Ito ay isang powerpoint presentation na tumatalakay sa paksang tungkol sa Epiko mula sa India na ang titulo ay Rama at Sita. Dito din matatagpuan ang ilang aktibidad o diskusyon patungkol sa paksang tinalakay.
Ito ay isang powerpoint presentation na tumatalakay sa paksang tungkol sa Epiko mula sa India na ang titulo ay Rama at Sita. Dito din matatagpuan ang ilang aktibidad o diskusyon patungkol sa paksang tinalakay.
Nawa'y mayroong maitulong sa inyo ang presentasyon na ito. Maaaring makakita kayo ng ilang pagkakamali magkagayon man alam kong ito'y makakatulong pa rin sa inyo. Salamat!
Ito ay isang powerpoint presentation na tumatalakay sa paksang tungkol sa Maikling Kuwento mula sa Pakistan na ang titulo ay Sino ang Nagkaloob. Dito din matatagpuan ang ilang aktibidad o diskusyon patungkol sa paksang tinalakay.
para sa mga nag hahanap oh gustong makuha ang file na ito maari lamang pong mag register ng account dito sa SLIDESHARE,pag katapos non ay iconfirm muna sa inyong email para ito ay maisave oh maidownload ng tama.
kung may katanungan po kayo maari lamang na mag email sa account na ito:
asa.net2015@gmail.com
asa.net2014@yahoo.com
maraming SALAMAT PO!
Mullah Nassreddin (Anekdota mula sa Persia/ Iran)Eleizel Gaso
Ang mag-aaral ay nakapanghihikayat tungkol sa kagandahan ng alinmang bansa batay sa binasang akdang pampanitikan
Nasusuri ang binasang anekdota batay sa:paksa, tauhan, tagpuan, motibo ng awtor, paraan ng pagsulat F10PB-IIIb-81
1. Natutukoy ang kahulugan ng anekdota
2. Nasusuri ang binasang anekdota batay sa paksa, tauhan, tagpuan, motibo ng awtor, paraan ng pagsulat
3. Nakasusulat ng anekdota tungkol sa mga dating karanasan nang may pagpapahalaga
The document discusses the characteristics of epics. Epics are long narrative poems that tell stories about the heroic deeds and adventures of larger-than-life characters through fantastical settings and events. They aim to inspire readers through embedded beliefs, customs, and ideals. Epics originated from ancient Greek and Spanish oral traditions and served to pass down cultural history and values to new generations. Examples of folk epics in the Philippines include the Ilocano epic Biag ni Lam-ang and the Visayan epic Maragtas.
The document discusses different types of media used for storytelling and sharing information. It defines comics as a medium that uses images and text to convey ideas, stories or narratives. It then describes the typical elements of comics like title, panels, captions and speech bubbles. It also discusses magazines as regular publications containing articles, stories, photos and ads. It provides examples of popular magazines in the Philippines and what types of content they feature.
Kaligirang Pangkasaysayan ng Tanka at Haiku; Pagkakatulad at pagkakaiba ng tanka at haiku; integrasyon ng tanka at haiku sa tula ng Pilipino; paghahambing ng tulang hapon sa lokal na kauri nito.
Nawa'y mayroong maitulong sa inyo ang presentasyon na ito. Maaaring makakita kayo ng ilang pagkakamali magkagayon man alam kong ito'y makakatulong pa rin sa inyo. Salamat!
Ito ay isang powerpoint presentation na tumatalakay sa paksang tungkol sa Maikling Kuwento mula sa Pakistan na ang titulo ay Sino ang Nagkaloob. Dito din matatagpuan ang ilang aktibidad o diskusyon patungkol sa paksang tinalakay.
para sa mga nag hahanap oh gustong makuha ang file na ito maari lamang pong mag register ng account dito sa SLIDESHARE,pag katapos non ay iconfirm muna sa inyong email para ito ay maisave oh maidownload ng tama.
kung may katanungan po kayo maari lamang na mag email sa account na ito:
asa.net2015@gmail.com
asa.net2014@yahoo.com
maraming SALAMAT PO!
Mullah Nassreddin (Anekdota mula sa Persia/ Iran)Eleizel Gaso
Ang mag-aaral ay nakapanghihikayat tungkol sa kagandahan ng alinmang bansa batay sa binasang akdang pampanitikan
Nasusuri ang binasang anekdota batay sa:paksa, tauhan, tagpuan, motibo ng awtor, paraan ng pagsulat F10PB-IIIb-81
1. Natutukoy ang kahulugan ng anekdota
2. Nasusuri ang binasang anekdota batay sa paksa, tauhan, tagpuan, motibo ng awtor, paraan ng pagsulat
3. Nakasusulat ng anekdota tungkol sa mga dating karanasan nang may pagpapahalaga
The document discusses the characteristics of epics. Epics are long narrative poems that tell stories about the heroic deeds and adventures of larger-than-life characters through fantastical settings and events. They aim to inspire readers through embedded beliefs, customs, and ideals. Epics originated from ancient Greek and Spanish oral traditions and served to pass down cultural history and values to new generations. Examples of folk epics in the Philippines include the Ilocano epic Biag ni Lam-ang and the Visayan epic Maragtas.
The document discusses different types of media used for storytelling and sharing information. It defines comics as a medium that uses images and text to convey ideas, stories or narratives. It then describes the typical elements of comics like title, panels, captions and speech bubbles. It also discusses magazines as regular publications containing articles, stories, photos and ads. It provides examples of popular magazines in the Philippines and what types of content they feature.
Kaligirang Pangkasaysayan ng Tanka at Haiku; Pagkakatulad at pagkakaiba ng tanka at haiku; integrasyon ng tanka at haiku sa tula ng Pilipino; paghahambing ng tulang hapon sa lokal na kauri nito.
Ito ay isang powerpoint presentation na tumatalakay sa Uri ng Panitikan na umusbong sa bansang Thailand. Dito din matatagpuan ang uri ng Panitikan ng Thailand tulad ng Oral Literature at Written Literature at kaunting kasaysayan ng Panitikan ng Thailand.
ANG HATOL NG KUNEHO Gr.9 FILIPINO, ARALIN 2.2Jenita Guinoo
Isang nakawiwiling uri ng akda ang pabula na kapupulutan ng aral.Ang layunin nito ay maturuan ng tamang pagpapahalaga ang bawat isa lalo na ang mga kabataan.
ay nagsasaad kung kailan naganap o magaganap ang kilos na taglay ng pandiwa. Mayroon itong tatlong uri: may pananda, walang pananda, at nagsasaad ng dalas.
The document discusses the benefits of meditation for reducing stress and anxiety. Regular meditation practice can help calm the mind and body by lowering heart rate and blood pressure. Making meditation a part of a daily routine, even if just 10-15 minutes per day, can have mental and physical health benefits over time by reducing stress levels and promoting relaxation.
This teaching guide lesson introduces students to the major organelles and structures found within cells, including the endomembrane system, mitochondria, chloroplasts, cytoskeleton, and extracellular matrix. Students will demonstrate their understanding by constructing 3D models of whole cells using local materials that show the endomembrane system, mitochondria, and chloroplasts. The models aim to help students understand the structures and functions of these organelles.
1. The document provides an outline for a lesson on the universe and the solar system. It includes an introduction to motivate students by relating the vast scale of billions of years to human timescales, and images showing the relative sizes of the solar system, Milky Way galaxy, and observable universe.
2. The instruction section involves a 30 minute lecture covering the structure, composition and age of the universe, the evidence for an expanding universe from redshift measurements, and an explanation of the Big Bang theory.
3. Assessment involves assignment questions and a report/summary to evaluate students' understanding of key topics like the origin and evolution of the universe.
This document provides an overview of a Teaching Guide for a General Physics 1 course for senior high school. It outlines the course content standards and performance standards, which are mapped to specific learning competencies. The course covers units, measurement, vectors, one-dimensional kinematics including uniformly accelerated motion, and two-dimensional and three-dimensional motion. The Teaching Guide is designed to be highly usable for teachers, providing classroom activities and notes to help develop students' understanding, mastery, and ownership of the content.
This document provides a teaching guide for a Statistics and Probability course for senior high school students. It begins with an introduction that discusses the importance of statistics and data analysis. It then outlines the structure and goals of the teaching guide, which includes sections on introduction, instruction, practice, enrichment, and evaluation. The guide is meant to help teachers facilitate student understanding, mastery of concepts, and a sense of ownership over their learning. It also discusses aligning the guide with DepEd and CHED standards to prepare students for college. The preface provides additional context on statistics as a discipline and its growing importance.
21st century literature from the philippines and the worldPRINTDESK by Dan
The document provides a lesson plan for teaching 21st century literature from the Philippines and other regions. It focuses on analyzing a poem by Filipino writer Cirilo Bautista called "A Man Falls to His Death" through historical and biographical criticism. Students will read and discuss the poem in groups to interpret its context and themes. They are assigned a homework essay analyzing details of the author's life and how it relates to the poem, as well as current issues around workplace accidents.
Sappia, the goddess of mercy, took pity on the people of Bohol suffering from a famine. With the land parched and people dying of hunger, Sappia squeezed drops of milk and then blood into barren weeds, causing them to grow heavy with grain. She watched over the people as they gathered the harvest, some grains white from her milk and others red from her blood, and were nourished back to strength. The life-giving grain Sappia provided, which became known as rice, ended the famine.
A control room of a local radio broadcast studio commonly known as the announcerPRINTDESK by Dan
The document describes a radio broadcast studio control room, commonly known as the announcer's booth. It also mentions a live audio room separated from the control room by glass partitions, which is usually known as the newsroom. The image is used with permission from a radio and television broadcast station in Cagayan de Oro City in the Philippines.
Here are the answers to the pre-assessment questions:
1. B
2. A
3. B
4. D
5. B
6. C
7. C
8. A
9. B
10. C
11. B
12. A
13. B
14. B
For the mini-research question, here is a suggested outline:
Conduct a mini-research or survey among your classmates to determine the following:
1. Number of students interested to join the FUN RUN activity
2. Possible date preference for the activity
3. Suggested registration fee and minimum pledges
4. Prizes for top 3 runners
This document is the introduction section of a Grade 10 mathematics learner's module developed by the Department of Education of the Philippines. It was created through a collaborative process involving educators from schools, colleges, universities, and the Department of Education. The material is intended to support the K-12 Basic Education Program and ensure students meet expected standards. It contains 8 modules covering various mathematics topics. The introduction describes the development and review process and outlines the topics to be covered in each module.
This document is the table of contents for a science textbook on living things and their environment. It includes summaries of 4 modules:
1. The coordinated functions of the nervous, endocrine, and reproductive systems.
2. Heredity and inheritance, including DNA, RNA, gene transmission from parents to offspring.
3. Biodiversity and evolution, covering classification, analogous and homologous structures, relatedness between species, and adaptation over time.
4. Ecosystems and biodiversity, including the value of biodiversity, environmental issues, and human impacts on communities.
Each module contains learning objectives, activities, summaries, and assessments. The document provides an overview of topics covered in the
Measure 100 mL of water using a graduated cylinder and pour it
into a 500-mL beaker or tin can.
2.
You: Use a pipette or syringe to carefully add 20 mL of cooking oil on top of
the water in the beaker/tin can. Observe what happens.
All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means -
electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
D
EPED
C
O
PY
357
3.
This document outlines many branches of biology, including:
- Aerobiology which studies airborne organic particles.
- Biogeography which studies the distribution of species spatially and temporally.
- Biomathematics which quantitatively studies biological processes through modeling.
- Several other branches study specific domains like agriculture, anatomy, astrobiology, botany, ecology, and more. Overall, the document provides a broad overview of the many specialized fields that make up the overall domain of biology.
- Basketball is a sport played by two teams of five players on a court, with the objective being to shoot a ball through a hoop mounted on a backboard at each end of the court.
- A team scores points by shooting the ball through the basket, with field goals being worth 2 or 3 points depending on whether the shot is made inside or outside the three-point line. The team with the most points wins.
- Violations of the rules are considered fouls, with personal fouls often resulting in free throw shots for the opposing team and technical fouls giving the other team both a free throw and possession of the ball.
The document summarizes the history and development of Barangay Babasit in Manaoag, Pangasinan, Philippines. It explains that the name "Babasit" originated from a local legend about a small couple who settled in the forested area, with "basbasit" meaning "short" in the local dialect. It has since grown into a progressive barangay with over 6,000 inhabitants and various infrastructure developments over time, including roads, schools, utilities, and community projects. The barangay is currently led by Captain Salvador S. Javilona and focuses on initiatives like medical missions, education programs, and infrastructure improvements.
1. AngAlamatniPrinsesaManorah
(Isinalinsa Filipino ni Dr. Romulo N. Peralta)
Isangalamatnapasalin-salinsaiba’tibangpanahon at henerasyonmulanoongpanahonng Ayutthaya at nagbigay-
inspirasyonkay Haring Rama V ng Thailand.
Si KinnareeManorah ay isangprinsesangalamatng Thai at angpinakabatasapitonganaknakinnareeng Haring
Prathum at ReynangJantakinnaree. Siya ay nakatirasamaalamatnakaharianngBundokGrairat. Angpitongkinnaree ay
kalahatingbabae at kalahatingsisne.Sila’ynakalilipad at nagagawangitagoangkani-kanilangpakpakkungkanilangnanaisin.
SaloobngkahariangKrairat (Grairat), nakatagoangkagubatanngHimmapan kung saan din
namamahayangmganakatatakotnanilalangnahindikilalasadaigdigngmgatao. Saloobngkagubatan, nakakubliangmaganda at
kaaya-ayanglawa kung saanangpitongkinnaree ay masayangdumadalawlalonasaarawngPanarasi (kalakihanngbuwan). Sa
di-kalayuannglawa, nakatiraangisangermitanyonanagsasagawangkaniyangmeditasyon.
Isangaraw, napadakoangisangbinatahabangnaglalakbaysakagubatanngHimmapan. Siya ay
siPrahnbun.Nakitaniyaangpitongkinnareenamasayangnagtatampisawsailog.
NamanghasiyasanakabibighaningkagandahanniPrinsesaManorah. Naisipniyana kung mahuhuliniyaangprinsesa,
dadalhinniyaitokayPrinsipeSuton, anganakng Haring Artityawong at Reyna JantaiveengUdonPanjah.
Tiyaknamatutuwaangprinsipe at tuluyangmapapaibigitosaprinsesa. Ngunitnaitanongniyasasarili kung paanoniyaitomahuhuli.
AlamniPrahnbunna may ermitanyongnakatirasamalapitngkagubatan.
Pinuntahanniyaitoupangmagpatulongsakaniyangbalak.
Sinabisakaniyangermitanyonanapakahirapangmanghulingkinnareedahilagad-agaditonglumilipadkapagtinatakot.
Ngunitnaisipngermitanyona may isang dragon nanakatirasapinakasulok-
sulukanngkagubatannamaaaringmakatulongsakanila. Nagpasalamatangbinatasaermitanyo at
nagmamadalinglumisanupanghanapinang dragon.
Hindi natuwaang dragon nangmarinigangbalakniPrahnbun, ngunitnapapayag din
itongbigyanniyasiPrahnbunngmakapangyarihanglubidnasiyangpanghuhuliniyasaPrinsesaManorah. Nagpasalamatangbinata
at patakbongumalisnadala-dalaangmakapangyarihanglubid at patagongtinungoangilog kung
saannaglalaroangmgakinnaree.
Habangabalasapaglalaroangmgakinnaree, inihagisniPrahnbunanglubid at matagumpaynanahulisiPrinsesaManorah.
Ganunnalamangangpagkaawangibangmgakapatidngprinsesa. Ngunitsila’ywalangnagawakundiagad-
agadnalumipaddahilsatakotnasilarin ay paghuhulihin.
ItinalinangmahigpitniPrahnbunangpakpakniPrinsesaManorahupanghindimakawala at
tuluyangmadalapabaliksaUdonPanjah at
maibigaykayPrinsipeSutonnanoo’ynaglalakbayrinsakaysakabayopapuntasakagubatan. NakasalubongniyasiPrahnbundala-
dalasiPrinsesaManorah.Agad-agadnanaakitsakagandahanniPrinsesaManorahangprinsipe.
Nang isalaysayniPrahnbunkayPrinsipeSutonangdahilan kung bakitniyahinuli at dinalaangprinsesasaharapniya,
nagpasalamatangprinsipe at binayaransiyanitongnapakalakinghalaga.
Nagbalikangprinsipesakaniyangpalasyodala-dalasiPrinsesaManorah kung saanumusbongangisangtunaynapag-
ibigsaisa’tisa. Nang sabihinngprinsipesakaniyanginangprinsesa at amanghariangbuongpangyayari, masayang-masayasila
at agad-agadnagbalaknamagsagawangkasalpara kina PrinsipeSuton at PrisesaManorah.
BumaliksilasapalasyongUdonPanjah kung saanisinagawaangkasal at
tuluyangnamuhaynangmasaya’tmatiwasayhabambuhay.
