase the speed of research, break down barriers, and improve quality by enabling immediate access to reliable data, transparency over ongoing projects before publication, and collaboration within a large community. The platform exceeds competitors by allowing open access for all, supporting information to publications like lab protocols and raw data, and providing sophisticated collaboration tools. A functional prototype demonstrates key features like project overviews and pages for collaboration. The technology stack including Vue.js, Electron, Express, and Docker enables rapid development. The roadmap includes adding tools for content creation, data visualization, citation management, and a subscription model to further the vision of an open collaboration platform.
Team Osmosis
The team proposes a tracking device placed on each farm animal that measures temperature and movement. The data is sent wirelessly to be analyzed with a prediction model. This provides real-time alerts on a website interface about animals that may be sick. The system aims to reduce treatment costs and prevent disease spread by enabling early detection, helping farmers comply with new regulations limiting antibiotic use. A prototype device has been created and the team plans future testing and refinement on farms.
Bacteria Busters
The document discusses the issue of antibiotic resistance caused by the introduction of antibiotics into aquatic environments through aquaculture. Approximately 50% of consumed antibiotics are directly released into water systems, as antibiotics are routinely added to fish farms to prevent disease and promote growth. This leads to antibiotic residues in farmed fish and the spread of antibiotics through the local environment. Many of the antibiotics used in aquaculture are also important for human medicine. While stopping antibiotic use and increased regulation could help, antibiotic resistance genes still spread through water. Therefore, innovative water treatment is needed to remove antibiotics, such as using Moringa oleifera seeds, which contain proteins that naturally bind antibiotics and can be filtered out. A prototype device using cyclone filtration powered by
Phage4Life
- The team developed a reproducible biochemical analysis approach for phage genome sequencing using a portable DNA sequencer called the MinION to make the approach affordable and accessible. They successfully tested their approach by sequencing a mono-phage sample from Ukraine and discovered a new phage genome.
- Moving forward, they plan to engage students through school projects using their approach, conduct mobile phage sequencing labs in rural areas using the portability of their method, and develop an online phage database to accelerate phage research.
Cofight19
This document summarizes a solution to address bottlenecks in diagnostic testing labs due to shortages and high costs of plastic consumables caused by the COVID-19 pandemic. The proposed solution involves 3D printing consumables like pipette tips, tubes, and swabs using a decentralized network of printing stations to produce the materials on-site. This eliminates dependencies on suppliers and provides stable pricing. The document outlines the automated printing and sterilization process and describes partnerships to pilot the solution in Ghana. It argues the approach outperforms competitors by ensuring fast availability of consumables at predictable low costs.
Avocado Overview
This document outlines a tech challenge to cultivate and clone avocado plants using state-of-the-art laboratory techniques. It notes that the avocado market is growing significantly each year due to high demand, but that current propagation and sustainability practices can be improved. The challenge aims to teach students to clone avocado plants and provide the resulting clones to an urban collaboration space to serve as decorative tropical plants.
Avocado Deep Dive
This document discusses opportunities for innovating the avocado industry through biological techniques. It describes avocados' popularity and cultivation challenges. Propagation is currently done through grafting, but the document proposes cloning avocado plants in the lab to address issues like limited cold hardiness. Genome sequencing could aid breeding programs to develop desirable traits more quickly. The document also suggests solutions like cultivating avocados sustainably in European greenhouses to meet growing demand. With biological solutions, the resulting avocado plants could serve as decorative office plants.
What Bio.Kitchen
The Bio.Kitchen has hosted 47 courses, 10 events, and 5 scientific programs over 4 years. It has trained approximately 350 students and incubated 10 startups. Some startups that have been created or incubated include Woodchicken, Irubis, Inveox, Invitris, Arridus, Fluics, Kilobaser, Orbem, BeWorm, and Medea Pharm. The Bio.Kitchen offers a range of beginner and advanced courses covering topics such as synthetic biology, microbiology, and personalized medicine. It also hosts programs like hackathons and a bootstrapping program to support the creation of biotech startups. A success story is the startup BeWorm, which started
How Bio.Kitchen
Bio.Kitchen is an open community lab for tech-talents with 5 workstations for micro- and molecular biology, chemistry, lab-on-Chip and lab automation. It promotes rapid prototyping, transdisciplinarity, an open hacker community, freedom to operate for founders, and a founder's mindset. The lab provides tools and technologies for DNA diagnostics, sequencing, printing, microfluidics, protein synthesis, and open reagents to enable agile innovation in life sciences.
Bio.Kitchen
The document discusses how biological innovation needs freedom - freedom to think for creative minds, freedom to create through experimentation and community support, and freedom to act by removing roadblocks and providing resources. It introduces Bio.Kitchen, which brings agile development practices to life science innovation through short courses merging biology, chemistry, technology and business. The program aims to generate sustainable solutions for issues like healthcare, food and the environment by coaching teams, supporting projects, and training talents with lab space and technology.
Bio.Kitchen
The document discusses how biological innovation needs freedom - freedom to think for creative minds, freedom to create through experimentation and community support, and freedom to act by removing roadblocks and providing resources. It introduces Bio.Kitchen, which brings agile development practices to life science innovation through short courses that merge biology, chemistry, technology and business to rapidly prototype solutions for green economy, food and healthcare challenges. Key facts note Bio.Kitchen's impact of coaching 25 teams per year who complete 50 projects, training 200 talents, and providing lab space and technology resources.
Bio.Kitchen
The document discusses the Bio.Kitchen, an open community lab that provides tools, technology, and courses to enable agile innovation in life sciences. It aims to lower barriers for biological innovation through rapid prototyping. Key facts noted are that it coaches 25 teams and 50 projects annually, training 200 talents with 25 open lab workspaces and 180 square meters of lab space. A variety of beginner, advanced, and startup courses are offered across disciplines like microbiology, synthetic biology, and more. The goal is to shorten time to results through their methodology and mobile technology.
More from ssuser432659 (20)
Recently uploaded
Executive Directors Chat Leveraging AI for Diversity, Equity, and Inclusion
Let’s explore the intersection of technology and equity in the final session of our DEI series. Discover how AI tools, like ChatGPT, can be used to support and enhance your nonprofit's DEI initiatives. Participants will gain insights into practical AI applications and get tips for leveraging technology to advance their DEI goals.
Azure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHat
বাংলাদেশ অর্থনৈতিক সমীক্ষা (Economic Review) ২০২৪ UJS App.pdf
বাংলাদেশের অর্থনৈতিক সমীক্ষা ২০২৪ [Bangladesh Economic Review 2024 Bangla.pdf] কম্পিউটার , ট্যাব ও স্মার্ট ফোন ভার্সন সহ সম্পূর্ণ বাংলা ই-বুক বা pdf বই " সুচিপত্র ...বুকমার্ক মেনু 🔖 ও হাইপার লিংক মেনু 📝👆 যুক্ত ..
আমাদের সবার জন্য খুব খুব গুরুত্বপূর্ণ একটি বই ..বিসিএস, ব্যাংক, ইউনিভার্সিটি ভর্তি ও যে কোন প্রতিযোগিতা মূলক পরীক্ষার জন্য এর খুব ইম্পরট্যান্ট একটি বিষয় ...তাছাড়া বাংলাদেশের সাম্প্রতিক যে কোন ডাটা বা তথ্য এই বইতে পাবেন ...
তাই একজন নাগরিক হিসাবে এই তথ্য গুলো আপনার জানা প্রয়োজন ...।
বিসিএস ও ব্যাংক এর লিখিত পরীক্ষা ...+এছাড়া মাধ্যমিক ও উচ্চমাধ্যমিকের স্টুডেন্টদের জন্য অনেক কাজে আসবে ...
CACJapan - GROUP Presentation 1- Wk 4.pdf
Macroeconomics- Movie Location
This will be used as part of your Personal Professional Portfolio once graded.
Objective:
Prepare a presentation or a paper using research, basic comparative analysis, data organization and application of economic information. You will make an informed assessment of an economic climate outside of the United States to accomplish an entertainment industry objective.
RPMS TEMPLATE FOR SCHOOL YEAR 2023-2024 FOR TEACHER 1 TO TEACHER 3
RPMS Template 2023-2024 by: Irene S. Rueco
The Diamonds of 2023-2024 in the IGRA collection
A review of the growth of the Israel Genealogy Research Association Database Collection for the last 12 months. Our collection is now passed the 3 million mark and still growing. See which archives have contributed the most. See the different types of records we have, and which years have had records added. You can also see what we have for the future.
Main Java[All of the Base Concepts}.docx
This is part 1 of my Java Learning Journey. This Contains Custom methods, classes, constructors, packages, multithreading , try- catch block, finally block and more.
PCOS corelations and management through Ayurveda.
This presentation includes basic of PCOS their pathology and treatment and also Ayurveda correlation of PCOS and Ayurvedic line of treatment mentioned in classics.
Advanced Java[Extra Concepts, Not Difficult].docx
This is part 2 of my Java Learning Journey. This contains Hashing, ArrayList, LinkedList, Date and Time Classes, Calendar Class and more.
Chapter 4 - Islamic Financial Institutions in Malaysia.pptx
Chapter 4 - Islamic Financial Institutions in Malaysia.pptxMohd Adib Abd Muin, Senior Lecturer at Universiti Utara Malaysia
This slide is special for master students (MIBS & MIFB) in UUM. Also useful for readers who are interested in the topic of contemporary Islamic banking.
BÀI TẬP BỔ TRỢ TIẾNG ANH 8 CẢ NĂM - GLOBAL SUCCESS - NĂM HỌC 2023-2024 (CÓ FI...
BÀI TẬP BỔ TRỢ TIẾNG ANH 8 CẢ NĂM - GLOBAL SUCCESS - NĂM HỌC 2023-2024 (CÓ FI...Nguyen Thanh Tu Collection
https://app.box.com/s/y977uz6bpd3af4qsebv7r9b7s21935vdANATOMY AND BIOMECHANICS OF HIP JOINT.pdf
it describes the bony anatomy including the femoral head , acetabulum, labrum . also discusses the capsule , ligaments . muscle that act on the hip joint and the range of motion are outlined. factors affecting hip joint stability and weight transmission through the joint are summarized.
How to Fix the Import Error in the Odoo 17
An import error occurs when a program fails to import a module or library, disrupting its execution. In languages like Python, this issue arises when the specified module cannot be found or accessed, hindering the program's functionality. Resolving import errors is crucial for maintaining smooth software operation and uninterrupted development processes.
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...Dr. Vinod Kumar Kanvaria
Exploiting Artificial Intelligence for Empowering Researchers and Faculty,
International FDP on Fundamentals of Research in Social Sciences
at Integral University, Lucknow, 06.06.2024
By Dr. Vinod Kumar KanvariaRecently uploaded (20)
Executive Directors Chat Leveraging AI for Diversity, Equity, and Inclusion
Executive Directors Chat Leveraging AI for Diversity, Equity, and Inclusion
Azure Interview Questions and Answers PDF By ScholarHat
Azure Interview Questions and Answers PDF By ScholarHat
বাংলাদেশ অর্থনৈতিক সমীক্ষা (Economic Review) ২০২৪ UJS App.pdf
বাংলাদেশ অর্থনৈতিক সমীক্ষা (Economic Review) ২০২৪ UJS App.pdf
RPMS TEMPLATE FOR SCHOOL YEAR 2023-2024 FOR TEACHER 1 TO TEACHER 3
RPMS TEMPLATE FOR SCHOOL YEAR 2023-2024 FOR TEACHER 1 TO TEACHER 3
Film vocab for eal 3 students: Australia the movie
Film vocab for eal 3 students: Australia the movie
Chapter 4 - Islamic Financial Institutions in Malaysia.pptx
Chapter 4 - Islamic Financial Institutions in Malaysia.pptx
BÀI TẬP BỔ TRỢ TIẾNG ANH 8 CẢ NĂM - GLOBAL SUCCESS - NĂM HỌC 2023-2024 (CÓ FI...
BÀI TẬP BỔ TRỢ TIẾNG ANH 8 CẢ NĂM - GLOBAL SUCCESS - NĂM HỌC 2023-2024 (CÓ FI...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
Exploiting Artificial Intelligence for Empowering Researchers and Faculty, In...
cell-Free Systems.pdf
- 3. Background ● Microorganisms that were able to metabolize PET were found through environmental samples at a garbage dump. After identifying the responsible bacterium "Ideonella sakaiensis", two promising proteins could be identified. “ISF6_4831” is a promising candidate for metabolizing PET. The amino acid sequence is freely accessible via a database and we were able to design a plasmid with which the protein can be expressed. https://www.uniprot.org/uniprot/A0A0K8P6T7
- 4. FASTA >sp|A0A0K8P6T7|PETH_IDESA Poly(ethylene terephthalate) hydrolase OS=Ideonella sakaiensis (strain NBRC 110686 / TISTR 2288 / 201-F6) OX=1547922 GN=ISF6_4831 PE=1 SV=1 MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVRSFTVSRP SGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFVVITIDTNSTLDQP SSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSMGGGGSLISAANNPSLKAAA PQAPWDSSTNFSSVTVPTLIFACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSHSCA NSGNSNQALIGKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS
- 5. SQ Sequence 873 BP; 151 A; 342 C; 258 G; 122 T; 0 other; atgaactttc cccgcgcttc ccgcctgatg caggccgccg ttctcggcgg gctgatggcc 60 gtgtcggccg ccgccaccgc ccagaccaac ccctacgccc gcggcccgaa cccgacagcc 120 gcctcactcg aagccagcgc cggcccgttc accgtgcgct cgttcaccgt gagccgcccg 180 agcggctacg gcgccggcac cgtgtactac cccaccaacg ccggcggcac cgtgggcgcc 240 atcgccatcg tgccgggcta caccgcgcgc cagtcgagca tcaaatggtg gggcccgcgc 300 ctggcctcgc acggcttcgt ggtcatcacc atcgacacca actccacgct cgaccagccg 360 tccagccgct cgtcgcagca gatggccgcg ctgcgccagg tggcctcgct caacggcacc 420 agcagcagcc cgatctacgg caaggtcgac accgcccgca tgggcgtgat gggctggtcg 480 atgggcggtg gcggctcgct gatctcggcg gccaacaacc cgtcgctgaa agccgcggcg 540 ccgcaggccc cgtgggacag ctcgaccaac ttctcgtcgg tcaccgtgcc cacgctgatc 600 ttcgcctgcg agaacgacag catcgccccg gtcaactcgt ccgccctgcc gatctacgac 660 agcatgtcgc gcaatgcgaa gcagttcctc gagatcaacg gtggctcgca ctcctgcgcc 720 aacagcggca acagcaacca ggcgctgatc ggcaagaagg gcgtggcctg gatgaagcgc 780 ttcatggaca acgacacgcg ctactccacc ttcgcctgcg agaacccgaa cagcacccgc 840 gtgtcggact tccgcaccgc gaactgcagc tga 873
- 8. myTXTL – Cell-Free Expression by Arbor Bioscience For convenience, myTXTL Master Mix and positive control template can be stored together at –80 °C. Once thawed to set up a TXTL reaction, myTXTL Master Mixes should be kept on ice and used within 4 hours after thawing. Up to five thaw- and-freeze cycles are possible without loss of protein production efficiency. When stored and handled under these conditions, myTXTL kits are stable for 12 months upon arrival.
- 9. Numbers The major factors for the growth of the cell-free protein expression market include the increasing R&D in the fields of proteomics and genomics, high prevalence of cancer and infectious diseases, and shorter-expression time and structural modification. The global market for protein expression should grow from $1.8 billion in 2017 to $3.1 billion by 2022 at a compound annual growth rate (CAGR) of 11.3% from 2017 through 2022.