Edisi29nasional
Upcoming SlideShare
Loading in...5
×
 

Edisi29nasional

on

  • 4,506 views

 

Statistics

Views

Total Views
4,506
Views on SlideShare
4,494
Embed Views
12

Actions

Likes
0
Downloads
4
Comments
1

2 Embeds 12

http://epaper.waspada.co.id 9
http://waspada.co.id 3

Accessibility

Upload Details

Uploaded via as Adobe PDF

Usage Rights

© All Rights Reserved

Report content

Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

Cancel
  • Full Name Full Name Comment goes here.
    Are you sure you want to
    Your message goes here
    Processing…
  • hai my name hendra
    Are you sure you want to
    Your message goes here
    Processing…
Post Comment
Edit your comment

Edisi29nasional Edisi29nasional Document Transcript

  • WASPADA Selasa 29 September 2009 Luar Negeri 3 Jordania Dengan Keras Mengutuk Penerobosan Israel Ke Al-Aqsha AMMAN, Jordania (Antara/Xinhua-OANA) upaya oleh tentara Israel yang melanggar : Pemerintah Jordania dengan keras mencela kesucian Masjid Al-Aqsha dan tempat suci di penerobosan ke tempat suci Muslim, Masjid Jerusalem karena kesucian itu dijamin oleh Al-Aqsha, oleh tentara Israel bersama sekelom- konvensi, hukum dan resolusi internasional, pok orang Yahudi radikal, yang mengakibatkan yang melindungi semua tempat suci dari beberapa orang Palestina menjadi cedera pelanggaran apa pun. demikian laporan kantor berita resmi Jordania, Ahad pagi, bentrokan terjadi antara orang Petra. Palestina di bagian timur Jerusalem dan polisi “Jordania mengutuk penerobosan ke dalam Israel saat sekelompok orang Yahudi radikal masjid oleh tentara Israel karena ini adalah menerobos ke halaman Masjid Al-Aqsha, tindakan provokatif yang tampaknya mening- tempat suci ketiga umat Muslim. katkan ketegangan,” kata Menteri Negara Sebanyak 16 orang Palestina dan beberapa Urusan Komunikasi dan Media Jordania Nabil polisi Israel cedera dalam bentrokan tersebut, Sharif dalam satu pernyataan Minggu (27/9). demikian laporan media. Nabil Sharif mengatakan penerobosan ke Sharif mengatakan penerobosan ke dalam masjid suci tersebut tampaknya meng- halaman masjid itu memicu kerusuhan pada akibatkan kerusuhan lebih lanjut dan mengan- saat berbagai upaya internasional meningkat cam keamanan serta kestabilan di wilayah itu. untuk meluncurkan perundingan perdamaian Ia menyatakan Jordania menolak setiap Palestina-Israel. Sudan Kecam Larangan Perjalanan AS Atas Politisi KHARTOUM, Sudan (Antara/Xinhua- Pemerintah AS, Sabtu, memberlakukan OANA) : Partai Kongres Nasional (NCP), yang pembatasan perjalanan atas politisi dari ketiga berkuasa di Sudan mengecam keputusan negara Afrika tersebut ke Amerika Serikat. pemerintah AS untuk memberlakukan larangan Al Mahdi mengatakan ia tidak optimiss perjalanan buat pemimpin politik di Sudan, bahwa peningkatan hubungan antara Khar- Kenya dan Zimbabwe. toum dan Washington mungkin terjadi, dan “Keputusan ini jelas menunjukkan bahwa mengatakan, “Ada tanda yang tak mendorong pemerintah saat ini Presiden AS Barack Obama optimisme, termasuk pendirian yang bertolak- mengikuti langkah yang sama dengan peme- belakang oleh AS dan utusannya Scott Gration”. rintah sebelumnya presiden George W. Bush,” “Pusat pembuat keputusan AS telah kata Sekretaris Politik NCP Mohamed Mandour dipengaruhi oleh lobi Zionis, yang secara keras Al Mahdi Minggu (27/9). memusuhi Sudan dan bekerja untuk “Pemerintah AS ingin menekan Sudan memisahkan Sudan utara dari selatan serta melalui cara baru,” tambahnya. mensahkan jalur pemisahan,” katanya. Foto rilis dari Iran Fars News Agency memperlihatkan misil Revolutionary Guard sedang diluncurkan dalam sebuah pelatihan di dekat kota Qom, Tehe- ran selatan, Minggu (27/9). AP Merkel Raih Mandat Kedua Sebagai Kanselir Jerman Iran Lakukan Ujicoba BERLIN, Jerman (Antara/AFP) : Angela Merkel meraih mandat kedua kali dalam pemilihan di Jerman untuk memimpin aliansi baru tengah-kanan, demikian hasil penghitu- ngan sementara menunjukkan. “Kita telah mencapai tujuan dengan meraih suara mayoritas untuk membentuk pemerin- wanita pertama Jerman dan satu-satunya kanselir dari timur yang bekas komunis, akan memimpin lagi untuk masa empat tahun. Berdasarkan penghitungan hasil pemilihan yang rumit di Jerman, gabungan suara kubu Merkel dan mitranya yang mencapai 48 persen sudah cukup menempatkan mereka di posisi Rudal Tahap Tiga tahan baru,” kata Merkel kepada para pendu- teratas. kungnya yang bersuka ria di Berlin Minggu Koalisi tengah-kanan pernah memerintah (27/9). “Saya ingin menjadi kanselir semua Jerman selama 28 dari 60 tahun sejak republik warga Jerman untuk membawa perbaikan bagi pasca perang itu didirikan. Keduanya terbiasa negeri kita.” dalam konstalasi politik Jerman. Hasil awal yang disiarkan televisi menunjuk- Pemimpin FDP GuidoWesterwelle sekarang kan blok Uni Kristen (CDU/CSU) yang konser- bertujuan menjadi wakil kanselir dan menteri vatif pimpinan Merkel, 55, meraih 33,5 persen luar negeri. TEHERAN, Iran (AP): berhasil mengujicoba rudal jarak Latihan perang itu dilaku- ancaman militer dari negara membuat keputusan untuk suara. Dalam jajak pendapat menjelang pemilihan, sedang Shahab-3 dan Sajjil yang kan di saat Iran mendapat lain. membuat senjata nuklir. “Para pemilihan telah memberikan suara, Merkel tetap berada di atas Steinmeier, 53. Iran mengatakan negaranya bisa menempuh jarak 2.000 km. tekanan keras dari internasional Menlu AS Hillary Clinton Jubir Kemlu Iran Hasan dan hasilnya merupakan hari getir bagi Demo- Merkel, yang oleh majalah Forbes disebut Ujicoba tersebut merupakan untuk menghentikan kegiatan mengatakan dia tidak percaya Qashqavi mengatakan, fasilitas krasi Sosial di Jerman,” kata Menteri Luar sebagai wanita paling berpengaruh di atas planet berhasil mengujicoba rudal tahap ketiga dalam latihan dua nuklirnya. Latihan tersebut Iran bisa meyakinkan AS dan pengayaan uranium yang baru Negeri Frank-Walter Steinmeier, saingan Merkel selama empat tahun pemerintahan, mengata- jarak jauh Senin (28/9), hari yang dilakukan Garda dimulai Minggu, dua hari sete- negara kuat lainnya pada perte- diungkapkan itu bernama dari kubu Sosial Demokrat (SPD), kepada para kan Jerman yang merupakan eksporter nomor Revolusioner itu. lah AS dan sekutunya mengung- muan mendatang bahwa pro- Fordo, desa yang terletak 180 pemilih yang kesal. “Tak ada cara lain untuk dua terbesar di dunia dan dilanda krisis glo- senjata tersebut mampu Rudal Sajjil-2 merupakan kap bahwa Iran secara diam- gram nuklirnya hanya untuk km sebelah selatan Teheran. berkata, ini merupakan kekalahan yang getir.” bal memerlukan satu pemerintahan tengah- membawa hulu ledak dan rudal dua tahap yang paling diam membangun fasilitas tujuan damai, seperti selama Tempat itu 100 km jauhnya dari SPD, mitra yunior dalam “koalisi besar” kanan guna mengakhiri penurunan ekonomi canggih milik Iran dan diperkuat pengayaan uranium bawah ta- ini dinyatakan Teheran. Natanz, yang dikenal sebagai Merkel meraih antara 22 dan 23 persen — angka pasca-perang. menyerang Israel, dengan bahan bakar padat nah dan mengingatkan negara Hal itu akan menyebabkan reaktor pengayaan uranium terburuk mereka sejak Perang Dunia II — dan Koalisi baru Merkel akan menghadapi se- pangkalan militer AS di sementara Shahab-3 meng- itu untuk membuka tempat ter- Iran mendapat sanksi ekonomi Iran. akan beroposisi setelah 11 tahun dalam jumlah masalah domestik seperti pengangguran, gunakan gabungan antara sebut bagi pemeriksaan inter- yang lebih keras dari ‘sanksi- Qashqavi lebih jauh menga- pemerintahan. perawatan kesehatan, pendidikan dan sistem Timur Tengah dan beberapa bahan bakar padat dan cair nasional atau akan menghadapi sanksi yang telah dijatuhkan’, takan, ujicoba rudal itu tidak Mitra-mitra yang disukai Merkel, Demokrat keamanan sosial yang perlu direformasi. dalam bentuk paling canggih. sanksi yang lebih keras. katanya. ada kaitannya dengan ketega- Bebas (FDP) yang pro bisnis, meraih hampir Di luar negeri, tantangan utama adalah bagian Eropa. Bahan bakar padat dipan- Jenderal Hossein Salami, Menurut perkiraan AS, Iran ngan berkaitan fasilitas tersebut 15 persen suara. Dengan demikian mereka Afghanistan, tempat Jerman telah mengerahkan dang sebagai kemajuan tek- Kepala Angkatan Udara Garda masih butuh waktu satu sampai dan mengatakan ujicoba itu akan kembali ke pemerintahan untuk pertama sekitar 4.200 serdadu di bawah pimpinan NATO nologi dalam program rudal Revolusioner, mengatakan lima tahun lagi untuk bisa bagian dari kegiatan rutin, kali sejak 1998. yang bertempur selama delapan tahun Televisi negara mengatakan karena bahan bakar padat Minggu latihan itu ditujukan memiliki senjata nuklir, meski latihan militer yang telah lama Dengan hasil mayoritas, Merkel, pemimpin melawan Taliban. Garda Revolusioner, yang me- meningkatkan ketepatan rudal untuk memperlihatkan bahwa badan intelijen AS juga meyakini direncanakan. nguasai program rudal Iran, dalam mencapai sasaran. Iran siap menghadapi setiap para pemimpin Iran belum (m18) Lima Anggota OAS Ditahan Korban Badai Pakistan, India Akhiri Di Honduras, Empat Diusir TEGUCIGALPA, Honduras (Antara/AFP): bawa kembali kenangan buruk,” kata Biehl, Ondoy Di Filipina Pembicaraan Tanpa Terobosan Lima anggota Organisasi Negara Amerika (OAS) yang menyinggung kediktatoran Augusto ditahan selama enam jam di bandar udara Pinochet. internasional di Honduras, dan empat lagi diusir, Rejim de fakto di Honduras, yang telah NEW YORK, AS (Antara/ menghukum mereka yang “Kami tetap khawatir kata John Biehl, satu-satunya pejabat OAS yang menghadapi kecaman yang meningkat karena Lebih Dari 100 Reuters) : Pakistan mengisya- berada di balik serangan- mengenai ancaman kelompok- memasuki negeri itu. caranya melakukan penindasan secara keras ratkan keinginannya untuk serangan itu. kelompok dan individu di Pa- Utusan OAS tersebut bermaksud meletak- sejak penggulingan Zelaya pada 28 Juni, telah membetulkan hubungan deng- Qureshi mengatakan ia telah kistan yang diarahkan kepada kan kerangka kerja bagi upaya penengahan berusaha menunda misi OAS tersebut. an India sementara para menteri membuat proposal kepada kami,” ujarnya. Ia menambah- sementara ketegangan meningkat antara pre- Dua pejabat dari Kedutaan Besar Spanyol MANILA, Filipina (Antara/PNA-OANA): Hujan deras luar negeri kedua negara yang India mengenai bagaimana ke- kan bahwa ia telah menekankan siden terdepak Manuel Zelaya, yang telah juga ditolak masuk di bandar udara Hondu- yang menimbulkan banjir di daerah-daerah Marikina, memiliki nuklir itu bertemu tapi dua negara yang berseberangan kepada Qureshi perlunya berlindung di kedutaan besar Brazil di Tegu- ras pada Ahad, sewaktu mereka kembali ke Pasig dan Rizal mengancam jalannya operasi tidak sampai mengumumkan itu memperbaiki hubungan, “langkah-langkah konkrit dan cigalpa selama satu pekan belakangan, dan Honduras setelah berlibur di luar negeri, kata penyelamatan dan pencarian di wilayah itu. perundingan perdamaian termasuk jadwal waktu tapi dia efektif” terhadap mereka”. para pemimpin de fakto negeri itu. satu sumber diplomatik. Meskipun badai tropis Ondoy telah berlalu, namun kembali yang macet. tak memberi perincian. Krishna mengakui tindakan “Kami ditahan di bandar udara. Ada dua Menlu India S.M. Krishna Pejabat lain Pakistan me- hukum yang Pakistan ambil Pemerintah sementara Sabtu malam mem- meninggalkan ratusan orang tewas, kebanyakan hanyut warga negara Amerika, dua Kanada, satu orang beri Brazil ultimatum 10 hari untuk memu- oleh arus banjir. Badai ini menyebabkan bencana besar dan rekan sejawatnya Shah ngatakan proposal diajukan terhadap para tersangka dalam Kolombia dan saya sendiri di dalam kelompok Mahmood Qureshi Minggu untuk mendorong dialog yang serangan Mumbai tetapi me- tuskan apa yang akan dilakukan pada Zelaya. di seluruh Metro Manila pada akhir pekan lalu. tersebut,” kata Biehl, penasehat Sekretaris (27/9) mengadakan pertemuan beku setelah serangan Mumbai. ngatakan “pusat kejahatan yang Rejim tersebut juga menyeru semua dip- Tidak ada badai di dalam wilayah tanggungjawab Jenderal badan pan-Amerika itu, Jose Miguel 100-menit di sela pertemuan Peluang logis bagi perdana men- dilakuakan di Mumbai tidak Insulza Minggu (27/9) . lomat dari negara yang telah memutuskan hu- Filipina, kata Lembaga Dinas Atmosfir Filipina (Pagasa), bungan dengan Honduras sejak kudeta duku- tahunan Sidang Umum PBB teri keduanya untuk bertemu dapat dilakukan oleh tujuh atau Satu anggota kelompok tersebut dikirim namun bagian tengah dan selatan Luzon diperkirakan dalam usaha memperbaiki bisa terjadi pada pertemuan delapan indivdidu”. ngan militer agar berhenti menggunakan plat ke Amerika Serikat dan tiga orang lagi dikirim masih terjadi hujan, yang akan diperkuat oleh angin hubungan yang diganggu oleh tingkat tinggi Persemakmuran India dan Pakistan telah nomor diplomatik dan surat kepercayaan ke Kosta Rika, kata Biehl. musim barat daya. serangan-serangan kelompok pada November di Trinidad. terlibat dalam tiga perang sejak “Kami ditahan selama enam jam ... sebagai mereka, serta mencabut bendera negara itu Pada Minggu (27/9), badai Ondoy berada di 560 pria bersenjata di Mumbai, Qureshi mengatakan ia ingin kemerdekaan pada 1947 dan orang Chile, saya harus mengatakan itu mem- dan berbagai lencana lain dari semua bangunan. kilometer di barat Iba, Zambales, pada sekitar pukul November lalu. pergi ke India jika hal itu mung- hampir terjadi lagi pada 2002. 22:00 waktu setempat. Pakistan mengakui bahwa kin memperbaiki sentimen Permusuhan yang berlang- Metro Manila kembali dilanda awan gelap dengan serangan terkoordinasi itu yang publik. “Saya telah menyaran- sung bertahun-tahun berpusat beberapa bagian diguyur hujan dan kilatan halilintar, menewaskan 166 orang diran- kan kepada rekan sejawat saya pada pertikaian mereka soal kata Pagasa. cang dan sebagian dilancarkan satu cara dan peta jalan bagi Kashmir, kawasan di Himalaya Wilayah barat Visayas dan Mindanao juga akan dari wilayahnya. Negara itu masa depan,” kata Qureshi yang mayoritas penduduknya mengalami hujan yang menyebar luas. mengadili tujuh tersangka kepada wartawan. Ia menolak beragama Islam. Pemerintah menginginkan provinsi ini agar tetap dalam sidang tertutup yang menjelaskan dengan mengata- Kedua negara menguji bom waspada terhadap banjir bandang dan longsoran dimulai lagi pekan lalu tapi kan ia ingin memberi waktu ke- nuklir pada 1998. lumpur, terutama di Marikina, Pasig dan Rizal. dijadwalkan mulai 3 Oktober. pada pihak India untuk mem- Setelah serangan-serangan Pagasa memantau perkembangan badai tropis di Komentar-komentar yang pertimbangkan proposalnya. Mumbai, India membekukan dekat Guam, yang mengarah ke barat barat-laut ke arah dikeluarkan para menteri pada Krishna menyebut perte- proses perdamaian yang telah Filipina. konferensi pers terpisah mem- muan tersebut “berguna, kons- berlangsung lima tahun. Perte- Hal itu dianggap tak terlalu mengkhawatirkan karena perjelas Pakistan ingin memulai truktif dan tulus” tetapi menga- muan kedua menlu pada Ming- pembicaraan luas mengenai apa takan bahwa untuk dialog ber- gu merupakan yang keempat cuaca buruk masih sangat jauh dari negara, sekitar 1.000 saja dari Kashmir hingga arti “penting untuk menjamin sejak Juni yang bertujuan me- kilometer, namun mungkin akan diperkuat oleh angin perdagangan. lingkungan yang bebas dari mulai kembali dialog. Perte- musim baratdaya pada tempo 24 jam mendatang. Namun, India yang tetap kekerasan, terorisme dan muan-pertemuan itu telah Sementara itu, program berita televisi Balitanghali hati-hati, menuntut aksi lebih ancaman untuk menggunakan berlangsung di sela konferensi mengatakan, para penduduk desa diharapkan secara keras oleh Islamabad untuk kekerasan”. internasional. sukarela membantu operasi pencarian dan penyelamatan meskipun mereka kurang terlatih. Mereka menyatakan ingin membantu menemukan kembali orang-orang yang hilang, kebanyakan dari Kasus Flu Babi Di Vietnam penduduk desa tetangga, yang hilang setelah terjadi banjir besar Sabtu lalu. Dua hari setelah tragedi itu, banyak orang masih Naik Jadi 8.419 berada di atap-atap rumah mereka dengan ketakutan HANOI, Vietnam (Antara/ demikian antara lain isi laporan provinsi dataran tinggi, kata terjadinya banjir lagi, akibat hujan Senin pagi. Xinhua-OANA):Vietnam meng- di laman Kementerian Kese- kementerian itu. Sejauh ini, 6.736 konfirmasi 206 lagi kasus influ- hatan Vietnam, Senin (28/9). pasien telah diperkenankan AP Badai Ondoy juga merusak rumah sakit Marikina, pulang setelah pulih, kata lapor- Sejumlah penduduk berjalan melintasi jalanan berlumpur saat hendak kembali ke rumah termasuk peralatan CT scan dan kamar gawat enza A/H1N1, sehingga me- Di antara kasus baru terse- an tersebut. Vietnam sejauh ini masing-masing di Marikina City, Manila timur, Filipina, Senin (28/9). Banjir tersebut juga daruratnya digenangi banjir akibat hujan lebat itu. naikkan jumlah keseluruhan but, 118 pasien berada di bagian telah melaporkan 13 kematian akibat influenza A/H1N1. merupakan bencana terburuk yang menimpa ibukota tersebut dalam empat dekade terakhir. pasien flu tersebut jadi 8.419, selatan, 69 di utara, dan 19 di
  • 4 Agenda WASPADA Selasa 29 September 2009 Mengenang Saat Jatuh Aktor Pemenang Emmy Pimpin Perhimpunan Hollywood Cinta, KD Terharu Aktor watak Ken Howard dipilih sebagai ketua Serikat Sebagai seorang perempuan, dan memukau tuan rumah serta pada Senin (28/9) pagi dengan Kerja Aktor Layar Hollywood Krisdayanti tentu pernah jatuh undanganyanghadir.KDkembali nomor register 1694/pdtg/2009/ (SAG) Kamis, kata cinta. KD mengenang masa- emosional ketika melantunkan PAJS. Menurut sumber di PA perhimpunan itu, empat hari masa indahnya saat jatuh cinta lagu ‘Mencintaimu’. “Ini untuk Jakarta Selatan, sidang perdana setelah dia memenangkan dengan menyanyi dan terharu. orang-orang yang sa-ling jatuh akan digelar pada 8 Oktober 2009 Emmy untuk film TV HBO Saat menjadi bintang tamu cinta,” tuturnya sebelum menya- mendatang. ‘Grey Gardens.‘ di acara ulang tahun Ketua nyi dengan wajah sendu. Soal materi gugatan cerai, Howard, mewakili kubu UmumPKB,MuhaiminIskandar, Sidang erai C Elsie tak mau membocorkannya moderat dalam perpecahan Minggu (27/9) malam, KD me- Krisdayanti resmi mengaju- karena hanya akan dibahas di tajam di serikat itu, nyanyikan 6 lagu. Saat menya- kangugatanceraiterhadapAnang dalampersidangan.Soalmengapa memenangkan dukungan 47 nyikan lagu ‘Menghitung Hari’, Hermansyah di Pengadilan Aga- KD mendaftarkan gugatan cerai, persen dari suara dalam satu ibu 2 anak itu sempat berhenti ma (PA) Jakarta Selatan. KD pun Elsie mengungkapkan kalau hal pemungutan suara untuk di tengah-tengah lagu dan curhat. berjanjiakanhadirdisidangcerai- itu sudah disepakati.“Anang dan menggantikan Alan “Dua belas tahun lalu saya nya. Yanti kok yang menyepakatinya Rosenberg, yang tak berhasil menyanyikanlaguiniuntukorang “Yanti pernah berbicara ke seperti itu,” imbuhnya. melanjutkan masa jabatan lain, sekarang lagu ini buat saya saya kalau dia niat datang ke si- Pasangan KD dan Anang dua tahunan ketiganya. sendiri,” ujarnya dengan mata dang,” jelas Elsie Lontoh, pe- bercerai secara Islam pada 19 Rosenberg adalah berkaca-kaca di kediaman Mu- ngacara KD, Senin (28/9). Agustus 2009 lalu. Keduanya me- pengikut kubu garis keras tak haimin Iskandar Jl Denpasar Blok KD, melalui pengacaranya nyepakatisoalhakasuhanak akan berhasil menghadapi suatu C3No.5,Kuningan,JakartaSelatan. sudah mendaftarkan gugatan dipegang Anang juga harta gono- kontrak pekerjaan baru KD pun kembalu bernyanyi cerainya di PA Jakarta Selatan gini.(dth) KD dan Anang/ th d dengan beberapa studio pada awal tahun ini. Ken owrd/ uddytv H b a .com Dia mendukung Anne- Lagu Terakhir Michael Jackson Marie Johnson, yang hanya meraih dukungan 33 persen suara untuk jabatan yang tak dibayar itu. mengingatkan diri kami bahwa semua adalah dalam satu tim, berjuang untuk kepentingan yang sama dan hanya dengan Dirilis Oktober Howard, 65 tahun, mengusulkan hu- bungan erat dengan perhimpunan Holly- wood yang lebih kecil, AFTRA (Federasi bersatu kami akan tumbuh lebih kuat,” kata Howard. Howard mendapat penghargaan Minggu Sebelum menghembuskan rika Utara pada 27 Oktober men- Contactmusic, Senin (28/9). Artis Televisi dan Radio Amerika), dalam untuk peran pendukungnya sebagai Phelan nafas terakhirnya, Michael Jack- datang. Namun sesuatu mengubah rangka membuat para aktor lebih kuat Beale, mantan suami ‘si Besar‘ Edie Beale son memiliki satu lagu belum Benci Thriller cara pandang Michael terhadap dalam posisi tawar-menawarnya di dalam ‘Grey Gardens,‘ suatu proyek dirilis. LaguterakhirMichaelJack- Album‘Thriller’milikMichael album tersebut. Kala itu Michael perundingan. berdasarkan dokumentasi mengisahkan son akan dirilis pada Oktober Jackson dirilis tahun 1982 terma- mengunjungi sebuah taman Para anggota SAG hampir sepasang sosialita eksentrik yang hidup mendatang. suk salah satu karya sang King bermain anak-anak. Tiba-tiba ia membatalkan penggabungan itu pada 2003, dalam kemelaratan. Lagu tersebut diberi judul of Pop yang laris manis. Namun sangat ingin memperdengarkan ketika Melissa Gilbert memimpin serikat Dalam pemungutan suara itu, kelompok ‘This Is It’. Single tersebut akan ternyata sesungguhnya, Michael album tersebut kepada seluruh kerja. moderat memperkokoh posisi mereka dirilis pada 12 Oktober. Single ter- membenci album tersebut. dunia. “Meskipun terjadi perbedaan tajam tapi dalam me-nguasai perhimpunan, dengan sebut akan dikemas dalam dua Michael bahkan berencana Tak percuma, akhirnya al- kami terus aktif dalam masalah memenangkan sebagian besar kursi pada CDdenganjudulyangsama.Lagu untuk tak menyelesaikan album bum itu laris sebanyak 100 juta perhimpunan, bahkan terkadang meliputi badan nasional SAG beranggotakan 71 ini juga akan dipilih menjadi pe- tersebut karena menurutnya copy di seluruh dunia. Album strategi dan taktik, kami ingin terus orang.(ant/rtr) nutup dalam film Michael. ‘Thriller’ sangatlah jelek. Bahkan fenomenal tersebut memuat “Film ini akan ditonjolkan se- Michaelsempatmenangiskarena karya Michael seperti ‘Baby Be bagai penutup rangkaian film mengira suara rekaman album Mine’, ‘The Girls is Mine dikerja- Michael dan juga termasuk suara kakak-kakak Michael menjadi tersebut tidak menyenangkan. “Ketika mendengarkan selu- kannya bersama Paul McCartney, ‘Beat It’, ‘Billie Jeans’ dan banyak Figuran Berebutan Main backing vokal,” demikian pernya- ruh album, ada tangis. Saya me- lagi. taan dari website Michael seperti dikutip dari Femalefirst, Kamis nangis seperti bayi. Saya berlalu dari ruangan dan mengatakan Tahun 2001, album tersebut dirilis ulang dengan edisi spesial. Di Film Julia Roberts (24/9). ‘Kami tak akan merilis album ini’,” Disertaiwawancaradariproduser Albuminiakandijualserentak ujar Michael lewat rekaman wa- Quincy Jones dan orang-orang Film bertajuk Eat, Pray, Love tua (dukun, red). Karakter ini dipe-rankan ke seluruh dunia pada 26 Oktober wancara belum sempat dirilis yang membantu album tersebut. dibintangi aktris Hollywood Julia Roberts seorang kakek berusia minimal 70 tahun ichael Jackson/ logspot.com M b mendatang sedangkan di Ame- harian World dan dikutip dari (vivanews/dth) menarik minat ratusan orang. Mereka yang mampu berbahasa Inggris dan berebut menjadi figuran dalam film membaca skrip. berlatar ka-wasan wisata Ubud, Bali. Salah seorang peserta casting Rigas Swan Pacar Anna Nicole Smith Hadapi Tuntutan Berat Seleksi untuk mencari figuran dan pemain latar dalam film lokasi syutingnya di Italia, India dan Indonesia telah berharap terpilih da-lam film yang bakal syuting di Ubud, Gianyar dan Uluwatu, Badung pada 16 Oktober hingga 6 November 2009. Pacar gadis cantik Playboy, Anna Nicole Smith, dan pengacara pecandu. dilakukan bebe-rapa waktu lalu. Casting “Siapa tahu bisa bertemu Julia Roberts,” Stern menyatakan ia tak bersalah atas dak-waan pemain lokal digelar selama dua hari di ujarnya.(dth) Hoeward K Stern didakwa dengan lima tuntutan lagi yang cukup Hotel Sanur Agung, Jalan By Pass Ngurah berat dan berpangkal dari kematiannya pada 2007. paling akhir dalam proses pengadilan Rabu. Rai, Denpasar. Tuntutan tambahan itu —yang sudah diajukan terhadap Smith, pernah menjadi Playboy Playmate, Film ini membutuhkan pe-main figuran ahli ilmu jiwa Smith, Khristine Eroschevich, dan dokter ahli berusia 39 tahun, ketika ia meninggal di Hollywood, dan latar pria dan wanita usia 17-50 tahun, pe-nyakit dalamnya, Sandeep Kapoor— menghadapi empat Florida, pada 8 Februari 2007, akibat kelebihan dosis anak-anak berusia usia 4-12 tahun dan ibu dakwaan memperoleh resep secara curang dan satu dakwaan obat, sekitar lima bulan setelah kelahiran putrinya beserta bayi usianya berkisar 9 bulan pemberian resep, memberikan atau menyalurkan bahan yang dan kematian putranya berusia 20 tahun dan juga sampai satu tahun. dipantau kepada seorang pecandu. meninggal akibat kelebihan dosis obat hanya tiga “Kita butuh puluhan orang untuk Jaksa Los Angeles mendakwa ketiga orang tersebut pada Maret hari setelah kelahiran sau-darinya lain ayah. figuran, sedangkan untuk pemain latar melakukan persekongkolan untuk memberi dia bahan yang dipantau. Menyusul kematian Smith, pergolakan hukum ratusan orang,” ujar Asisten Casting Ketiga orang tersebut telah menyatakan mereka tak bersalah. meletus mengenai siapa yang akan menjadi ayah Director Inneke saat dihubungi Senin (26/ Stern, yang juga adalah seorang pengacara, menghadapi putrinya, Dannielyn Hope. Pemeriksaan DNA 9). tiga dakwaan persekongkolan untuk melakukan kejahatan, memastikan ayah anak tersebut adalah juru kamera Inneke mengatakan, casting film dua dakwaan melibatkan pemberian resep secara melanggar Larry Birkhead, kini telah menjadi wali putrinya. tersebut diminati banyak orang baik dari hukum atas bahan dipantau dan satu dakwaan pemberian Stern juga menyatakan bahwa ia adalah ayah anak Bali maupun luar Bali. Salah satu figuran perempuan itu.(ant) Anna icole Smith/ new N ox s.com f yang sulit ditemukan adalah peran balian Julia Roberts/ npop.com a f resep, pelaksanaan atau penyaluran bahan yang dipantau buat 07.00 Film Keluarga 07.00 Cerita Pagi 07.00 Pororo The 07.05 Indonesia 07.30 Musik : 08.30 Bunga 07.00 Back At 07.30 Inbox 07.00 KiSS This Morning 07.30 I Gosip Spesial Lebaran 08.30 Layar Pagi Little Penguin Derings Rampai Barnyard 09.00 Musik : Dahsyat 09.30 Halo Vaganza 07.30 Metro Xin 08.00 Selamat Pagi 10.30 Nekad’z 07.30 Dino Babies 09.00 Skesa 09.00 Kabar 9 08.00 Go Diego 11.00 Silet Selebriti 08.30 Kid’s Song Wen 09.00 Dorce 11.00 Sidik 08.00 Star Kids Ya 09.30 D’Show 09.30 Kabar Pasar Go 12.00 Seputar Indonesia 10.00 Sinema Pagi 09.30 FTV 08.05 Healthy Life 10.0 Dengarlah Aku 12.00 Layar Iyalah 11.00 Insert 10.30 Pariwara 09.00 Obsesi 12.30 Sergap 12.00 Liputan 6 Drama 09.05 Archielago 10.30 60 Minutes Kemilau 09.00 Espresso 12.00 Reportase 11.00 Opini 10.00 Bukan 13.00 Film Spesial Siang 11.30 Patroli 10.00 Kreasi 11.30 Redaksi Siang Lebaran 13.30 1001 Cerita 10.00 Heboh Siang 12.00 Kabar Siang Sinetron 12.30 Sinema 12.00 Fokus 10.30 The Inter- 11.00 Dimas & 12.00 I Gosip Siang 15.00 Cek & Ricek 14.30 Go Show 11.30 Topik Siang 12.30 Missing 13.30 Expose Siang Siang view Raka 12.30 Bocah 15.30 Mata Mata 15.00 Twist & 12.00 Musik : Klik Lyrics 14.00 Kamus 13.30 Kasak Kusuk 12.30 Happy 11.05 Expedition 12.00 Abdel & Petualang 16.00 Minta Tolong Shout 13.30 Kartun 13.30 Bioskop Kuliner 14.30 Status Song 11.30 Megapolitan Temon 13.00 Laptop Si Unyil 17.00 Seputar Indonesia 17.00 Ninja 15.00 Demian 12.05 Metro Siang Indonesia 15.00 Kabar 15 17.30 Baim Anak Selebriti 14.30 KiSS Sore 13.00 Global 13.30 Cita Citaku Warrior Sang Penakluk 13.30 Economic 15.30 Insert Sore 15.30 Kabar Pasar Sholeh 15.00 Pejuang 15.30 FS : Starlit Siang 14.00 Tom & Jerry 18.00 Putri 16.30 Topik Challenges 16.00 Orang 17.30 Kabar 18.00 Manohara Cinta 17.00 Amira 14.30 FTV 15.00 Asal Usul Fauna Dongeng Petang 14.30 Metro Sore Ketiga The Petang 19.00 Safa Dan Marwah 15.30 Playlist 18.00 Tangisan 16.30 Berita 16.00 Jejak Petualang 19.00 Ingat Ingat 17.00 Mantap 15.30 Public Series 19.00 Bang One 20.30 Cinta Dan 17.00 Liputan 6 Isabella Global 16.30 Redaksi Sore Anugerah Lupa 18.30 Kena Deh Corner 17.00 Reportase Show Petang 19.00 Jiran 17.00 Spongebob 18.30 On The Spot 22.00 Deddy Corbuzier 20.00 Sinema 19.00 Segeerr 19.05 Suara Anda Sore 19.30 Janji Wakil 18.00 Naruto 17.30 Kepompong 20.00 Inayah 20.00 Opera Van Java Master Mentalis Asyik 20.00 4 M 20.30 Inside 18.00 Suami Rakyat 19.00 Big Movies 19.00 Melati 22.00 A Love To 20.45 OKB 23.30 Black And News 21.30 Sinema 21.30 Tawa Sutra 21.05 Top Nine Suami Takut 20.30 Telusur Robon Untuk Marvel Kill News 22.00 Bukan Empat 01.00 Seputar Indone- Layar Lebar 23.00 4 Lawan Istri 21.00 Apa Kabar Hood sia Malam 20.00 Cinta Fitri 00.00 FS : The 21.30 Auto Zone Mata 23.30 Cerita Satu 19.00 Bioskop Indonesia Malam 22.00 Big Movies 01.30 UEFA Champi- 21.30 Terlanjur Hospital 22.05 Today’s 23.30 Begadang Malam 00.00 Topik Indonesia 22.00 World ons League : Cinta 01.00 Fokus Dialogue 00.30 Sport 7 Malam 01.00 Galaxy Malam 21.00 Bioskop Report Creepies Hell On Barcelona vs 22.30 Gala Sinema Malam 23.05 Secret 01.00 Redaksi Malam Kumpulnya Para 00.30 Lensa Trans TV 23.00 Highlight Eigh Legs Dyname Kyiv 01.00 Liputan 6 01.30 Kasih Dan Operations 03.30 Florentina vs Bintang Olahraga Malam 23.00 Bioskop Barclays Premier 00.00 F1 Sensa- Malam Amara 23.30 Metro Sports Trans TV tion Liverpool League 01.00 Buser 00.05 Metro 01.00 Reportase 01.00 MTV Malam Malam Insomnia CATATAN Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan **m30/B
  • WASPADA Selasa 29 September 2009 Nusantara 5 200 Ribu Pendatang Baru Tiba Di Jakarta pendatang baru hanya transit mas, Rofiq Widadi dihubungi Menanggapi fenomena itu, JAK ARTA ( Waspada): Setiap tahun Jakarta bagai di Jakarta, lalu menuju kota lain lewat ponsel mengatakan, para ahli kependudukan Prof. Dr. magnit bagi pencari kerja dari seperti Bogor, Tangerang, pencari kerja itu sedang mem- Ascobat Gani mengaku tidak berbagai daerah di Indone- Depok dan Bekasi. Namun buat kartu kuning untuk bekal terlalu heran. Kenyataan terse- sia. Jumlahnya terus bertam- separuhnya diperkirakan tinggal di ibukota. but menggambarkan belum bah. Tahun 2009 ini diper- di Jakarta. Sejak Kamis (24/9), Dinas semua program pembangunan kirakan 150-200 ribu penda- “Untuk mengantisipasi Sosial Banyumas kembali mela- di daerah berjalan baik. Karena tang baru akan tiba di Jakar- pendatang baru ini kami mela- yani permohonan pembuatan itu ibukota masih dianggap ta bersamaan arus balik leba- kukan pengawasan di terminal kartu kuning setelah tutup ka- sebagai ‘ladang emas’ atau justru ran. Jumlah ini naik diban- dan stasiun. Mereka akan dita- rena libur lebaran. Meski kantor sebagai pilihan akhir. ding 2008 yaitu 88.473 pen- nya apakah sudah punya kete- baru dibuka, ratusan pemohon “Kalau mereka datang datang baru dan 109.617 rangan penduduk yang resmi kartu kuning sudah antre di tanpa bekal, tentunya akan pendatang pada 2007. atau belum,” kata Franky. loket pelayanan. Hingga Kamis menjadi masalah baru. Mereka Sementara, sekira 2.500 siang itu lebih 120 pemohon hanya menjadikan Jakarta Kepala Dinas Kependu- pencari kerja baru dari Banyu- kartu kuning datang. Jumlah itu sebagai pilihan terakhir untuk dukan dan Catatan Sipil DKI Ja- mas, Jawa Tengah akan menyer- naik 300 persen dibanding hari mengadu nasib. Jadi pemulung karta, Franky Mangatas Panjai- bu Jakarta setelah lebaran. Kadis biasanya. “Kalau hari biasa pa- pun akan dilakoni,” tandas- tan menyatakan, sebagian Sosial dan Tenaga Kerja Banyu- ling 30-40 pemohon,” katanya. nya.(dianw) Tim Lima Bertemu Perwakilan LSM JAKARTA (Antara): Tim Sebelumnya, Tim Lima su- posisi itu serta melaksanakan dan diminta melaporkan Lima bertugas memberikan dah bertemu dengan perwakilan tugas, peran dan fungsinya hasilnya kepada Presiden 1 rekomendasi kepada Presiden advokat dan para pemimpin maupun kelayakan dalam aspek Oktober 2009, dan yang terpilih Susilo Bambang Yudhoyono redaksi media massa untuk kepercayaan masyarakat. akan dilantik 2 Oktober 2009,” untuk mengisi pelaksana tugas meminta masukan. Hingga “Tim diberi waktu tujuh hari kata Widodo. pimpinan Komisi Pemberan- pukul 15.45 pertemuan tertutup Antara tasan Korupsi (KPK) bertemu itu masih berlangsung. PERBATASAN PAPUA: Sejumlah anggota personil TNI Yonif 527 Kabupaten Lumajang, memperagakan kondisi siaga dalam operasi pembersihan dan menghadapi musuh, saat inspeksi keberangkatan 650 pasukan Yonif 527 oleh Asop Palingma TNI.Mayjen dengan perwakilan lembaga swadaya masyarakat (LSM) di Presiden menandatangani keputusan presiden (keppres) Penculikan Aktivis 97-98 Supiayadin, di lapangan Batalyon Yonif 527, Lumajang, Jawa Timur, Senin (28/9). Hal tersebut dalam rangka keberangkatan tugas menjaga wilayah perbatasan di Propinsi Papua. Jakarta, Senin (28/9) sore. Tim beranggotakan Menteri tentang pembentukan tim yang akan memberikan rekomendasi Pelanggaran HAM Berat Koordinator Politik, Hukum dan nama calon yang akan menjadi JAKARTA (Waspada): Ketua panitia khusus (pansus) pena- Keamanan Widodo AS, Men- pelaksana tugas pimpinan KPK. nganan pembahasan atas hasil penyelidikan penghilangan orang TNI Siap Berdialog Dengan Keli Kwalik kum HAM Andi Mattalatta, mantan ketua KPK Taufiequrah- man Ruki, anggota timWantim- Sebelumnya, Menteri Koordinator Politik Hukum dan Keamanan Widodo AS menje- secara paksa (1997-1998), Effendi MS Simbolon mengatakan, telah terjadi pelanggaran hak asasi manusia berat dalam peristiwa penculikan dan penghilangan para aktivis 1997-1998. TIMIKA (Antara): Jajaran sia yang terjadi sejak Juli-Sep- perhatian khusus bagi tercipta- Cawapres RI terpilih periode Dia mengatakan itu dalam sidang paripurna dipimpin Wakil TNI di Papua terutama Korem tember. nya situasi kamtibmas yang 2009-2014, Boediono ke Timika, pres Adnan Buyung Nasution, laskan, Presiden ingin agar serta tokoh hukum Todung nama yang diangkat sebagai Ketua DPR RI Muhaimin Iskandar, Senin (28/9) di DPR, Jakarta. 171 Praja Vira Tama (PVT ) Aksi teror itu mengakibat- kondusif di Mimika, khususnya Senin, pihak TNI dan Polri me- Rekomendasi diputuskan pansus setelah mendengar masukan Sorong, siap berdialog dengan kan tiga orang tewas, dua di di areal kerja PT Freeport In- ngerahkan sedikitnya 300 per- Mulya Lubis, bertemu dengan pejabat sementara pimpinan perwakilan dari Lumbung KPK mendapat kelayakan dan melalui rapat dengar pendapat dengan Komisi Nasional HAM Pimpinan Tentara Pembebasan antaranya karyawan perusa- donesia yang dilanda teror sonel gabungan yang bertugas dan rapat dengar pendapaat umum serta masukan dari saksi, Nasional Organisasi Papua haan masing-masing Drew penembakan sejak Juli lalu. mengamankan area sekitar Informasi Rakyat (Lira), Forum dipercaya kredibilitasnya oleh Rektor, Masyarakat Transpa- masyarakat. Karena itu, Presiden para korban dan keluarga korban. Merdeka (TPN-OPM) wilayah Nicholas Grant (warga Australia) Terkait hal itu, Siahaan me- Bandara Mozes Kilangin Effendy melaporkan pansus tidak banyak mendapat masukan Timika, Keli Kwalik. “Kalau dan Markus Rate Alo serta negaskan, penanganan masalah Timika. ransi Indonesia, YLBHI serta membentuk tim yang akan Indonesian Center for Environ- membantunya. dan tambahan data dari pemerintah serta pihak-pihak diduga memang dia (Keli Kwalik-red) seorang lainnya, Briptu Marson gangguan kamtibmas sepe- Selama kunjungan Boedio- sebagai pelaku yang telah direkomendasikan Komnas HAM untuk mau, kita siap berdialog. Saya Petipelohi merupakan anggota nuhnya menjadi kewe-nangan no di Timika yang hanya sete- mental Law. Menurut dia, tidak mudah Pertemuan di Gedung De- memilih nama pejabat semen- mendengar keterangannya. jamin aman dan tidak akan Propam Polda Papua. pihak Kepolisian dengan du- ngah jam untuk melanjutkan Pansus beranggota 50 orang telah terbentuk dalam rapat diapa-apakan,” kata Komandan Menurut Siahaan, setiap saat kungan TNI. perjalanan menuju Wamena, wan Pertimbangan Presiden tara pimpinan KPK. Karena itu, berlangsung tertutup. Dari lima sebelum ditetapkan, Presiden paripurna DPR 27 Februari 2007, dan juga mengalami pergantian Korem 171 PVT Sorong, Kolonel TNI membuka diri berdialog Dia berharap situasi yang Jayawijaya, kondisi kamtibmas ketua yang semua ditugaskan kepada Panda Nababan, selanjutnya Inf. Fransen Siahaan di Timika, dengan jajaran pimpinan TPN- mulai kondusif di areal Freeport di wilayah ini cukup aman. anggota hanya dua anggota yang juga perlu meyakini nama itu hadir yaitu, Adnan Buyung Na- benar-benar memiliki kelaya- digantikan Effendi MS Simbilon. Senin (28/9). OPM untuk mengetahui aspirasi saat ini tetap terjaga dengan “Situasi di Timika saat ini sangat Pada akhirnya pansus merekomendasikan kepada presiden Kelompok TPN-OPM wila- mereka, sekaligus bisa kembali baik agar operasional perusa- aman, mudah-mudahan sution dan Todung Mulya Lubis. kan, baik dalam arti menempati membentuk pengadilan ad hoc, merekomendasikan kepada yahTimika pimpinan Keli Kwalik ke masyarakat untuk memba- haan tetap berlangsung dan masyarakat tetap membantu presiden serta instansi pemerintah serta pihak-pihak terkait selama ini disebut-sebut berada ngun Papua secara bersama- masyarakat sekitar tidak dilanda menjaga keamanan agar Timika melakukan pencarian 13 orang yang oleh Komnas HAM masih di balik aksi teror penembakan sama. ketakutan dan kekhawatiran. bisa menjadi zona damai,” dinyatakan hilang. di areal PT Freeport Indone- Siahaan juga memberikan Berkaitan kunjungan kerja harapnya. Merekomendasikan kepada pemerintah merehabilitasi dan memberikan kompensasi terhadap keluarga korban yang hilang, Warga Jakarta Diminta Berbatik 2 Oktober merekomendasikan kepada pemerintah segera meratifikasi konvensi anti penghilangan paksa sebagai komitmen dan dukungan menghentikan praktek penghilangan paksa di Indonesia. (aya) JAKARTA (Antara): Warga Aurora menyebutkan, itage of Humanity UNESCO, Pemprov DKI akan digratiskan Jakarta diminta mengenakan Gubernur juga mengeluarkan setelah wayang (2005) dan keris mulai 3 hingga 7 Oktober khu- baju batik pada 2 Oktober seba- Instruksi No. 136/2009 tentang (2003). “Selanjutnya sedang sus bagi pengunjung menge- Sidang Paripurna DPD Sahkan gai tanda dukungan terhadap pemakaian batik pada 2 Okto- didaftarkan gamelan dan nakan batik,” ujar Kadis Pari- pengukuhan batik sebagai ber 2009 sebagai seruan bagi angklung,” ujar Aurora. wisata dan Budaya DKI Arie Rancangan Peraturan Tatib warisan budaya dunia bukan seluruh pegawai di lingkungan Untuk 2009, sebanyak 111 Budhiman. JAKARTA (Waspada): Melalui voting sidang paripurna DPD benda oleh Badan PBB Menge- DKI. “Kami sangat menghargai dari total 160 negara anggota Selain itu, khusus Senin, 5 menyepakati Rancangan Peraturan Tata Tertib DPD sebagai bahan nai Pendidikan, Ilmu dan Buda- dukungan warga Jakarta UNESCO mengajukan salah satu Oktober, Taman Margasatwa masukan untuk anggota DPD periode 2009-2014. “Sidang paripurna ya (UNESCO) pada hari tersebut. mengenakan batik pada tanggal budayanya untuk dikukuhkan Ragunan memberikan tiket menyepakati menerima,” ujar Ketua DPD Ginandjar Kartasasmita, Gubernur DKI Jakarta Fauzi tersebut,” kata Aurora. sebagai ICH. “Batik salah satu gratis untuk masuk dengan Senin (28/9) di Gedung DPD Jakarta. Bowo mengeluarkan seruan Batik Indonesia didaftarkan yang terunggul untuk menjadi syarat mengenakan batik. “Ini juga keputusan, bukan berarti tidak ada keputusan,” kata gubernur bernomor 9 tahun oleh kantor Menko Kesejahte- warisan budaya dunia bukan “Segala macam batik diterima, Ginandjar didampingi kedua wakil ketua, Laode Ida dan Irman 2009 tentang pemakaian baju raan Rakyat RI kepada UNESCO benda, tapi keputusan baru bahkan sarung batik dengan baju Gusman, dan calon terpilih anggota DPD 2009-2014. Sebelumnya batik pada 2 Oktober 2009 yang untuk mendapatkan status diberikan 2 Oktober pukul 16:00 koko juga diterima. Mungkin antaranggota DPD dipersilakan berdebat melalui dua termin dikeluarkan 25 September, Intangible Cultural Heritage waktu setempat atau 20:00 yang tidak diterima hanya waktu. sebagai imbauan bagi seluruh (ICH), yang keputusannya akan WIB,” papar Aurora. piyama batik,” kata Arie. Draft Rancangan Peraturan Tata Tertib DPD yang diajukan warga Jakarta. “Ini sebagai ben- diberikan 2 Oktober dari rapat Sementara, untuk menun- Ancol juga memberikan dis- Panitia Perancang Undang-Undang (PPUU) DPD memuat dua tuk dukungan moral dari ma- yang sedang dilakukan mulai jukkan dukungan bagi warga kon 50 persen bagi tiket masuk alternatif tatacara pemilihan pimpinan DPD yang dipilih dari syarakat agar batik bisa diku- 28 September hingga 2 Oktober menggunakan batik, Pemprov gerbang utama, Atlantis dan dan oleh anggota dalam sidang paripurna DPD. Alternatif ke kuhkan sebagai warisan budaya di Abu Dhabi, Uni Emirat Arab. DKI memberikan potongan Gelanggang Samudera. Semen- satu, pemilihan pimpinan DPD dengan prinsip keterwakilan tiga bukan benda,” ujar Deputi Bila permintaan itu dite- harga bahkan menggratiskan tara untuk Dunia Fantasi mem- wilayah RI yang meliputi barat (Sumatera, Kepulauan Riau, Bidang Budaya dan Pariwisata rima, batik akan menjadi tempat hiburan bagi warga yang berikan diskon 40 persen. Sekali Kepulauan Bangka Belitung), tengah (Jawa, Bali, Kalimantan) DKI Aurora Tambunan di Ja- warisan ketiga Indonesia yang mengenakan batik pada hari itu. lagi dengan syarat pengunjung dan timur (Sulawesi, Maluku, Papua, Nusa Tenggara). Model karta, Senin (28/9). terdaftar dalam Intangible Her- “Seluruh museum yang dikelola harus mengenakan batik. ini memilih ketua DPD mendahului wakil ketua DPD. Alternatif kedua, pemilihan pimpinan DPD dengan prinsip Ketua MPR: Pimpinan MPR Cukup 3 Orang Antara keterwakilan tujuh gugus kepulauan RI meliputi Sumatera (Aceh, Sumut, Sumbar, Riau, Jambi, Bengkulu, Sumsel, Lampung, Kepulauan Riau, Bangka Belitung), Jawa (DKI Jakarta, Jabar, Jateng, JAKARTA (Antara): Ketua Padahal menurut dia, ber- (Pansus) DPR sehingga MPR sesuatu yang berkelanjutan dan PENGUNGSI KEBAKARAN: Sejumlah warga mengungsi di kolong DI Yogyakarta, Jatim, Banten), Kalimantan (Kalsel, Kalteng, Kalbar, Majelis Permusyawaratan Rak- dasarkan pengalaman dan hasil tidak memiliki kewenangan memerlukan momentum jembatan Tol, akibat rumah mereka terbakar di kawasan Kaltim), Bali dan Nusa Tenggara (Bali, Nusa Tenggara Barat, Nusa yat (MPR), Hidayat Nur Wahid observasi, jumlah pimpinan untuk melakukan evaluasi UU politik untuk dilakukan. “Perlu Penjaringan, Jakarta, Senin ( 28/9). Warga yang rumahnya Tenggara Timur), Sulawesi (Sulsel, Sulteng, Sultra, Sulut, Gorontalo, menyatakan bahwa sebenarnya yang diperlukan oleh MPR yang telah diamandemen kondisi politik yang obyektif terbakar terpaksa mengungsi di kolong jembatan tol, tenda- Sulawesi Barat), Maluku, Maluku Utara, Papua (Papua, Papua jumlah pimpinan MPR cukup hanyalah tiga orang. “Tentu saja tersebut,” kata Hidayat sesal. dalam masyarakat untuk men- tenda darurat dan di tempat sanak famili. Barat). Model ini memilih ketua DPD sekaligus wakil ketua.(aya) tiga orang saja. disertai penambahan tugas bagi Menanggapi wacana yang dorong dilakukannya aman- Ditemui dalam acara halal masing-masing pimpinan MPR beredar di masyarakat supaya demen terhadap sebuah UU,” bihalal di Gedung DPR-MPR Ja- tersebut”, ujarnya. kembali kepada UUD ‘45 yang kata Fatwa. karta,Senin(28/9),Hidayatmeng- Dalam acara yang dihadiri asli, Hidayat hanya mengatakan Fatwa juga menyatakan ungkapkan dirinya bersama sejumlah pekerja media itu, bahwa dia akan melakukan hal- bahwa kembali kepada UUD ‘45 anggota MPR yang lain pernah Hidayat juga menyampaikan hal yang diperlukan sesuai keten- yang asli juga tidak mungkin. mengusulkan kepada DPR bahwa MPR pernah mengaju- tuan UU yang berlaku. “MPR “Kembali pada UUD ‘45 yang mengenai perampingan jumlah kan usulan kepada DPR me- lembaga yang bertugas mem- asli merupakan langkah mun- pimpinan MPR. “Namun entah ngenai upaya evaluasi terhadap buat UU, sehingga harus me- dur yang tidak rasional, karena mengapa, jumlah pimpinan efektivitas undang-undang yang matuhi UU itu sendiri,” jelasnya. amandemen terhadap UUD MPR malah menjadi lima orang, telah diamandemen. Sementara, Wakil Ketua adalah wujud dari dinamika sementara tugas tidak ditambah “Tapi sayangnya usul itu MPR AM Fatwa menilai bahwa politik masyarakat Indonesia,” melainkan tetap,” katanya. ditolak oleh panitia khusus amandemen UU merupakan sebut Fatwa. Jenazah Susilo Akan Diserahkan RS Lapangan Mudahkan Kepada Keluarganya Penanganan Bencana SOLO (Antara): Jenazah zahnya akan segera diserahkan JAKARTA (Waspada): Men- sono mengatakan, sangat Susilo alias Adib, diduga teribat pihak keluarga Susilo. dukung peran dan fungsi pa- menghargai bantuan Depkes. kasus terorisme dalam penyer- Mengenai perkembangan sukan reaksi cepat penanggu- Dalam situasi dan kondisi daru- gapan di Mojosongo, Jebres, Istri Susilo, Putri Munawaroh langan bencana (PRCPB) TNI, rat, RS lapangan (tenda-tenda Solo, 17 September 2009 diperki- yang dirawat di Rumah Sakit Departemen Kesehatan menye- permanen) mudah didirikan. rakan pekan ini sudah bisa Polri Kamat Jati dalam keadaan rahkan bantuan rumah sakit Selain itu RS lapangan mencapai diambil dan segera diserahkan sehat. “Munawaroh sudah bisa lapangan dan ambulan benca- belasan tenda cukup luas dan kepada pihak keluarganya. bertemu dengan keluarganya. na. Bantuan senilai Rp6,8 miliar dilengkapi pembangkit listrik Kuasa hukum dari anggota Orang tua dan kakaknya sudah diserahkan Menteri Kesehatan, tenaga diesel, tabung oksigen, Tim Pengacara Muslim (TPM), menjenguk di ruamah sakit,” Siti Fadillah Supari kepada Men- berbagai alat kesehatan mema- Anis Priyo Ansori di Solo, Senin kata dia. teri Pertahanan, Juwono Sudar- dai, 100 tempat tidur pasien serta (28/9) mengatakan, pihaknya Menurut Ketua RT 2 RW 11 sono di ruang Leimena gedung 10 tenda operasi darurat. sudah menghadap pejabat Kagokan, Katino, pihaknya be- C Depkes, Jakarta, Senin (28/9). Saat ini sumbangsih TNI Kepolisian Mabes Polri dan lum mengetahui perkemba- Menkes mengatakan, ban- mengatasi kondisi pasca ben- jenazah Susilo diperkirakan ngan tentang informasi jenazah tuan itu merupakan realisasi cana semakin baik dengan pekan ini sudah bisa diambil Susilo, karena yang mengurusi kesepakatan kerjasama antara kehadiran PRCPB. Khusus setelah selesai identifikasi. pemakaman jenazah dari TPM. Depkes dan TNI dalam bidang untuk RS lapangan dan ambulan “Jenazah Susilo paling lambat “Saya mendapat informasi yang pembinaan kesehatan dan bencana, penanganannya ada Sabtu (3/10) sudah diizinkan mengurus jenazah hingga acara pertahanan negara yang terjalin di masing-masing divisi kostrad. diambil dan dibawa ke Solo p e m a k a m a n d a r i T P M ,” sejak 1999 dan diperbarui pada Dalam upaya tanggap ben- untuk dimakamkan,” kata Anis. katanya. 2008. “Bantuan ini selaras cana, Depkes sudah mem- Menurut dia, jenazah Susilo Menurut keterangan pihak dengan UU 24/2007 tentang bentuk 9 pusat penanggulangan belum dapat diambil pihak ke- keluarga Susilo, jenazahnya bencana, yang penjabarannya krisis regional di 9 kota yakni, luarganya, karena polisi masih rencananya dimakamkan di mentitikberatkan pada pening- Medan, Palembang, DKI Jakarta, melakukan identifikasi dan tempat Pemakaman Umum katan koordinasi lintas program Semarang, Surabaya, Banjar- kepolisian memperkirakan Pracimaloyo, Kel. Makam Haji, dan lintas sektor,” kata Menkes. masin, Bali, Makassar dan pekan ini sudah selesai. Jena- Kec. Kartasura, Kab. Sukoharjo. Menhan, Juwono Sudar- Manado.(dianw)
  • 6 Sport WASPADA Selasa 29 September 2009 Hasil lengkap: Catania vs AS Roma 1-1 Chievo vs Atalanta 1-1 Juventus vs Bologna 1-1 Lazio vs Palermo 1-1 Napoli vs Siena 2-1 Parma vs Cagliari 0-2 Udinese vs Genoa 2-0 Sampdoria vs Inter 1-0 Livorno vs Fiorentina 0-1 AC Milan vs Bari 0-0 Klasemen Sampdoria 6 5 0 1 11-5 15 Juventus 6 4 2 0 11-4 14 Inter Milan 6 4 1 1 12-4 13 Fiorentina 6 4 1 1 7-4 13 Udinese 6 3 2 1 10-7 11 Genoa 6 3 1 2 11-10 10 Parma 6 3 1 2 7-8 10 Chievo 6 2 2 2 7-5 8 AS Roma 6 2 2 2 12-12 8 Lazio 6 2 2 2 6-7 8 AC Milan 6 2 2 2 3-6 8 Bari 6 1 4 1 6-4 7 Cagliari 6 2 1 3 5-6 7 AP Napoli 6 2 1 3 8-11 7 Kenwyne Jones melakukan gerakan akrobatik setelah mencetak gol ke gawang Wolves. Palermo 6 1 3 2 7-8 6 Bologna 6 1 3 2 4-5 6 Sunderland Ramaikan Papan Tengah Siena Catania Atalanta 6 1 1 4 7-11 4 6 0 3 3 6-10 3 6 0 2 4 2-8 2 Reuters LONDON (Waspada): Sun- 3 di kandang Wigan Athletic, gol cepat.Yang pertama hasil gol Livorno 6 0 2 4 1-8 2 Penampilan motor serangan AC Milan, Ronaldinho, tak kunjung membaik sehingga timnya mampu ditahan Bari di Giuseppe derland melanjutkan kekuatan mengumpulkan 18 poin seperti bunuh diri John Mensah setelah Meazza, Senin (28/9) dinihari WIB. merekadalammengawalimusim juga Manchester United yang penjaga gawang Craig Gordon Liga Premier dengan kemena- menang 2-0 atas Stoke City. meninju bola lurus ke arahnya. Milan Mandul ngan kandang 5-2 atas Wolver- Pada satu-satunya pertan- Wolves membuat kedudukan hamptonWanderers di Stadium dingan Minggu, Sunderland imbangmelaluitendanganbebas of Light, Minggu (27/9). memimpin2-0padababakkedua Kevin Doyle. Sunderland, musim lalu setelah dua penalti menyusul Sunderlandkembalimemim- nyaris terkena degradasi, naik pelanggarankepadaDarrenBent. pinmelaluitembakanJones.Sete- untuk berada satu level dengan Striker tersebut mencetak gol lah itu, Michael Turner menyun- AstonVilla, Manchester City dan pertama setelah menit kesem- dulkan gol keempat tiga menit Arsenal dengan 12 poin. Totten- bilan, sementara Kenwyne Jones kemudian dan Bent menggenapi ham Hotspur dan Liverpool menyarangkan yang kedua kemenangan dengan mencip- mengumpulkan15poin.Chelsea, setelah menit ke-48. takan gol kelima untuk menam- kehilangan poin untuk pertama Permainan kian seru ketika bahpengumpulangolnyamusim MILAN, Italia (Waspada): Pada duel Serie A ter- lebih untuk Massimo Ambrossini menciptakansatuancamanserius namun tendangannya mudah kalinya musim ini ketika kalah 1- Wolves membalas dengan dua ini menjadi tujuh. (m33/ant/rtr) akhirnya, Milan juga tak men- cs. Sayang, mimpi Leonardo tak ke gawang Milan melalui Paulo diamankan. AC Milan hanya mampu cetak gol saat menghadapi menjadi kenyataan. Vito Barreto. Sepanjang pertandingan itu, bermain imbang tanpa gol Udinese.Merekaakhirnyadipaksa Bermain di kandang, AC Saat itu, tem-bakannya dari Milan menciptakan lima peluang Hasil lengkap: ketika menjamu Bari dalam menyerah 0-1. Pelatih Leonardo Milan malah tertekan. Usaha luar kotak penalti mengarah lurus emas dari 12 kali usaha. pun memahami masalah tum- membangun koordinasi per- ke dalam dekapan Marco Storari. Sementara itu, Bari mela- BordeauxvsStadeRennes 1-0 lanjutan Serie A di Stadion pulnya lini depan Milan. mainan solid kandas oleh Milan belum juga bangkit kukan lima tembakan ke gawang LeMansvsRacingLens 3-0 Giuseppe Meazza, Senin (28/ Menghadapi Bari, ia lugasnya permainan Bari yang ketika Bari berhasil menciptakan dari 17 percobaan. Lille vs Nice 1-1 9) dinihari. Milan pun mencoba formula baru dengan rajin mengejar dan memotong dua peluang beruntun di babak Denganhasilini,Milanmasih Auxerre vs Grenoble 2-0 menduetkanKlaas-JanHuntelaar alur umpan Milan. kedua melalui Massimo Donati tertahan di peringkat ke-11 MonacovsStEtienne 1-2 melanjutkan rekor buruk dan Ronaldinho didukung Cla- Ketika mendapat peluang dan Rivas. dengan delapan poin. Bari sendiri ASNancyvsSochaux 2-1 mereka dengan gagal rence Seedorf sebagai penyerang pun, mereka tanpa pikir panjang Di tengah derasnya serbuan berada persis di bawah Milan FC Lorient vs Paris St Germain 1-1 lubang. langsung melepas ancaman. Bari, Milan menemukan dengan koleksi tujuh poin. MontpelliervsBoulogne-sur-Mer 1-0 mencetak gol dalam dua laga Dukungan para tifosi juga Dari delapan usaha di babak kesempatan unggul melalui OlympiqueLyonvsToulouse 2-1 terakhir. diharapkan memberikan energi pertama, Bari hanya mampu Ignazio Abate di menit ke-76 (m33/rtr) Valenciennes vs Marseille 3-2 AP Yoann Gourcuff berhasil mere- potkan penjaga gawang lawan, namun gagal mencetak gol. Beruntung, Bordeuax meraih hasil maksimal usai unggul 1-0 atas Rennes, Senin (28/9). Bordeaux Kembali Ke Puncak PARIS (Waspada): Juara gerakan cerdas. tahun kekuasaan Lyon untuk bertahan Girondins Bordeaux Klubasalpusat“wine”itunaik meraih gelar pertama mereka membuat Olympique Lyon ha- ke posisi teratas dengan 19 poin dalam 10 tahun pada Mei lalu, nya sebentar di puncak klasemen dari tujuh pertandingan, unggul sekarang sudah menjalani 21 Ligue 1 dengan merebut kembali dua poin dari tim di tempat kedua pertandingan tanpa kekalahan posisi tersebut setelah meraih Olympique Lyon, yang sempat dalam semua kompetisi. kemenangan kandang 1-0 atas memimpin sebentar setelah Sementara itu, Lille mem- Stade Rennes, Senin (28/9). kemenangan kandang 2-1 atas butuhkan gol menjelang akhir Bordeaux hanya sekali men- Toulouse pada Sabtu. pertandingan dari striker Pierre- cetak gol dalam pertandingan “Kami tahu bahwa Rennes Alain Frau untuk meraih hasil yang menghibur itu, melalui adalah tim kuat dan meskipun imbang 1-1 di kandang dengan sundulan gelandang asal Brazil sulit kami sangat menginginkan sesama tim yang terseok-seok, Wendel atas umpan silang dari posisi pertama itu,” kata gelan- Nice. Benoit Tremoulinas pada menit dang Bordeaux Mathieu Chalme Sebelumnya,Nicememimpin ke-23, tetapi menggetarkan fans kepadasalurantelevisiCanalPlus. berkat gol Loic Remy. (m33/ant/ mereka dengan serangkaian Bordeaux, mengakhiri tujuh rtr) AP Vedad Ibisevic (biru) mencetak gol kedua bagi Hoffenheim, Senin (28/9). Torehan tersebut juga tak terlepas dari sepatu baru Ibisevic yang berwarna kuning menyala. Tuah Sepatu Baru Ibisevic Klasemen: HamburgSV 7 5 2 0 17-7 17 Bayer Leverkusen 7 5 2 0 14-5 17 Hoffenheim 7 4 2 1 14-5 14 BERLIN - Striker Hoffen- pekan lalu dipukul Freiburg sendirinya, aku bermain lawan dan mencetak gol Schalke04 7 4 1 2 9-5 13 heim, Vedad Ibisevic, mem- 0-4. dengan sepatu baru dan ketiganya. WerderBremen 7 3 3 1 12-6 12 peroleh manfaat besar dari Ibisevic, musim lalu jadi senang mencetak tiga gol,” Setelah itu, tim tamu VfLWolfsburg 7 4 0 3 15-14 12 sepatu barunya. Melawan pencetak gol terbanyak hing- kata Ibisevic yang sudah sempat mengejar ketinggalan BayernMunich 7 3 2 2 13-7 11 Hertha Berlin, ia mencetak ga paruh musim pertama, bermain tujuh kali musim ini. melalui tendangan bebas kaki Mainz 7 3 2 2 10-2 11 Reuters EintrachtFrankfurt 7 2 4 1 8-8 10 Santi Cazorla cs sudah lama tidak merasakan nikmatnya kemenangan bagi Villarreal. tiga gol alias hatrik untuk hanya perlu waktu 21 menit Sepatu itu setidaknya kanan Raffael. Namun, Hoffe membawa Hoffenheim me- untuk mengemas hatrick membantu pemain 25 tahun kembali mengamuk di babak Freiburg 7 3 1 3 11-12 10 VfBStuttgart 7 2 2 3 9-10 8 Kapal Selam Villarreal Tenggelam nang telak 5-1, Senin (28/9). Berkat kemenangan ini, Hoffe kini merangsek ke perdananya musim ini. Dua gol pertama diciptakan pada lima menit pertama. tersebut melepas tendangan keras dari jarak 15 meter yang berbuah gol pertama. kedua. Striker Nigeria Chinedu Obasi membuat gol di menit ke-58, sebelum Borussia M’gladbach VfLBochum 7 2 1 4 9-15 7 7 2 1 4 8-14 7 posisi ketiga klasemen “Dalam beberapa laga Tiga menit kemudian, giliran Eduardo menjebol gawang Hanover96 7 1 3 3 6-8 6 M A D R I D ( Wa s p a d a ) : BorussiaDortmund 7 1 3 3 6-13 6 Hasil lengkap: sementara Bundesliga. Bagi terakhir, aku tak mencetak kepalanya membuahkan gol Hertha lewat titik putih Villarreal masih mencari Nuremberg 7 1 2 4 4-8 5 Hertha, ini merupakan dua gol dan tak bermain baik. bagi tuan rumah. Pada menit empat menit kemudian. kemenangan pertama mereka Deportivo Coruna vs Villarreal 1-0 Cologne 7 1 1 5 5-10 4 kekalahan beruntun setelah Hari ini gol datang dengan ke-21, ia lepas dari kawalan (m33/ant/rtr) di ajang kompetisi La Liga musim Osasuna vs Sporting Gijon 1-0 Hertha Berlin 7 1 0 6 6-17 3 ini setelah tendangan bebas yang Espanyol vs Xerez 0-0 luar biasa dari Juca memberi Real Mallorca vs Valladolid 3- 0 Deportivo Coruna kemenangan Real Zaragoza vs Getafe 3-0 1-0 di kandangnya di Stadion Almeria vs Racing Santander 2-2 Riazor, Senin (28/9) dinihari. Athletic Bilbao vs Sevilla 0-4 Tendangan melengkung Malaga vs Barcelona 0-2 pemain Brazil itu melesak masuk Real Madrid vs Tenerife 3-0 gawang pada menit kedelapan Valencia vs Atletico Madrid 2-2 dan walaupun Villarreal mem- bangun serangan setelah waktu terus melakukan serangan di lebih berprestasi dan terangkat turun minum, mereka tetap tidak babak kedua dan saya pikir suatu naik ke posisi atas. bisa menembus penjagaan kiper hasil imbang mungkin bisa Atletico Madrid, juga belum Daniel Aranzubia. menjadi hasil yang cukup adil,” pernah menang, berhasil mem- Pelatih baruVillarreal Ernesto kata PresidenVillarreal Fernando bukukan hasil imbang 2-2 di me- Valverde menyaksikan kekalahan Roig kepada televisi Canal Plus. nit akhir saat menghadapiValen- ketiga beruntun klubnya itu dan Valverde bergabung dengan cia. El Che sendiri menempati kinimerekaberadadiposisikedua pelatihValencia Unai Emery dan posisi ketujuh dengan delapan dari papan bawah klasemen pelatih Atletico Madrid Abel poin, sedangkan Atletico di posisi dengan dua poin. Resino dalam berjuang mena- 18 dengan tiga poin. (m33/ant/ “Kami memiliki peluang dan ngani klub mereka untuk bisa rtr)
  • WASPADA Selasa 29 September 2009 Sport 7 Firman Rajai RR Wakil Bupati Buka Pacuan Kuda Tradisionil Gayo Walikota Lhokseumawe TAKENGON (Waspada): Gubernur Aceh batal hadir ke Tanoh Gayo untuk membuka pengikat tali sirahtuhrahim tan- pa membedakan status sosial,” kata Nasaruddin. KOTA LHOKSEUMAWE pesta rakyat berupa pacuan Bupati Dataran Tinggi Gayo kuda tradisionil. itu menyampaikan permintaan (Waspada): Firman Farera Event rakyat itu awalnya maaf Gubenur Provinsi Aceh yang membela Team Yamaha memperebutkan piala bergilir Irwandi Yusup yang tidak dapat gubernur, namun karena tidak hadir ke lapangan H M Hasan Ten Mild Tan’s Motor asal hadir maka pesta rakyat itu Gayo. “Seharusnya, bapak gu- Sumatera Utara, merajai dibuka Bupati Aceh Tengah Ir bernur yang membuka dan H Nasaruddin MM, Senin meresmikan lomba pacuan Road Race Piala Wakil (28/9). kuda kali ini,” sebut Nas. Walikota Lhokseumawe. Event selama sepekan itu Pacuan kuda tradisionil di akan berlangsung di lapangan Gayo Aceh Tengah selama ini Dalam event tersebut, Hasan, M Gayo, Blang Bebang- bukan lagi menjadi agenda Firman memenangkan dua ka Kec Pegasing. Pesta rakyat hiburan rakyat yang diseleng- tahunan itu memperlombakan garakan selama sepekan. Na- kelas seeded, Bebek 4T Tune ratusan ekor kuda dari berbagai mun budaya tradisi yang sudah Up 110 cc dan 125 cc. klasifikasi. berlangsung sejak zaman Belan- Waspada/ist Pembukaan turut dihadiri da (tahun 1938), mulai diminati Bupati Aceh Tengah Ir H Nasaruddin MM menyalami seorang Bupati Bener Meriah Ir Tagore parawisatawan, baik lokal dan peserta pacuan kuda tradisionil, Senin (28/9). Sementara itu, pembalap A B serta beberapa pejabat dari manca negara. Hal itu ditandai andalan Kota Lhokseumawe Kabupaten Gayo Lues. Kuda dengan ramainya masyarakat yang dipacu dalam event ini dari pesisir mengunjungi arena Nova S hanya memenangkan satu kelas pada MP3 (Bebek 4T Tune Up 110 cc Pemula A) setelah bukan hanya berasal dari Aceh Tengah, namun dari Gayo Lu- pacuan. Menurut Drs Zulkifli Rah- Indonesia Petik gagaldikelasMP4(Bebek4TTune Up 125 cc Pemula A) karena wes dan Bener Meriah juga turut ambil bagian. mat selaku Ketua Panpel, fasiltas event rakyat itu terus dibenahi. Kemenangan Kedua tabrakan di race 15 sehingga Dalam sambutannya, Nasa- “Untuk saat sekarang ini kita sepeda motor yang ditung- MANILA (Waspada): Tim bola voli putra Indonesia memelihara ruddin meminta agar ajang pa- mendapatkan kucuran dana peluang masuk babak delapan besar pada Kejuaraan Asia Senior ganginya terpaksa meninggalkan Waspada/Maimun Asnawi cuan kuda itu menjadi semakin Rp1,2 miliar yang akan diper- arena. Wakil Walikota Lhokseumawe, Suaidi Yahya, menyerahkan piala kepada Firman Farera yang ke-15 setelah mengalahkan Thailand 3-0 (25-23, 25-21, 25-20) menambah eratnya tali silatur- gunakan untuk perbaikan la- pada laga kedua yang digelar di kompleks olahraga San Andres, Kejuaraan balap motor seri berhasil memenangi dua kelas seeded pada kejuaraan balap motor seri OMR Yamaha Putaran rahmi. “Kita sebagai masyarakat pangan pacuan kuda dan fasiltas OMR Yamaha Putaran III 2009 III 2009 di Lanud Malikussaleh Aceh Utara. Manila, Filipina, Senin (28/9). yang berbudaya, hendaknya penunjang lainnya,” sebutnya. Kemenangan ini merupakan yang kedua kalinya setelah sehari berlangsung di Lanud Sultan menjadikan ajang ini sebagai (b18/Cir) sebelumnya menundukkan India 3-1. Indonesia yang dilatih Li MalikussalehAcehUtara,Minggu dingkanadalahKelasMP1(Bebek di setiap event kejuaraan balap (27/9), memperebutkan piala Tune Up 110 cc Seeded), Kelas motor dapat menghasilkan racer Qiujiang ini selangkah lagi akan dapat mempertahankan posisi Wakil Walikota Lhokseumawe. MP2 (Bebek Tune Up 125 cc handal yang mampu meng- mereka seperti dua tahun ketika kejuaraan dilaksanakan di Jakarta, Kegiatan yang diselenggarakan Seeded), Kelas MP3 (Bebek 4T harumkan nama Aceh baik di yakni posisi ketujuh. oleh Profesional Speed Lhok- Tune Up 110 cc Pemula), Kelas kancah nasional maupun Indonesia yang tergabung pada Pool B bersama India, Thailand seumawe secara umum MP4 Kelas MP3 (Bebek 4T Tune internasional. dan Jepang. Hanya dua tim teratas yang berhak masuk babak berlangsung sukses. Up 125 cc Pemula), Kelas Bebek Pada kesempatan itu juga delapan besar. India dan Thailand telah sama-sama menderita Ketua Pelaksana Seri OMR 4T Jupiter MX STD Usia 18 Thn, disebutkan, untuk mencegah sekali kekalahan. Dua tim terbaik di Pool B akan menghadapi Yamaha Putaran III 2009, Begem Kelas MP3 (Bebek 4T Tune Up balapan liar di Kota Lhokseu- dua tim teratas Pool D yang diisi juara bertahan Australia, Korea, mengaharapkan, pada tahun- 110 cc Pemula A), MP4 (Bebek mawe, pihaknya merencanakan Lebanon, Qatar dan Maladewa. tahun berikutnya agar kembali 4T Tune Up Pemula A) dan Kelas akan membangun sirkuit Sementara itu, empat tim lainnya diisi oleh dua tim terbaik dilaksanakan kegiatan serupa MP6 (Bebek 4T s/d 125 Open). permanen yang bisa digunakan dari Pool A dan C. Pool A dihuni tuan rumah Filipina, Taiwan, dengan tetap didukung berbagai Sebelum kejuaraan ditutup, untuk latihan atlet dan tempat Kazakstan dan Myanmar, sedangkan Pool C diisi China, Iran, pihak. Wakil Walikota Lhokseumawe penyelenggaran event yang Hong Kong, Vietnam dan Sri Lanka. Tim yang tidak lolos delapan Delapan kelas yang dipertan- SuaidiYahyamengharapkan,agar bersifat open. (cmun) besar, akan berebut peringkat antara sembilan hingga 18. “Karena sudah mengantongi dua kemenangan, 95 persen kita sudah lolos ke babak berikutnya, tinggal menunggu hasil pertandingan lainnya. Kalau Jepang menang terus, maka sudah Net Motorsport Lepas pasti kita akan lolos,” kata Li. Jika melihat kekuatan Jepang selama ini, rasanya tim Matahari Terbit ini akan memenangi semua laga di Pul B. Bila Jepang menang pada tiga laga pul, maka Indonesia akan menemani mereka ke Dian AP Ke Reli Makassar babak delapan besar. “Belum sepenuhnya aman, tetapi peluang kita sangat besar,” ujar pelatih asal China itu. Indonesia pada partai terakhir Pul MEDAN (Waspada): Net fisik cukup diperlukan ujar Dian dak sebagai manajer tim me- B akan menghadapi Jepang, Kamis (1/10). Motorsport Medan melepas AP yang juga Ketua Harian Net nyatakan optimis dengan ke- Menghadapi musuh bebuyutannya di Asia Tenggara, Indonesia pereli andalannya Dian AP Ha- Motorsport. mampuan Dian . menampilkan Ayip Rizal, Affan Priyo Wicaksono, Didi Irwadi, rahap untuk mengikuti seri Dijelaskan mobilnya Mitsu- “Kami lihat tekad Dian Waspada/Setia Budi Siregar Andri, Fadlan Abdul Karim, I Nyoman Rudi Tirtana dan M kedua Kejurnas Reli 2009 di bishi Evolution yang akan di- cukup besar sehingga grafik Ketua Umum KONI Sumut H Gus Irawan SE Ak MM, Ketua Umum Pengprov PASI Sumut Drs Riviansyah. Makassar. pacu berlomba di Grup A kini prestasinya terus naik. Hal itu HM Yahya dan unsur kepengurusan PASI Sumut foto bersama dalam acara halal bi halal di “Di awal pertandingan anak-anak sepertinya agak nervous Ketua Umum Net Motor- sudah sampai di Makassar sudah dibuktikan dalam KFC kediaman Gus Irawan, Jumat (27/9) malam. menghadapi Thailand, namun saya kira Thailand juga sama. sport Dodi Sutanto dalam acara walau rombongan baru ber- Junior Rally penampilan yang Untungnya, pada saat poin kritis, anak-anak bermain lebih tenang sehingga memenangi set pertama,” kata manajer tim Indonesisa Gus Yakin Prestasi Atletik Meningkat halal bi halal di kediamannya tolak Senin (28/9) ini. cukup maksimal mampu mem- Jl Bah Mendaris Medan, Minggu “Mobil telah sampai dan bawa Dian masuk peringkat Heyzer Harsono.(m33/ant) (27/9) malam, menyatakan Net dipersiapkan oleh RFT Manage- keenam di seri pertama,” ung- Motorsport mendukung sepe- nuhnya penampilan Dian AP ment,” ungkap Dian. Sofyan Siregar yang bertin- kap Sofyan. (h09) MEDAN (Waspada): Ketua Umum KONI Sumut H Gus Sumut dan Pengprov PASI Sumut serta 1000-an undangan. binaan Intensif (PPI) yang diga- wei KONI Sumut, PASI Sumut Karate Gagal Rebut Emas Harahap dalam Kejurnas Reli Irawan SE Ak MM mengatakan Gus yang juga Direktur juga menggelar training camp Makasar. GUANGZHOU, China (Waspada): Dua karateka andalan tim yakin prestasi atlet atletik Su- Utama PT Bank Sumut menye- dengan mengasramakan atlet Indonesia, Umar Syarif (kelas +80 kg) dan Donny Darmawan “Dian AP diharapkan bisa matera Utara terus meningkat butkan, KONI Sumut sangat potensial meraih medali. (-60 kg), gagal memenuhi target emas pada Kejuaraan Asian memberi kontribusi dalam dalam persiapan menghadapi apresiatif dengan Pengprov- PASI Sumut juga berencana Karate-Do Federation (AKF) di Guangzhou, China, Minggu Kejurnas Reli sekaligus menjadi PON XVIII 2012 di Riau. pengprov top olahraga. Dalam mengirimkan atlet berlatih ke (27/9). duta Sumut dalam event ini. Se- Ini bukan tak beralasan ka- suasana Idul Fitri ini, Gus luar negeri. Sebut saja Zulkar- Keduanya dinyatakan kalah pada partai semifinal melawan bab itu, kita harapkan doa restu rena atlet hingga Agustus lalu mengajak para pengurus khu- nain Purba yang sekarang me- karateka Iran dan Brunei. “Memang di luar dugaan Umar kalah dari masyarakat Sumut khu- mengalami peningkatan secara susnya para atlet terus termo- ngikuti Pelatihan Atlet Andalan atas Zabiola Poorshab dari Iran dan Doni kalah melawan Muhd susnya insan otomotif Sumut bertahap di kejuaraan nasional tivasi dalam mencapai prestasi (PAL) hasil program Kantor Fiday dari Brunei,” kata Ketua Binpres Federasi Karate Indo- sehingga ia bisa meraih prestasi junior maupun senior. menggembirakan, khususnya Kementerian Pemuda dan nesia (FORKI) Madju Daryanto. maksimal dalam event terse- “Pengurus PASI Sumut da- dalam PON mendatang. Pada Olahraga (Kemennegpora) dan pat bekerjasama dalam me- PON 2008, Sumut menduduki KONI Pusat. Menurut Madju, gagalnya Umar dan Donny itu telah but,” kata Dodi Sutanto didam- memupuskan harapan tim Indonesia untuk merebut medali pingi sekretaris umum Sofyan ningkatkan prestasi atlet. Ca- ranking tujuh dengan raihan 20 Lainnya seperti Edi He- bang olahraga atletik sebagai medali emas. rianto Harahap (800m/1500m), emas AKF, karena keduanya memang menjadi andalan dari 21 Siregar, penasehat Andre Ismail karateka yang diberangkatkan mengikuti kejuaraan itu untuk Nasution, Bambang dalam aca- salah satu penyumbang medali Sementara itu, Ketua Nyai Agita Prima Siregar emas tentunya diharapkan Umum PASI Sumut Drs HM (3.000m st Chase), Dimas Su- mendapatkan medali emas. ra yang juga dihadiri Pangkosek “Sayang memang keduanya kalah, apalagi kami menilai Hanudnas Marsma TNI Chai- dapat menambah perolehan Yahya didampingi Ketua Bidang mantri (lempar cakram), Zul- medali emas di PON XVIII,” Pembinaan dan Organisasi OK ham (tolak peluru), M Ridwan pertandingan tidak berjalan dengan fair dan banyak merugikan rudin Ray. karateka Indonesia,” katanya. harap mantan Ketua Umum Zenilhar SE, Sekum Irwan (lontar martil) serta atlet junior Melihat grafik prestasi yang PASI Sumut itu dalam acara Pulungan SSos, Bendahara Zul- Nur Ainun (800m) yang prestasi- Pihaknya sempat melayangkan protes kepada Asia Karate terus meningkat dengan me- halal bi halal di kediamannya karnain menyampaikan, atlet nya menggembirakan di Ke- Federation (AKF) karena menilai wasit salah dalam memberikan nempati peringkat 6 besar Komplek Perumahan Setia Budi terus mengikuti program la- jurnas dan tingkat pelajar se Asia keputusan pada pertandingan antara Umar Syarif dengan Zabiola dalam seri I KFC Junior Rally Waspada/ist Indah, Jumat (27/9) malam. tihan. Selain Program Pem- Tenggara. (m20) Poorshab. Namun protes itu tidak membuahkan hasil dan justru dan lima besar Kejurnas Sprint Pereli Dian AP (dua kanan) dilepas untuk berlomba ke Kejurnas Halal Bi Halal dengan tema karateka kawakan timnas itu didiskualifikasi. 2008 di Sumut, Dodi Sutanto Reli Makasar dalam acara yang dihadiri Pamgkosek Hanudnas “Bersama Membangun Umat” “Padahal kami punya rekaman pertandingan yang menargetkan pereli andalan tim Marsma TNI Chairudin Ray, Sabtu (26/9) malam. Terlihat Ketua turut dihadiri Wakil Gubernur membuktikan bahwa Umar yang terkena pukulan, namun AKF Net Motorsport Dian AP nan- Umum Net Motorsport Dodi Sutanto (dua dari kiri), penasehat Sumut H Gatot Pujo Nugroho, tetap pada keputusannya dan menyatakan Umar terkena tinya mampu masuk posisi 5 tim Andre Nasution (kanan) dan manajer tim Sofyan Siregar Kapoldasu Irjen Pol Badrodin diskualifikasi,” kata Madju kecewa. besar nasional di Kejurnas Reli (berdiri). Haiti, keluarga besar PT Bank Atas keputusan AKF itu pihaknya memang tidak tinggal diam, yang akan berlangsung 3-4 dan akan melayangkan protes ke Word Karate Federation (WKF). Oktober ini. Dengan keputusan AKF itu, Umar Syarif dan Doni harus puas Apalagi dalam penampilan dengan medali perunggu. (m33/ant) kali ini, Dian AP akan didam- pingi navigator andal Sumut PSMS Kembalikan Ciri Khas Edwin A Nasution. Dalam kesempatan itu, Dodi berterimakasih atas dukungan Pengprov IMI Sumut dan PT MEDAN (Waspada): Per- mainan keras dalam batas spor- tivitas bakal menjadi andalan bur bintang.Tanpa pemain asing dan pemain top asal Pulau Jawa dan Papua, Suimin diharuskan PS Bank Sumut. Di laga per- tama, PSMS mengungguli PSDS 1-0 dan kembali menang 2-0 Sudoku para laskar Ayam Kinantan mengemas skuad PSMS yang atas Dharma Putra. Lalu ber- Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada Barumun Palma Nauli serta PT menghadapi kompetisi Divisi solid dan ini bukan pekerjaan main imbang melawan PS Bank pengulangan angka mendatar, menurun, maupun di dalam kotak Tanto Jaya dalam penampilan Utama Liga Indonesia 2009/ mudah mengingat waktu cukup Sumut 1-1 dan hasil serupa saat 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu tim Net Motorsport ini ke Ma- 2010. sempit. bertandang ke Stadion Baha- kassar. Pasalnya, dalam tiga hari “Affan Lubis dan kawan- roeddin Siregar. pertimbangan dan logika. Jawaban di kolom 8. 1 Dian AP dalam kesempatan latihan pasca libur Idul Fitri, kawan tidak boleh memberikan Dengan hasil lima mema- itu menyatakan sudah melaku- kan persiapan menjelang pe- arsitek PSMS Suimin Dihardja menggenjot habis pressing peluang bagi lawan memegang bola lama-lama. Lawan dapat sukkan dan dua kemasukan dari empat pertandingan, Suimin 1 7 5 3 8 6 nampilan di Makasar. Ia telah melakukan persiapan fisik. pemain. Kalau Jumat (25/9) Suimin bola, terus melakukan pres- sing. Kabarnya, kompetisi ber- kembali memutar otak dalam menyusun strategi. Top skor se- 6 5 7 menerapkan individual pressing, gulir awal Oktober namun kami mentara PSMS dipegang Jecky 4 “Kita dapat informasi trek di Makasar cukup berat dan melelahkan sehingga untuk maka Sabtu (26/9) latihan pressing team. Pelatihan ekstra belum menerima jadwal kom- petisi. Seharusnya sekarang ini dengan tiga gol, disusul M Affan Lubis dan Febry masing-ma- 9 mengatasi lintasan yang terdiri dari 16 special stage, kesiapan keras di bawah komando Sui- min bersama asisten Suyono, Jamaluddin Hutauruk dan sudah diketahui kapan dilak- sanakannya kompetisi,” aku Suimin. sing satu. Suimin pun tidak memung- kiri skuadnya kali ini merupakan 9 6 2 1 7 1 5 3 8 6 1 9 4 2 3 8 2 7 9 5 6 4 Nimrot Manalu sebagai pelatih fisik. Cukup beralasan, karena Suimin harus mempersiapkan perpaduan wajah lama dan baru.Wajah lama tampak M Ha- 7 2 3 9 2 4 7 7 5 6 1 5 9 8 6 1 4 3 8 “Kita tidak bisa main-main. Pemain harus digenjot sema- ngat dan stamina, namun tidak program misalnya pertandi- ngan ujicoba di antaranya laga segitiga antara PSMS, Persidi lim dan Sony Gunawan (pen- jaga gawang), Selamet Riyadi (belakang) dan M Affan Lubis 6 9 5 7 9 8 6 4 5 1 3 2 8 7 4 6 1 9 2 3 7 5 mengesampingkan teknik in- dividual,” terang Suimin, Ming- Pidie (Aceh Timur) dan Penang FC Malaysia. (tengah). “Pemain lama dibutuhkan 8 4 5 2 3 gu (27/9). Sebelumnya, Ayam Kinan- pengalamannya. Kalau pemain 5 1 9 6 3 7 4 8 2 PSMS menggelar latihan tan menggelar empat pertan- debutan, selain diharapkan sta- pagi dan sore setiap hari kecuali dingan masing-masing dua pe- mina dan teknik prima juga di- Waspada/Handaya Wira Yuga 8 5 7 7 2 5 6 9 2 4 8 1 3 6 9 6 8 3 4 9 2 5 7 1 Minggu, berbeda dengan skuad nampilan melawan PSDS Deli butuhkan mental dan team Pelatih fisik PSMS Nimrot Manalu (kanan) serius mengawasi latihan PSMS sebelumnya yang berta- Serdang, PS Dharma Putra dan work,” tambahnya. (m20) pemain di Stadion Kebun Bunga Medan baru-baru ini.
  • 8 Sport WASPADA Selasa 29 September 2009 Akhir Tragis Bagi Sugiyama TOKYO (Waspada): Petenis nomor satu dunia, Hasil lain Dinara Safina, secara mengejutkan menelan Kateryna Bondarenko (Ukraina) vs Anna-Lena Groenefeld (Jerman) 6-3, 6-1 kekalahan 7-6, 4-6, 7-5 dari petenis kualifikasi asal Samantha Stosur (Australia) vs Alexa Glatch (AS) 7-5, 6-0 Taiwan Chang Kai-chen pada pertandingan Vera Dushevina (Rusia) vs Alona Bondarenko (Ukraina) 1-6, 7-5, 6-1 pertamanya di Turnamen Pan Pacific Terbuka, Daniela Hantuchova (Slovakia) vs Jill Craybas (AS) 6-3, 6-3 Marion Bartoli (Perancis) vs Sorana Cirstea (Rumania) 6-3, 6-0 Senin (28/9). Magdalena Rybarikova (Slowakia) vs Urszula Radwanska (Polandia) 6-4, 6-4 Petenis Rusia ini, tersing- ma pada 2009 dan juga mela- pada putaran pertama se- sus datang ke Ariake Colos- kir pada babak ketiga AS Ter- kukan awal yang buruk di kaligus mengakhiri karirnya seum untuk menyaksikan per- buka, susah-payah sejak awal Tokyo. di tunggal putri secara menye- tandingannya. pertandingan ketika melawan Di laga lain, juara Perancis dihkan. Adalah sakit yang “Rasanya amat mengesan- pemain yang peringkatnya Terbuka Svetlana Kuznetsova menjadi penyebab Sugiyama kan dapat memenuhi impian 131 tingkat di bawahnya. “Ini juga tersingkir di setelah mundur pasca bertarung sel- kita semasa kecil. Saya mem- saat yang tidak mudah. Saya dikalahkan petenis Jerman ama 17 tahun. buat tujuan baru lagi dalam memiliki banyak peluang pa- Andrea Petkovic. Unggulan Petenis berusia 34 tahun dunia tenis saya, yaitu masuk da set ketiga namun saya kelima asal Rusia, mendapat yang juga mantan juara dunia urutan lima besar. Tapi saya membiarkannya berlalu be- bye pada babak pertama ber- ganda putri itu mengaku sakit kembali bertanya kepada diri gitu saja,” kata Safina. sama tujuh pemain unggulan ketika melawan Nadia Pe- saya, mengapa ketika masih Kekalahan ini kian men- lainnya, menelan kekalahan trova (Rusia) dalam keadaan kecil saya tidak bermimpi jadikan posisi nomor satu Sa- 5-7, 6-4, 3-6 pada petenis pe- skor 6-0, 2-1. Mundurnya Su- menjadi petenis nomor satu fina sumber pertarungan se- ringkat 58 itu. giyama turut mengecewakan dunia?” katanya. telah kegagalannya menjuarai Petenis tuan rumah Ai Su- pada pendukungnya, terma- turnamen Grand Slam perta- giyama juga terpaksa mundur suk Putri Michiko yang khu- (m33/ant/rtr) Gelar Kedua Monfils METZ, Perancis keenam set kedua untuk (Waspada): Unggulan menyamakan kedudukan, utama Gael Monfils (foto) namun Monfils kembali mengalahkan unggulan bangkit pada set penentu kedua Philipp dan menutup permainan Kohlschreiber 7-6, 3-6, 6-2 dengan menggunakan pada final Turnamen Metz pukulan forehand Terbuka, Senin (28/9), kemenangan pada game sehingga mendapatkan keenam. gelarnya yang kedua di “Saya gembira dapat Perancis. menunjukkan permainan Monfils, 23, selama ini yang benar sehingga mengincar gelar sejak memenangi set kedua dan meraih kemenangan pada ketiga. Saya gembira 2005 di Sopot, Polandia. Ia karena meraih gelar untuk kalah pada pertandingan kedua kalinya dalam final sejak turnamen di Perancis,” kemenangannya itu. kata Monfils. Melawan Kohlschreiber, “Ini amat Monfils memperagakan membanggakan tetapi gerakan cepat dan saya belum puas. Saya pukulan keras untuk baru merasa lega bila mengakhiri pertandingan nanti dapat memenangi dalam dua jam 13 menit Prancis Terbuka,” katanya itu. petenis yang menun- AP Kedua petenis sama- jukkan ketangkasan prima sama melancarkan servis permainan tiebreak yang cukup keras. sejak awal tampil di Metz. keras pada set pertama dimenangi Monfils 7-1 Kohlschreiber berjuang AP sehingga dibutuhkan lewat pukulan backhand kembali pada game (m33/ap) Ai Sugiyama (kiri) turut dihibur petenis Rusia Nadia Petrova setelah terpaksa mengakhiri karirnya secara tragis di putaran pertama Turnamen Pan Pacific Terbuka di Tokyo, Senin (28/9). Glock Kaget Finish Kedua SINGAPURA (Waspada): “Itu adalah balapan yang “Saya tahu sebelum ke semangat. Kami berkonsen- Para penonton GP Singapura sangat bagus buat saya. Start- sini, kami bagus dan bisa mem- trasi pada mobil dan kru,” pasti terkejut mendapati na- nya sedikit kacau di tikungan buat perbedaan. Jadi dari la- kata Glock. ma Timo Glock (foto) sebagai pertama. Saya tahu saya tidak tihan kami langsung tampil (m33/kez) penghuni posisi kedua. Jelas secepat dua atau tiga pem- saja, bahkan Glock sendiri pun balap terdepan, jadi saya ber- tak percaya dengan penca- konsentrasi dengan apa yang paiannya. bisa dilakukan,” cetus Glock Setelah menempuh bala- seusai lomba. pan sepanjang 61 lap di sirkuit Hasil finish kedua adalah jalan raya Marina Bay, Singa- hasil terbaik bagi Glock tahun pura, Minggu (27/9), Glock ini. Pembalap Jerman itu me- finish di posisi kedua di bela- mang pernah merebut podium kang Lewis Hamilton yang kedua juga, tetapi itu terjadi menjadi pemenang. pada GP Hungaria tahun lalu. AP PELABUHAN INDONESIA I PENGUMUMAN PELELANGAN Nomor: UM58/24/12/PI-09 PT Pelabuhan Indonesia I (Persero) akan melaksanakan Pelelangan Umum dengan Pascakualifikasi menggunakan dana internal PT Pelabuhan Indonesia I (Persero) sebagai berikut: Reuters No. Nama Klasifikasi: Kualifikasi Perkiraan Nilai Phil Mickelson (kiri) memegang trofi Tour Championship Pekerjaan Bidang/Sub. Bidang Pekerjaan (Rp) didampingi Tiger Woods yang memenangi trofi FedEx Cup, Senin (28/9). 1 Perbaikan Kerusakan Sipil/Pelabuhan (Gred 5) 7.875.000.000,- struktur Dermaga atau dermaga Internasional Belawan Interna- tional Container Terminal. 1. Persyaratan Peserta: a. Memiliki Surat Izin Usaha (SIUJK/SBU Jasa Pelaksanaan Konstruksi) yang masih berlaku. b. Perusahaan yang bergerak dalam bidang Sipil, Subbidang Pelabuhan atau Dermaga. c. Dalam waktu 7 (tujuh) tahun terakhir telah berpengalaman dalam perbaikan Struktur Dermaga Pelabuhan Laut dengan nilai pekerjaan minimal Rp. 3.937.500.000,- (Tiga milyar sembilan ratus tiga puluh tujuh juta lima ratus ribu rupiah). 2. Persyaratan Pendaftaran a. Pendaftaran harus dilakukan sendiri oleh pimpinan perusahaan yang namanya tercantum dalam akte pendirian perusahaan/daftar susunan pengurus perusahaan atau dikuasakan dengan menunjukkan KTP asli yang masih berlaku. b. Pada saat mendaftar menyerahkan foto copy Surat Izin Usaha (SIUJK/SBU Jasa Pelaksana Konstruksi) yang masih berlaku, Akta Pendirian Perusahaan yang telah disahkan oleh Menteri Kehakiman (berbentuk PT) dan oleh pengadilan (Badan usaha yang lain), pengalaman kerja perusahaan, KTP pendaftar (seluruhnya memperlihatkan aslinya). c. Pada saat mendaftar menandatangani Pakta Integritas. d. Membayar biaya pengganti dokumen lelang sebesar Rp 750.000,- (tujuh ratus lima puluh ribu rupiah). 3. Pendaftaran dan pengambilan dokumen lelang pada: a. Hari : Rabu s.d. Jumat (pada hari kerja) b. Tanggal : 30 September s.d. 2 Oktober 2009 c. Jam : 08.00 s.d. 16.00 WIB d. Tempat : Kantor Pusat PT (Persero) Pelabuhan Indonesia I, Biro Logistik Lantai III, Jln. Krakatau Ujung No. 100 Medan. 4. Aanwijzing pada: a. Hari : Selasa (pada hari kerja) b. Tanggal : 6 Oktober 2009 c. Jam : 10.00 WIB d. Tempat : Kantor Pusat PT Pelabuhan Indonesia I (Persero) Biro Logistik Lantai III, Jln. Krakatau Ujung No. 100 Medan. Medan, 28 September 2009 PT PELABUHAN INDONESIA I (PERSERO) BIRO LOGISTIK
  • WASPADA Selasa 29 September 2009 Medan Metropolitan 9 Bupati-Walikota Diminta Waspadai Banjir MEDAN (Waspada): Gubsu sialisasi kepada masyarakat un- an sekaligus untuk membahas kembali mengingatkan para tuk mewaspadai fonemena apakah masa tanggap darurat bupati dan walikota memper- alam ini,” tegas Gubsu didampi- masih diperpanjang atau dihen- siapkan satuan pelaksana ben- ngi Kadis Kominfo, Eddy Syofian. tikan” ujar Kadis Kominfo cana alam seiring laporan Bagi masyarakat yang ting- kepada wartawan. Badan Meteorologi Klimatologi gal di bantaran sungai agar Menurut Eddy Syofian, dan Geofisika (BMKG) yang melakukan kewaspadaan Gubsu telah memerintahkan mengumumkan peringatan bahkan siapkan ronda untuk Sekdapropsu untuk melakukan dini akan terjadinya hujan lebat, mengantisipasi munculnya inventarisasi permasalahan dan petir dan angin kencang di banjir. Gubsu juga kembali menugaskan Bappeda Sumut wilayah Sumatera Utara. mengingatkan untuk tidak bekerjasama dengan Pemkab “Laporan BMKG sampai melakukan penebangan liar Madina menyusun daftar kebu- akhir tahun wilayah Sumut dan minta aparat di daerah tuhan dalam menyiapkan berpotensi hujan lebat disertai melakukan pengawasan dan tahap masa Rehabilitasi dan petir dan angin kencang sehing- tindakan hukum bagi pelaku- Rekonstruksi. ga berpotensi menimbulkan pelaku illegal logging. Dalam masa rehabilitasi banjir besar seperti yang pernah Menurut informasi BMKG, dan rekonstruksi Gubsu telah terjadi di Bahorok maupun di fonemena alam ini akibat akti- menugaskan Sekda membahas Madina,” kata Syamsul Arifin fitas daerah tekanan rendah di dengan pihak pusat atas kerugi- kepada wartawan di Gubernu- Samudra Pasifik sebelah timur an material baik infrastruktur ran Medan, Minggu (27/9). Filipina mempengaruhi kondisi dan fasilitas publik milik pe- Gubsu mengatakan, lapo- atmosfir di wilayah sekitar merintah maupun milik ma- ran BMKG dalam kurun waktu Indonesia dengan terbentuknya syarakat termasuk persawahan 3 hari kemarin curah hujan cu- daerah pusaran angin yang me- dan pertanian lainnya. kup tinggi mencapai 273/mm manjang dari Sumatera Bagian Dalam kesempatan ini selama 8 jam rata-rata. Padahal Utara, Laut China Selatan dan Gubsu juga meminta Pemkab banjir bandang di Bahorok perairan lainnya. Madina agar menugaskan Di- tahun 2002 curah hujan hanya Sementara dilaporkan, Wa- nas Pendidikan setempat untuk mencapai 101/mm. gubsu Gatot Pujonugroho, Se- tetap menjalankan proses bela- Karenanya kata Gubsu, bagi nin (28/9), memimpin Rakor jar mengajar di pengungsian daerah kabupaten/kota yang Penanggulangan Bencana di karena mulai Senin ini proses berpotensi hujan lebat seperti Kecamatan Natal Madina seka- belajar akan dimulai. Medan, Deliserdang, Sergai, ligus memantau dampak ben- Dalam kunjungan ke Ma- Langkat, Asahan, Labuhan cana yang sampai hari ini masih dina, Wagubsu juga menyerah- Batu, Tebing Tinggi, Sibolga dan masa tanggap darurat yang kan bantuan dana tanggap da- Madina agar melakukan kewas- akan berakhir 29 September. rurat dari Gubernur Sumatera padaan dini. “Bapak Wagub memimpin Utara sebesar Rp100 juta dan “Siapkan kebutuhan logis- Rakor yang diiikuti pimpinan diharap agar semua bantuan Waspada/Surya Efendi tik, obat-obatan, kebutuhan SKPD Provinsi dan Pemkab yang masuk dicatat dengan FLY OVER AMPLAS: Kendaraan roda dua melaju di atas fly over Amplas, Senin (28/9). Fly over yang dibuka untuk mengantisipasi arus mudik dan arus balik penanggulangan bencana dan Madina untuk mengevaluasi baik, akuntabel dan trans- itu sangat tepat. Kondisi persimpangan Terminal Terpadu Amplas yang biasanya padat kini lancar. yang paling penting berikan so- bantuan dan kendala di lapang- paran.(m19) Pembongkaran Kios PLN Belum Dapat Di Atas Parit Gagal MEDAN (Waspada): Ren- cana pembongkaran terhadap Suwarno, rencana pembong- karan dilakukan sesuai surat gang, mengatakan keberatan digusur alasannya karena mere- Pastikan Listrik Normal beberapa lapak pedagang kaki lima dan bangunan kios di atas parit di Jalan Bhayangkara Ujung/Simpang Jalan Pancing gagal dilaksanakan, akibat lambatnya alat berat (skopel) perintah Camat Medan Tem- bung, Azwanto, pada 12 Agustus 2009 dan 24 September 2009. Sebelumnya, camat telah me- minta agar pemilik bangunan kios/PKL segera membongkar ka sudah bertahun-tahun ber- jualan di lokasi itu. Pedagang, Suherman dan Suhendro, mengatakan, mereka telah membayar uang sewa ke- pada Golkar Sinulinnga Cs yang MEDAN (Waspada): PT PLN (Persero) Wilayah sedang dilakukan proses pemu- sebesar 20 MW, dan pelanggan tu rumah tangga. Pemadaman dan personel PP Pemko Medan bangunan sebelum ada pem- mengaku sebagai pemilik kios. Sumatera Bagian Utara belum dapat memastikan lihan secara maksimal sehingga industri (TT) sebesar 70 MW. sering membuat kacau rencana turun ke lokasi, Senin (28/9). bongkaran dari Pemko. Na- “Silahkan gusur, tapi beri dapat kembali beroperasi da- Begitupun untuk pelanggan RT menyiapkan sarapan anak- Lurah Indra Kasih, Kecama- mun, imbauan itu tidak kami diberi ganti rugi untuk pasokan listrik ke pelanggan normal kembali, lam waktu yang tidak lama lagi. kita akan melakukan pemera- anak dan menyiapkan makan tan Medan Tembung, Ramli diindahkan. tempat usaha,” ujar pedagang setelah terjadi gangguan pembangkit besar di Seperti 27 September 2009, satu taan seadil-adilnya. malam untuk keluarga. Lubis, mengatakan, meski gagal Secara terpisah, koordinator itu menambahkan camat Me- Belawan pada 24 September 2009 yang unit GT dan sebagian PLTU te- “Setelah nantinya kembali Demikian Kemalawati, dilakukan kemarin, pembong- alat berat Dinas Bina Marga Ko- dan Tembung jangan meman- lah kembali normal atau dapat normalnya PLTU Labuhan Divisi Hukum dan HAM, Badan karan tetap akan dijadwal ulang. ta Medan, Buchari, mengata- faatkan surat edaran walikota menyebabkan 38,07 persen daya atau sebesar 495 Sedangkan skopel hari itu baru kan, kendala lambatnya turun terkait penggusuran untuk ke- memasok daya ke sistem kelis- Angin pada 30 September nanti, Kerjasama Organisasi Wanita MW hilang. trikan sebesar 190 MW. maka defisit akan mengalami (BKOW) Sumut, Senin (28/9). datang sejam lebih dari waktu skopel ke lokasi itu karena hari pentingan kelompoknya. “Sedangkan PTLU Labuhan penurunan sehingga pemada- Menurut Kemala, Gubsu yang ditentukan pukul 09.00 bersamaan mereka member- Masalah ini juga telah di- Pasalnya, kerusakan diaki- bali,” ujarnya. Angin berkapasitas 115 MW man tidak mencapai 4 jam kem- harus memberikan perhatian yang telah dihadiri pejabat sihkan lapak dan bangunan kios adukan pedagang kepada ketua batkan pemakaian secara mak- Namun, lanjutnya, jika opsi direncanakan akan berfungsi bali,” sebut Pasaribu. Dia atas serius terhadap masalah ini. Bila Muspika. di atas parit di Jalan Bulan dan DPRD Kota Medan (Komisi C) simal menjelang Ramadhan itu tidak berhasil maka kita akan kembali Rabu (30/9). Dan untuk nama manajemen PLN Sumba- perlu ikut memberikan masu- Menurut Ramli didampingi Sutomo. tertanggal 1 November 2008 hingga Hari Raya Idul Fitri, se- melakukan pembelian ke ma- satu unit GT lainnya akan di- gut menyampaikan permoho- kan kepada PLN agar pemada- Kasie Trantib, Medan Tembung, Secara terpisah, para peda- dan 1 Desember 2008. (m25) hingga beberapa mesin pem- nufacturing yang memungkin- usahakan akan pulih dalam nan maaf atas ketidaknya- man tidak dilanjutkan lagi. bangkit mengalami gangguan. Bahkan ada suku cadang (spare- kan memakan waktu yang cukup lama atas persediaan waktu dekat karena masih me- manan yang ditimbulkan akibat Apalagi, kata Kemala, Gubsu Kuis THR Waspada-Honda Periode IV Berakhir nunggu perbaikan kerusakan pemadaman. pernah berjanji tahun 2009 ini part) yang rusak dari mesin sparepart tersebut. pembangkit sampai kemarin masih dicari di gudang mesin General Manager Wilayah Sumbagut, Manarep Pasaribu, yang ada,” ujarnya. Menurut Pasaribu, daya PLN yang berkurang berimbas Sementara GM PLN Piki- tring Wilayah Aceh Dan Sumut, Bintatar Hutabarat, menyata- tidak akan ada pemadaman. “Penggunaan listrik untuk keperluan mengolah makanan Warga Karantina II Medan pembangkit di Jakarta, Muara menyatakan pada 24 Septem- Tawas yang sama dengan mesin pembangkit di Belawan. ber 2009 yang lalu beberapa mesin pembangkit PLN menga- kepada pelanggan saat ini ber- kisar 180 MW, dimana pada siang hari untuk pelanggan kan kerusakan mesin pem- bangkit PLTU yang saat ini se- dang dilakukan percobaan ber- begitu penting, terutama bagi wanita bekerja yang punya wak- tu sedikit untuk menyiapkan Raih Hadiah Utama General Manager Pem- lami gangguan, dimana dua akan dikenakan pemadaman sifat minor, jika dibiarkan akan makanan pagi dan sore hari. Jika bangkitan Sumbagut, Misba- unit GT (gas turbin) 21 dan GT MEDAN (Waspada): Iswan- 4 pemenang Rp 600 ribu, 6 hadiah mulai Kamis (1/10), di sebesar 100 MW, pelanggan menyebabkan kerusakan fatal hendak bekerja, dengan waktu di, warga Jl. Karantina II No.65 pemenang Rp 400 ribu, dan 10 Harian Waspada, Jl. Letjen chul Munir, kepada wartawan 22, satu unit PLTU DI PLTGU industri & bisnis (TM) sebesar terhadap mesin pembangkit. yang sempit ternyata listrik pa- di Kantor PLN Wilayah Sumba- Sicanang, Belawan dan PLTU Medan, memenangkan hadiah pemenang Rp. 200 ribu. “Para Suprapto/Brigjen Katamso No. 50 MW, sedangkan pelanggan Ibu Rumah Tangga Repot dam, bagaimana menyiapkan utama Kuis THR Waspada- pemenang dapat mengambil 1 Medan (jam kerja),” katanya. gut, Senin (28/9), menyatakan Labuhan Angin. industri (TT) sebesar 30 MW. Padamnya listrik akhir- keperluan memasak,” ujarnya. Honda periode keempat, pada Daftar Pemenang Kuis THR Waspada-Honda keberadaan sparepart mesin “Hal ini mengakibatkan Pada malam hari untuk pelang- akhir ini semakin membuat ibu Begitu juga, lanjutnya, saat pengundian di Lantai 3 Gedung pembangkit itu baru dapat berkurangnya kemampuan gan rumah tangga akan dikena- rumah tangga kerepotan, ter- listrik padam pada sore hari se- Bumi Warta Harian Waspada Pemenang Utama Rp. 1,5 juta diketahui informasinya Selasa pasokan listrik PLN sebesar 495 kan pemadaman sebesar 110 utama mereka yang bekerja te- pulang bekerja, semakin mem- Medan, Senin (28/9). · Iswandi, Jl. Karantina II No.65 Medan (29/9) pagi. MW atau 38 persen dari total MW, industri & bisnis (TM) tapi tidak mempunyai pemban- buat sulit. (m38/m36) Iswandi memenangkan 2 Pemenang @ Rp. 800 ribu “Jika sparepart itu tersedia beban puncak sehingga PLN hadiah uang tunai senilai Rp 1,5 · Ramadhana Jl. Limau Manis Gang Armed Deli Serdang di pembangkit Muara Tawas, terpaksa melakukan pemada- · Suken Jl. Bunga Asoka Pasar VI Kec. Medan Selayang maka paling lambat 5 Oktober 2009 dibawa ke Medan sehing- ga mesin dapat beroperasi kem- man listrik bergilir ke beberapa daerah secara tersebar,” ujarnya. Hingga saat ini, lanjutnya, DPRDSU: Bentuk Pansus PLN juta setelah kupon miliknya di- undi Redaktur SumutWaspada, M. Zeini Zein, disaksikan panitia 4 Pemenang @ Rp. 600 ribu · Usrijal Pulungan Jl. Sekata Gang Mawar Medan dan karyawan. · Rinaldy Jl. Abadi, Setia Budi Medan MEDAN (Waspada): Meski oleh negara dan selalu memo- jung dengan kebijakan pema- Ketua panitia kuis Zultam- · Susilawati Jl. Pasar Merah Medan sedang disibukkan dengan nopoli penjualan listrik di Indo- daman bergilir yang dilakukan Camat Medan Perjuangan Diganti pembentukan alat kelengkapan nesia, maka sikap PLN yang PLN. Salah satunya dengan cara ser, SE mengatakan, antusiasme · Siti Nurahmi Jl. Brigjen Katamso Gang Rame Medan peserta pada periode IV cukup 6 Pemenang @ Rp. 400 ribu MEDAN (Waspada): Pj Walikota Medan, Rahudman Harahap dewan, namun anggota DPRD selalu melakukan pemadaman segera membentuk Pansus tinggi, dimana kupon yang · Chairuddin Lubis Jl. Perjuangan Gg. Keluarga No.120 C Medan mengganti Camat Medan Perjuangan, Syaifuddin Harahap karena Sumatera Utara yang baru dan meminta maaf dengan untuk meminta pertanggung- masuk mencapai 30-an ribu · Sugiman Jl. Pantai Labu Kebun Kelapa Lubuk Pakam tersandung masalah tindak pidana kriminal. Penggantinya Sekcam dilantik perlu segera menyikapi alasan kerusakan sudah tidak jawaban manajemen PLN lembar. · Syahfitri Jl. Letda Sujono Gang Aman Medan Medan Tembung, Budi Haryono. kebijakan pemadaman listrik wajar lagi. Apalagi melihat be- terhadap masyarakat. “Kuis terselenggara berkat · Nor Asrul Jl. Halat Gang Makmur No.12 Medan “Camat Medan Perjuangan telah bertindak arogan kepada PLN di daerah. Bila perlu, de- sarnya tarif listrik saat ini, Secara terpisah, Ketua Frak- kerjasama HarianWaspada dan · Dendi Purnama Jl. Marelan Gang Syukur Medan bawahan. Tindakan ini tak pantas dan telah mencoreng muka wan membentuk Pansus (pani- seharusnya PLN sudah tidak si PPP (Partai Persatuan Pem- Honda serta didukung bebera- · Nopidawati Jl. Rawa Sembilan No.66 Medan pemerintah Kota Medan,” katanya, (28/9) di Kantor Walikota tia khusus) untuk meminta per- layak lagi menerima subsidi. bangunan) DPRDSU, Fadly pa sponsor yakni, Harian Berita 10 Pemenang @ Rp. 200 ribu Medan. tanggungjawaban manajemen Brillian yakin persoalan Nurzal, meminta PLN Sumut Sore, BNI, Bank Sumut, Telkom- · Syahrial JL. Buku Ayahanda Medan Rahudman menjelaskan, tindakan pencopotan sudah melalui PLN Sumut. kerusakan dan krisis listrik di untuk tidak memancing emosi sel, Bank BPD Aceh dan AXIS. · M. Fikri Jl. Pertahanan Medan koordinasi dengan Sekda Medan dan para asisten serta adanya “Karena sudah beberapa Sumut pasti disebabkan kesala- masyarakat Sumut dengan Kuis ini merupakan agenda ta- · Khairul Jl. Bandar Labuhan Tanjung Morawa hasil pemeriksaan yang dilakukan Inspektorat Kota Medan. periode anggota dewan berlalu, han manajemen. Karena segala melakukan pemadaman listrik hunan Harian Waspada di bu- · Abadi Jl. Jeruk Atas No.20 Pematang Siantar Sehingga kesimpulan pencopotan harus dilakukan untuk tapi persoalan krisis listrik di fasilitas dan kemudahan sudah saat masyarakat membutuhkan lan suci Ramadhan yang diper- · Syahrul Jl. Seto No.1 Medan menegakkan kebenaran. Sumut seperti tidak pernah sele- diberikan kepada PLN. Seha- listrik. “Kebijakan PLN untuk sembahkan bagi pembaca setia · Irvan Zulfani Jl. Marelan I Pasar IV Barat Gg. Keramat No.63 Rahudman menegaskan, tugas harian Camat Medan sai. Padahal persoalan PLN sela- rusnya sudah tidak ada lagi menyelesaikan persoalan ja- Waspada,” jelas Zultamser. · Pupu Diana Jl. Gurilla Gang Kartiwi No.1 Medan Perjuangan harus melaksanakan kinerja dengan baik dan lu itu-itu saja,” kata Bendahara masalah. “Berarti ada miss ngan hanya searah. Seharusnya Selain pemenang hadiah Rp · Zainuddin Jl. Selamat, Simpang Limun Medan bersinergi. Tugas ini diberi waktu selama satu bulan, bila ternyata Fraksi PDI Perjuangan DPRD- management di internal PLN.” PLN bisa membuktikan kalau 1,5 juta, juga terdapat 2 peme- · HM. Siregar Jl. Pimpinan Gang Salam No.4 Medan tidak mampu maka akan dilakukan evaluasi kembali. SU, Brillian Moktar, kepada Karena itu, menurut Bri- mereka sahabat masyarakat nang uang tunai Rp 800 ribu, · Dedi Syahputra Jl. Sosro No.04 B Medan Tembung (cmai) Kilaf Waspada di gedung dewan, llian, sebagai perpanjangan dan masyarakat sahabat PLN. Camat Medan Perjuangan, Syaifuddin saat dikonfirmasi Senin (28/9). tangan rakyat Sumut, DPRDSU Sesama sahabat jangan me- wartawan di Poltabes Medan mengatakan bahwa dia saat itu kesal Brillian mengatakan, seba- harus segera menyikapi per- nyakiti,” ujarnya Ketua DPW dengan ulah bawahannya sehingga dia kilaf. gai perusahaan yang disubsidi soalan krisis listrik yang beru- PPP Sumut itu. (h11) Syaifuddin mengatakan saat itu dia hanya mengacungkan senjata gas. “Saat itu saya kilaf,” ujarnya. (h10/m39) Hari Ini Rapat Bahas Boleh Miliki Senpi Bila Ada Izin Penertiban Ternak Babi MEDAN (Waspada): Kapoltabes Medan, Kombes Pol Drs Imam MEDAN (Waspada): Pj Wa- dengan Muspida Plus. Bila da- untuk berternak kaki empat,” Margono menegaskan, masyarakat sipil diperbolehkan memiliki likota Medan, Rahudman Ha- lam rapat itu nantinya didapat- paparnya. senpi (senjata api) apabila ada izinnya. rahap mengatakan, pihaknya kan langkah-langkah, maka Di tempat terpisah, pimpi- “Terus terang saja, perampok sekalipun bila mempunyai izin sedang menyusun langkah me- dengan segera kita lakukan nan sementara DPRD Medan, boleh memiliki senpi. Karena semuanya itu berdasarkan surat lakukan penertiban ternak kaki penertiban,” ucapnya. Surianda Lubis menegaskan, izin. Tidak ada larangan bagi masyarakat yang punya senpi tapi empat di wilayah Kota Medan. Rahudman menyebutkan, penertiban ternak kaki empat dengan satu catatan harus memiliki surat izin kepemilikan,” jelasnya Salah satunya meminta masu- pelaksanaan penertiban ternak diKotaMedankhususnyaMedan kepada wartawan ketika dihubungi melalui telefon selular, Senin kan dari Muspida Plus sehingga itu tetap harus dilaksanakan, ha- Denai jangan sampai menim- (28/9). pemindahan ternak kaki empat nya saja pelaksanaannya masih bulkan kesan lambat, makanya Dijelaskan, bila ada warga sipil yang memiliki izin tapi tidak dapat berjalan lancar. dibahas. Hal ini juga berkaitan dari mulai sekarang harus di- dilengkapi dengan surat, maka pihaknya akan memprosesnya Rahudman mengatakan itu dengan pembersihan di wilayah buat aturan hukumnya serta secara hukum dan bila perlu akan melakukan penangkapan. ketika dikonfirmasi, Senin (28/ yang ada ternak kaki empat. komitmen untuk penertiban. “Namun bila ada masyarakat sipil yang memiliki senpi dilengkapi 9) di kantor Walikota menang- “Kita ingin kota Medan ber- “Kita sangat mengharapkan surat izin, maka pihak kepolisian akan melakukan pendataan,” gapi lambannya penertiban ter- sih dan tertata. Untuk itu, pener- Pemko segera menertibkan katanya. nak babi. Bahkan hingga kini tiban ternak kaki empat harus ternak kaki empat di Medan khu- Bukan berarti, lanjutnya, memiliki senpi dengan surat izin belum lahir Peraturan Walikota berjalan agar Medan yang me- susnya Medan Denai. Jangan bisa menggunakannya sesuka hati. Bila ada ditemukan warga (Perwali) Medan terkait untuk nuju Kota metropolitan, ma- sampaimasyarakatberanggapan sipil yang memiliki senpi resmi dengan surat dan digunakan untuk penertiban ternak kaki empat. dani dan religus dapat terwujud. Pemko tidak pernah berpikir un- Waspada/Mursal AI melakukan tindak pidana, maka akan diambil tindakan tegas “Besok (hari ini) saya akan Apalagi daerah Kecamatan Me- tuk menertibkan ternak itu,” MENUNJUKKAN: Redaktur SumutWaspada M.Zeini Zein (tengah) menunjukkan nama pemenang dan diproses secara hukum yang berlaku. (m39) melakukan rapat koordinasi dan Denai merupakan larangan demikian Surianda Lubis. (h10) hadiah utama di lantai 3 Gedung Bumi Warta Harian Waspada, Senin (28/9).
  • 10 Medan Metropolitan WASPADA Selasa 29 September 2009 Sumut Belum Bebas Campak Dan Polio MEDAN (Waspada): Provinsi Sumatera Utara hatan yang ingin mereduksi pe- anak yang belum mendapatkan Menanggapi hal itu, Asrin (Sumut) belum terbebas dari wabah penyakit nyakit campak dan melakukan imunisasi polio dan campak Naim memberi support atas eradikasi penyakit polio di In- pada pelayanan rutin. rencana tersebut. Kata Naim, campak dan polio. Sedang di tingkat nasional, donesia pada tahun 2010 nanti. Pihaknya berharap, Gubsu rencana Dinkes itu akan dia baru tiga daerah saja yang bebas dari kedua Selain itu, pihaknya juga bersedia membuka kampanye komunikasikan kepada Gubsu penyakit tersebut, yakni Bali, Nusa Tenggara Barat ingin menghilangkan kelom- anti-kedua penyakit itu yang Syamsul Arifin agar bisa hadir pok rawan campak di daerah dijadwalkan pada 8 atau 9 dalam launching kampanye dan Jogjakarta. risiko tinggi dan menjangkau Oktober di Medan. nanti.(m19) “Karena itulah pemerintah tonga, SH. pusat melalui Departemen Ke- sehatan akan mengampanye- kan pentingnya imunisasi cam- Kata Chandra, di tahun 2006 Sumut tidak memiliki sedikit- pun kasus penderita campak Program Kerja pak dan polio kepada bayi-bayi di seluruh Indonesia, termasuk dan polio. Namun sepanjang tahun 2007-2008, jumlah pen- DPRD Medan Lamban di Sumut, agar nantinya ter- derita kedua penyakit itu men- bebas dari penyakit tersebut,” capai 555 orang. Dan tahun MEDAN (Waspada): Pro- dibentuk. rian mereka di gedung dewan ujar Kepala Dinas Kesehatan ini, hingga bulan Juli terdapat gram kerja DPRD Medan ber- Seharusnya, kata Muslim saat ini, kebanyakan mereka Waspada/Anum Saskia Provsu dr Chandra Syafei, SPOG, 164 penderita campak dan jalan sangat lamban. Sampai Maksum, dewan segera mene- duduk di ruangan ketua. AKRAB : Dari kanan Kadis pendidikan Medan Drs Hasan Basri MM, Pj Walikota Drs Rahudman, dalam pertemuan dengan Asis- polio. Senin (29/9), praktis anggota tapkan fraksi-fraksi dan mem- Ketua DPRD Medan se- Kadis Pendidikan Sumut Drs Bahrumsyah dan Sekda Medan Drs Dzulmi Eldin nampak akrab ten III Provsu, Asrin Naim, di “Kami menargetkan 95% dewan periode 2009-2014 be- bentuk panitia khusus (Pansus) mentara Denni Ilham Pangga- saat berlangsung halal bi halal, Senin (28/9). Kantor Gubsu, Senin (28/9). dari penderita penyakit polio lum melakukan kerja apapun. yang bertugas untuk menyusun bean, kepada wartawan, me- Chandra saat itu didam- dan campak harus bisa sem- Sementara pelaksanaan rapat tata tertib (Tatib). Dari sanalah ngakui baru hari ini (Selasa 30/ pingi Konsultan WHO untuk Kampanye Campak dan Polio buh,” kata Chandra. Selain itu, pihaknya akan melakukan pembentukan alat kelengkapan dewan yang dijanjikan ketua sementara Denni Ilham Pang- kemudian alat kelengkapan dewan lainnya, seperti komisi- komisi dibentuk. Termasuk 9), akan melakukan rapat pim- pinan. Setelah itu, baru digelar rapat dengan sejumlah pim- Walikota Minta Kadisdik Tambahan di Sumut, dr Bikash kampany e pemberanta- Lamichhane. Sementara Asrin Naim didampingi Kepala Biro san kedua penyakit itu di semua Posyandu yang ada di gabean, hari itu belum ber- langsung. Menurut pengamatan war- menetapkan pimpinan DPRD devenitif. Menurut informasi yang di- pinan parpol untuk menyusun alat kelengkapan dewan. Evaluasi Program Kerja Pemberdayaan Perempuan, Sumut. Usai melakukan rapat de- tawan, sejak dilantik tanggal 15 peroleh wartawan, kemungki- ngan seorang pimpinan dewan MEDAN (Waspada) : PJ Wa- dan Sumut serta pejabat saja persoalan kualitas seorang Vita Lestari dan Pelaksana Ke- Chandra mengatakan, pi- September 2009, sampai kini nan fraksi di DPRD Medan akan pala Bidang Humas Pimpinan haknya ingin menjalankan lainnya, yakni Surianda Lubis, likota Medan, Drs H Rahudman lainnya. pendidik harus benar-benar anggota DPRD Medan belum bertambah satu dari periode kata Denni, pihaknya juga akan Provsu, Maike Moganai Ri- program Departemen Kese- melakukan kegiatan. Pelaksa- sebelumnya, menjadi delapan. Harahap, meminta Kepala Di- “Tinjau kembali sistem menjadi pemikiran bagi Dinas melakukan rapat dengan sekre- nas Pendidikan Kota Medan, kerja. Jangan berjalan monoton, Pendidikan Medan serta upaya- naan program DPRD berjalan Yakni Fraksi Partai Demokrat taris dewan.Yakni guna menga- sangat lamban. Jangankan un- (FPD), Fraksi Partai Keadilan melakukan evaluasi program karena pendidikan itu menga- upaya yang harus dilakukan 283 CPNS Depagsu Terima SK tuk melaksanakan fungsi dan Sejahtera (FPKS), Fraksi Partai komodir agenda dewan. ‘’Kita berharap minggu depan selu- kerja. Hal ini sangat diperlukan, guna memastikan apakah pen- lami perkembangan yang pesat. Harapan saya dengan evaluasi untuk berbagai perbaikan. “Mendapatkan hal itu perlu tugas dewan, membentuk alat Demokrasi Indonesia Perjua- ruh alat kelengkapan dewan MEDAN (Waspada): Sebanyak 283 orang pelamar umum di kelengkapan dewanpun belum ngan (FPDIP), Fraksi Partai Gol- didikan di Medan berkualitas dan meninjau kembali, akan dukungan dari berbagai pihak, lingkungan Kanwil Departemen Agama Provsu menerima SK sudah terbentuk,’’ katanya. atau belum. dapat dilihat apakah sistem khususnya DPRDSU, untuk dilakukan. kar (FPG), Fraksi Partai Amanat CPNS yang diserahkan langsung oleh Kakanwil Depagsu, Syariful Setiap hari, sejumlah ang- Nasional (FPAN), Fraksi Partai Sementara itu, Sekretaris “Evaluasi juga bertujuan yang berjalan sudah mantap membahas adanya Perda Pen- Mahya Bandar di aula kantor itu, Senin (28/9). Hadir dalam acara gota dewan yang datang ke kan- Damai Sejahtera (FPDS) Fraksi DPRD Erwin Lubis, mengakui untuk meningkatkan mutu atau perlu diperbaharui lagi. didikan agar menjadi payung itu, Kabag Tata Usaha, H.M Idrus Hasibuan, Kasubag Hukmas/ tor hanya mondar-mandir dan PPP dan tambahannya Fraksi kalau akan dilakukan penam- pendidikan maupun tenaga Terutama untuk sistem belajar hukum bagi peningkatan kuali- KUB, Solehuddin dan undangan lainnya. duduk ngobrol. Tidak ada pem- Partai Bersatu (FPB). bahan satu ruang untuk Fraksi pendidik di kota ini. Sehingga efektif lima hari. Saya ingin ada tas dan mutu pendidikan di Mahya mengatakan, dari angkatan formasi tahun 2008, sampai bahasan masalah pekerjaan. Dengan bertambahnya Partai Gabungan. Fraksi ini ga- berbagai anugerah bidang pen- evaluasi, selambatnya Oktober Medan,” katanya. saat ini masih ada 40 orang lagi yang masih dalam proses Lepas tengah hari, umumnya satu fraksi di DPRD Medan, ma- bungan dari PIB, PKDI, PPRN didikan yang didapatkan bukan nanti sudah ada pembahasan Sebelumnya Kadis Pendidi- penyelesaian SK CPNS-nya di Departemen Agama RI. CPNS ini anggota dewan sudah tidak ka gedung dewan juga membu- dan Partai Buruh. Sementara hanya sebagai lambang tetapi apakah ini akan diteruskan atau kan Medan, Drs Hasan Basri, terdiri dari: tenaga administrasi, penyuluhan dan guru. nampak lagi di kantor itu. tuhkan satu ruangan tamba- satu orang anggota dewan dari Partai Patriot, bergabung de- wujud dari apa yang telah dila- dihentikan,” katanya. MM dalam sambutannya me- Sebelumnya, Kabag TU H.M.Idrus Hasibuan menyebutkan Seorang anggota dewan han. Untuk hal ini juga sampai kukan,” kata Rahudman saat Dia juga menyampaikan ngatakan, kegiatan ini sebagai pelamar umum yang diusulkan ke Depag RI sebanyak 323 orang. Muslim Maksum Lc, kepada sekarang belum terlihat tanda- ngan anggota dewan dari Partai Persatuan Pembangunan. ‘’Se- berlangsungnya acara halal bi keluhan masyarakat yang dite- sarana pertemuan silaturahmi Sedangkan yang terbit SK-nya baru 283 terdiri dari CPNS di Kanwil wartawan mengaku belum da- tanda pembenahan. Akibatnya, halal di lingkungan Dinas Pen- rimanya, masih ada guru yang antar sesama pegawai maupun pat melakukan tugas-tugas ka- empat orang anggota yang ren- mentara ini, ruangan Fraksi 4 orang, Kandepag Tapteng 51 orang, Nias Selatan 23 orang, Hum- didikan Kota Medan di Kom- berprilaku tidak mendidik dan tenaga pendidik di lingkungan rena belum tahu membidangi cananya akan bergabung di Partai Bersatu kita tempatkan bang Hasudutan 23 orang ( 1 orang mengundurkan diri), Samosir di ruangan humas, lantai I,’’ kata plek Vila Malina Indah Permata memberikan citra buruk di te- pendidikan yang digelar setiap apa. Katanya, jangankan komisi, fraksi ini, untuk sementara be- 20 orang, Serdang Bedagai 21 orang, Padang Sidempuan 9 orang, fraksi-fraksi juga belum lum memiliki ruangan. Keseha- Erwin. (m17) Hijau, Senin (28/9). ngah masyarakat. Hal itu diketa- tahunnya. Di samping itu untuk Mandailing Natal 13 orang, Labuhan Batu 12 orang, Kabupaten Hadir Sekda Kota Medan, huinya berdasarkan SMS yang lebih meningkatkan ikatan Langkat 14 orang, Toba Samosir 3 orang, Asahan 13 orang, Tanjung Drs Dzulmi Eldin, Kadis Pen- diterima dari masyarakat, yang silaturahmi yang dijalin. Balai 1 orang, Pakpak Barat 5 orang, Sibolga 4 orang, Pematang- siantar 6 orang, Kota Medan 5 orag, Binjai 3 orang,Tebing Tinggi Tiga Perampok Ditangkap didikan Kota Medan, Drs Hasan Basri MM, Kadis Pendidikan keberatan atas sikap dan prilaku guru yang tidak menunjukkan Acara diiringi dengan penampilan band dari siswa 2 orang, Nias 6 orang, Simalungun 4 orang, Tapsel 12 orang, Deliser- Sumut, Drs Bahrumsyah, Ke- bagaimana selayaknya menjadi SMKN 11 Medan, Pj Walikota dang 9 orang,Taput 7 orang,Dairi 6 orang dan Karo 7 orang. (m36) Gasak 1,5 Kg Emas Dan Uang Rp 15 Juta pala Cabang Dinas Kecamatan, seorang pendidik. dalam kesempatan itu turut Kepala Sekolah (SD,SMP ,SMA Disamping perlunya me- menyumbangkan suara MEDAN (Waspada): Tiga diringkus dari rumahnya. Masih pengakuan tersang- dan SMK) serta sfaf dan pegawai ningkatkan citra sebagai tenaga emasnya diiringin acara salam- Tender Di Palas pria komplotan perampok Selanjutnya dilakukan pe- ka, saat beraksi mereka berjum- dan kepala bagian di jajaran pendidik yang baik di mata salaman seluruh yang hadir bersenjata tajam ditangkap ngembangan dan berhasil di- lah 8 orang. Satu dari delapan Dinas Pendidikan Kota Medan masyarakat,sambung dia, tentu kepada walikota. (m36) Diduga Tak Sesuai Kepres Reskrim Unit Jahtanras Poltabes ringkus tersangka Saut dan Har- orang berperan menggambar Medan dari kediaman masing- di di rumah masing-masing. situasi di toko emas korban, MEDAN (Waspada): Panitia tender di Kabupaten Padang Lawas untuk peningkatan jalan jurusan Mondang-Pinarik Kec. Batang Lubu Sutam dengan nomor paket 04 diduga tidak mengikuti masing, Senin (28/9). Tersangka Alfred Lumban Tobing, 40, warga Jalan Pertaha- Dari ketiga tersangka polisi me- nyita barang bukti handphone serta sejumlah uang. empat orang mengikuti korban dengan menumpang Angkot yang ditumpangi Nurli dan tiga DPRDSU Bentuk Susunan peraturan Kepres. Hal ini disampaikan Direktur PT. Koalisi Bumi Agung Ir. Sori Pada Hasibuan melalui Jubir Harahap di kantor Waspada, Senin nan, Desa Sigaragara Patumbak, Saut Richard Simamora alias Birong, 48, warga Jalan Binjai Kepada polisi, ketiga ter- sangka mengaku merampok korban yang juga pemilik toko orang lagi mengikuti dari bela- kang dengan menaiki mobil Toyota Avanza. Kepengurusan 10 Fraksi (28/9). Km 8,5 Pasar IV Kampung La- emas, Nurli Tarigan, warga Setibanya di Jalan Binjai, MEDAN (Waspada): DPRD Ketua Jamaluddin Hasibuan, Asri. Pimpinan FPDS Ketua Menurutnya, berdasarkan Kepres, panitia lelang harus memberi lang dan Hardi, 38, warga Jalan Binjai saat menumpang Angkot Angkot yang ditumpangi kor- Sumatera Utara mengesahkan Wakil Sekretaris Guntur Ma- Tonnies Sianturi dan Sekretaris kesempatan kepada pengikut lelang untuk memeriksa keabsahan Putri Hijau Medan. di Jalan Binjai 11 September ban disetop tersangka dengan dokumen, baik dari segi administrasi maupun teknis. susunan kepengurusan 10 frak- nurung, Penasihat H Saleh Darmawan Sembiring. Sedang- Kapoltabes Medan, Kom- 2009 sekira pukul 17:00. modus berpura-pura razia. “Pembukaan lelang pada Jumat (11/9) lalu dinilai tidak sehat. bes Pol Drs. Imam Margono, Dari korban, tersangka Hingga saat ini polisi masih si, yakni: Fraksi Partai Demokrat, Bangun, Hasbullah Hadi dan kan FPPRN diketuai Wasington Sebab, pengikut lelang tidak diberi kesempatan untuk melihat melalui Kasat Reskrim, Kompol berhasil merampok perhiasan melakukan pengembangan Partai Golkar, PDI Perjuangan, Amarullah Nasution. Pane dengan anggota Rinawati dan memeriksa keabsahan dokumen. Panitia lelang juga Gidion Arif Setyawan, SIK di- emas seberat 1,5 kg serta uang sekaligus mengejar lima orang PKS, PAN, PPP, PDS, PPRN, Kemudian, FPG diketuai Sianturi, Restu Kurniawan Saru- menginstruksikan tidak boleh membuat sanggahan di waktu dampingi Kanit Jahtanras, AKP tunai Rp 15 juta. Korban ketika lagi kawanan pelaku peram- Fraksi Gerindra Bintang Refor- oleh Biller Pasaribu dan Sekre- maha, Rahmiana Delima Pulu- pembukaan penawaran. Kami menilai ada permainan antara Faidir Chan, saat dikonfirmasi itu sempat melakukan perlawa- pokan tersebut. masi dan Hanura dalam rapat taris Isma Padly AP Wakil Ketua , ngan, Roslyda Marpaung, Oloan panitia lelang dengan kontraktor yang menang, kita dari PT. Koalisi wartawan mengatakan, terung- nan hingga akhirnya ditikam Menurut Kanit Jahtanras, paripurna dipimpin Ketua De- Zefri Januar Pribadi, Wakil Se- Simbolon dan Sonny Firdaus. Bumi Agung (kalah-red) merasa dirugikan” terang Jubir. kapnya kasus ini berawal polisi salah seorang tersangka dibaha- ketiga tersangka Alfred, Saut wan Sementara Palar Nainggo- kretaris Richard Eddy M Lingga, Untuk pimpinan Fraksi Untuk itu, Jubir meminta agar tender peningkatan jalan mendapat informasi tentang gian tubuhnya. Dengan kondisi dan Hardi akan diserahkan ke lan dan Wakil Ketua Chaidir Bendahara Syafrida Fitrie, Pena- Gerindra Bintang Reformasi Mondang-Pinarik Kec. Batang Lubu Sutam dengan nomor paket keberadaan tersangka Alfred. mengenaskan, korban mela- Polres Binjai karena lokasi Ritonga, di gedung dewan, sihat Chaidir Ritonga, Syahrul diketuai Yan Syahrin, Sekretaris 04 diulang. “Dan pihak-pihak terkait untuk memeriksa keabsahan Kemudian dilakukan pengin- porkan peristiwa tersebut ke kejadian diwilayah hukum Senin (28/9). Pasaribu dan Ajib Shah. FPDIP Ferry Suando Tanuray,Wakil Ke- ketiga pemenang tender.” (cmai) taian hingga akhirnya Alfred Polres Binjai. Polres Binjai. (m39) Pengesahan pimpinan 10 diketuai Budiman P Nadapdap, tua Mulyani, Anggota Khairud- fraksi itu sesuai Keputusan Sekretaris Analisman Zalukhu, din Syah dan Imam B Nasution. Grand Angkasa Sumbang Sumut Berpeluang Ekspor Pimpinan Sementara Dewan No.01/KPS/2009 tentang pem- Wakil Ketua Syamsul Hilal,Wakil Sekretaris Alamsyah Hamdani, Dan pimpinan Fraksi Hanura Ketua Musdalifah, Sekretaris Rp17 Juta Ke RZI Bahan Makanan Ke Rusia bentukan susunan pimpinan dan anggota fraksi-fraksi DPRD Bendahara Brilian Moktar, Panasihat Japorman Saragih, Suasana Dachi, Bendahara Adohot Simamora. MEDAN (Waspada): Grand Angkasa International Hotel Sumut, berdasarkan pasal 301 Taufan A Ginting dan Eddi Seusai paripurna peneta- menyerahkan sumbangan zakat dari hasil penjualan 1.430 UU 27/2009 tentang MPR, DPR, Rangkuti. FKS diketuai Timbas pan dan pengesahan pimpinan MEDAN (Waspada): Suma- pada saat Sekdaprovsu me- menggambarkan bahwa tahun cokelat kepada Rumah Zakat Indonesia (RZI) di lobi hotel itu, DPD dan DPRD. Tarigan, Sekretaris Hidayatul- fraksi, masing-masing fraksi tera Utara memiliki peluang ngunjungi peserta dari Sumut lalu produk makanan meliputi Senin (28/9). Sesuai Keputusan Pimpi- lah, Bendahara Zulkarnain ST, melakukan rapat fraksi dalam besar menerobos ekspor bahan yang ambil bagian pada World 40 persen produk consumer Sumbangan itu diserahkan langsung oleh General Manager nan Sementara, ditetapkan Wakil Ketua Nur Azizah Tam- melanjutkan agenda kegiatan makanan ke Rusia, terutama Expo Moskow yang dibuka price index di Rusia. Hotel Grand Angkasa Internasional Terence T Lee kepada Yudha pimpinan FP Demokrat, antara bunan, Wakil Sekretaris Amasal dewan selanjutnya sesuai ke- sayur mayur, buah-buahan, resmi Selasa (15/9) lalu. Selain itu, hampir 90 persen E. Setiawan selaku Program Manager Sumatera Rumah Zakat lain, Ketua Palar Nainggolan, Nasution, Penasihat Muham- lompok kerja yang sudah diben- perikanan dan berbagai komo- “Peluang Sumut cukup produk konsumen yang dijual Indonesia. Asisten Public Relation Manager Hotel Grand Angkasa Sekretaris Mustofawiyah, Wakil mad Nuh dan Sigit Pramono tuk sebelumnya.(h11) ditas perkebunan seperti crude besar untuk menerobos ekspor di Rusia saat ini merupakan Idawati Onggo menjelaskan, sebagaimana yang diketahui masya- palm oil (CPO), kopi, teh, coklat, bahan makanan ke Rusia. Ini produk impor dari luar Rusia rakat umum, pihak hotel bekerjasama dengan Gordon Max dan frozen food hingga produk harus kita manfaatkan secara di mana 35 persen di antaranya PT Gandum Mas Kencana membuat 1430 cokelat berbentuk bulan dan bintang yang digantung di lobi hotel sejak 19 Agustus 2009. Setiap cokelat seharga Rp20.000 per batang dan sebulan terkumpul kerupuk dan lainnya. Sekdaprovsu, RE Naing- baik dan terencana. Meski sela- ma ini sudah ada, namun volu- adalah produk makanan. Ini merupakan peluang besar bagi 152 Guru Tidak Lulus PLPG golan, mengatakan hal itu ke- me dan kuantitasnya perlu lebih kita (Sumut –red). “Itulah sebab- dana Rp17.500.000. Hasil penjualan diserahkan kepada RZI. MEDAN (Waspada): Penja- alasan mereka masing-masing. peserta dapat meningkatkan pada wartawan di Medan, kita tingkatkan karena peluang nya Sekdaprovsu menyambut Sementara itu, Yudha E Setiawan dari RZI mengatakan, selama ringan 2.083 guru pada Pendidi- “Dengan ketidakhadiran 44 mutu seorang guru. “Modul Minggu (27/9), setelah selama itu cukup signifikan,” ujarnya baik dan mendorong sejumlah Ramadhan ini, pihaknya telah memperoleh dana Rp1 ,3 miliar kan dan Latihan Profesi Guru orang peserta ini pada PLPG Su- tersebut terdiri dari beberapa tiga hari melakukan kunjungan seraya mengemukakan bebe- pengusaha Sumut mengikuti dan mengalami peningkatan dari tahun sebelumnya. (cat) (PLPG) Sumut 2009 gelombang mut 2009 gelombang pertama, materi, yakni, materi pertama, kerja ke Moskow, Rusia, pada rapa langkah yang dipersiapkan World Expo Moskow di jantung 15 – 18 September 2009 bersa- mem-follow up kunjungan ini. Rusia,” katanya. pertama lalu, menyisihkan 152 mereka tetap kami imbau pengembangan profesionalitas Rektor UMY Hadiri ma Kepala Dinas Perindustrian dan Perdagangan Sumut, Hasbi Didampingi Kadis Kominfo Sumut, Eddy Syofian, Sekda- Pameran produk makanan yang disebut-sebut kedua ter- peserta yang tak lulus. Karena 152 orang guru ini tak meme- untuk mengikuti PLPG pada gelombang berikutnya. De- guru, kedua, metodologi pem- belajaran yang meliputi peni- Halal Bi Halal Kaumy Nasution, dan beberapa pengu- saha Sumut. provsu optimis pasar makanan yang cukup besar di Rusia dapat besar di dunia ini juga direspon positif dengan memfasilitasi nuhi syarat kelulusan pada PLPG Sumut 2009 tersebut. ngan begitu, mereka tetap memiliki peluang untuk lolos laian hasil belajar, model dan media pembelajaran, dan MEDAN (Waspada): Rektor Universitas Muhammadiyah Selama di Rusia, Sekda- dimanfaatkan oleh Sumut pengusaha Indonesia berperan Demikian diungkapkan sertifikasi guru pada tahun rencana pelaksanaan pembe- (UMY) Yogyakarta, Ir Dasron Hamid, Msi menghadiri halal bi provsu berkesempatan berte- meski diakui persaingan juga di dalamnya oleh pihak Kedu- Ketua Divisi Diklat PLPG Uni- ini,” ujarnya. lajaran (RPP), dan ketiga halal keluarga alumni Universitas Muhammadiyah Yogyakarta mu Duta Besar RI di Moskow, akan cukup ketat. bes RI di Moskow. 23 Peserta versitas Negeri Medan (Uni- Berlin menyebutkan, me- penelitian tindakan kelas dan (Kaumy) di Semba Café Medan, Jumat (25/9). Rektor merasa bangga Hamid Awaludin, dan sejumlah Dijelaskan, beberapa fakta dari Indonesia termasuk Sumut med), Berlin Sibarani, kepada reka yang lulus PLPG tahun ini penulisan karya ilmiah (PTK dengan rasa cinta dan kebanggaan para alumni pada almamaternya. pengusaha setempat, berbin- yang diperolehnya dari pihak berperanserta aktif pada pa- wartawan, Senin (28/9). “Syarat akan menerima tunjangan pro- PKI),” paparnya. ‘’Saya merasa bangga melihat para alumni yang mencintai cang dan berdialog, terutama berkompeten di Moskow meran itu. yang dibutuhkan untuk lulus fesi guru mereka. “Penerimaan Disebutkannya, untuk dan juga membanggakan kampus tempatnya menuntut ilmu,’’ Sekdaprovsu mengemuka- pada PLPG Sumut 2009 ini tak tunjangan profesi guru bagi pengumuman kelulusan pada ujar Rektor UMY. kan, menurut informasi yang hanya dari penilaian portofolio peserta yang lulus PLPG Sumut PLPG Sumut 2009 gelombang Hadir juga dalam acara itu Sekretaris Umum DPP Kaumy diperolehnya, ketergantuangan saja, tapi juga ujian tulis, ujian 2009 ini, pada tahun depan me- pertama yang digelar Unimed Satriawan Guntur Zass, SH, Ketua DPD Kaumy Boyke Chandra, pihak Rusia pada impor bahan praktek mengajar, penilaian mang sudah dianggarkan dana- pada 7-16 September 2009 lalu Sekretaris DPD Agus Marwan dan para alumni yang berasal dari makanan ini telah berlangsung teman sejawat dan penilaian nya di APBD. Jadi, tahun depan telah dapat diakses di website berbagai daerah di Sumut dan Aceh. sejak lama dengan nilai impor partisipasi,” jelas Berlin. mereka telah berhak menerima resmi Unimed, unimed.ac.id, Pada acara itu rektor menyampaikan beberapa kemajuan sebesar 20 miliar dolar AS di Berlin mengatakan, 152 tunjangan profesi guru mere- dan dapat dilihat secara lang- yang dicapai UMY. Antara lain kerjasama dengan universitas di tahun 2007 melonjak tajam peserta yang tak lulus ini masih ka,” katanya. sung di papan pengumuman luar negeri seperti Australia, Arab Saudi, Iran, Amerika Serikat, menjadi 36 miliar dolar AS dapat mengikuti ujian ulang, Jadi, lanjut Berlin, dari 2.083 yang berada di depan Gedung Singapura dan Irak. UMY juga telah memiliki berbagai prestasi tahun 2008 lalu. yang akan digelar pada 30 Sep- peserta dikurangi 152 yang tak Biro Rektor Unimed Jalan seperti juara lomba robot nasional dan juara debat bahasa Ingggris. Menurut Dubes RI di Mos- tember 2009 mendatang di lulus dan dikurangi 44 peserta Willem Iskandar Medan Estate. ‘’Para dosen juga sudah 80 persen lulus Strata-2, 10% Strata- kow, Hamid Awaludin semua Unimed. “Pelaksanaannya yang tak mengikuti PLPG ge- PLPG Sumut 2009 lalu 3 dan UMY juga sudah memiliki tiga guru besar sendiri,’’ katanya. itu antara lain sebagai sebuah digelar satu hari penuh, dari lombang pertama ini, maka diikuti 2083 orang guru Kota Sementara Guntur menyatakan bahwa ke depan Kaumy akan konsekuensi pasar bebas yang pukul 08:00 hingga 18:00. Se- jumlah peserta PLPG Sumut Medan yang pada sertifikasi menjalin hubungan intensif dengan berbagai pihak termasuk diberlakukan Rusia ditambah dangkan jenis ujian ada dua 2009 yang lulus adalah 1.887 2008 lalu gagal portofolio. dengan Gubsu. Dia menekankan agar Kaumy juga memiliki andil kebijakan pemerintah atas per- yakni ujian tulis dan praktek orang guru. Adapun peserta diklat ini untuk merumuskan dan mengusulkan ide-ide cemerlang pada taniannya. Negeri beruang pu- mengajar,” terangnya. Pada pelaksanaan PLPG merupakan guru SD sebanyak Muktamar Muhammadiyah ke-100 pada tahun depan. Muktamar Waspada/Ist tih itu hanya mensubsidi peta- Lebih lanjut Berlin menga- yang memakan waktu 10 hari 668 orang, guru SMP sebanyak ini sendiri akan digelar di UMY. Sekdaprovsu DR RE Nainggolan, MM (kiri) dan Kadis Perindag ninya sebesar 6 persen dari nilai takan, pada diklat yang telah tersebut, masing-masing peser- 577 orang, guru SMA sebanyak ‘’Kita juga perlu memberdayakan DPD-DPD di daerah untuk Sumut, HM Hasbi Nasution, di salah satu pojok areal lokasi World total produksinya dibanding- memakan waktu sekitar 90 jam ta diberikan modul yang telah 639 orang, guru SMK sebanyak semakin memiliki peran yang setrategis,’’ kata Guntur yang berniat Expo Moskow yang berlangsung 15 hingga 18 September 2009 di kan dengan Uni Eropa 32 lalu tidak diikuti 44 orang pe- disediakan. Dengan modul 66 orang, dan guru BK sebanyak mencalonkan diri menjadi Bupati Asahan ini.(m12) Moskow. persen. (m19) serta dengan mengemukakan tersebut, Berlin berharap para 132 orang.(m41)
  • WASPADA Selasa 29 September 2009 Medan Metropolitan 11 Dua Jurtul Togel Diringkus Penulis Togel, Pemilik MEDAN (Waspada): Dua juru tulis judi toto gelap (togel) seorang diantaranya purnawirawan TNI, diringkus petugas Pistol Mainan Dibekuk Polsekta Medan Timur, Senin (28/9) siang, dari kawasan Jalan MEDAN (Waspada): Operasi Pekat (penyakit masyarakat) yang HM Said Medan. dilaksanakan Polsekta Medan Labuhan lima hari terakhir ini Kedua tersangka masing-masing Halim, 30, warga Jalan berhasil menangkap sembilan tersangka penulis judi toto gelap HM Said Gang India dan Syahruddin, 62, warga jalan HM Said (togel) dan satu orang pemilik pistol mainan yang digunakan Gang Kacung Kampung Durian Medan. Dari kedua tersangka, untuk merampok dari lokasi berbeda. polisi menyita Rp40 ribu dan beberapa lembar kertas berisikan Delapan orang tersangka adalah laki-laki warga Kecamatan nomor-nomor angka tebakan dari para pemesannya. Medan Deli dan Medan Labuhan yakni Is, 32, TS, 49, AA, Muk, Awalnya, polisi menangkap tersangka Halim ketika sedang Isk, RH, Her dan TP dan seorang wanita Mur, warga Gang Bantenan, menerima pesanan nomor tebakan dari pembelinya di salah Kecamatan Helvetia, Kabupaten Deli Serdang. Dari para tersangka, satu warung di Jalan HM Said Gang India. Dari pengakuan Halim, disita barang bukti uang Rp700 ribu, HP buku tafsir mimpi dan , polisi kemudian meringkus tersangka Syahruddin, kertas rekap. purnawirawan TNI, di Jalan HM Said Gang Kacung. Kapolsekta Medan Labuhan, AKP Dony Aleksander, SIK Kedua jurtul togel tersebut tak berkutik lagi saat ditangkap didampingi Kanit Reskrim, Iptu Antonie Rajaguguk mengatakan, karena beberapa barang bukti turut disita. Guna pengusutan kedelapan tersangka merupakan penulis yang dibandari oleh selanjutnya, kedua jurtul togel tersebut dijebloskan ke dalam tersangka Ac yang telah ditangkap Poltabes MS beberapa hari tahanan Polsekta Medan Timur. lalu. “Judi tidak boleh marak di wilayah hukum Polsekta Medan Kapolsekta Medan Timur, AKP Yatim Syahri Nasution Labuhan. Oleh karenanya pemberantasan judi ini terus dilakukan,” menyebutkan, kedua tersangka sudah beberapa bulan ini katanya saat memberikan keterangan di Aula Sanika Satyawadana menjadi jurtul togel dan menjalankan profesi ilegalnya itu secara Mapolsekta Medan Labuhan. sembunyi-sembunyi. “Saat disergap, kedua tersangka tak bisa Pistol Mainan mengelak lagi karena beberapa barang bukti seperti lembaran Sebelumnya Polsekta Medan Labuhan menangkap tersangka nomor-nomor togel serta uang hasil penjualan turut disita,” LPA, 32, warga Jalan RPH Mabar, pemilik pistol mainan mirip jelas Nasution. (cat) senpi yang digunakan untuk merampok korbannya, Roy, warga Mabar, Kecamatan Medan Deli. “Senjata ini mirip revolver taurus buatan Brazil,” kata Dony. Kejatisu Terima Perkara Kepada petugas tersangka mengaku mendapat pistol mainan itu dari seorang temannya, Win, 18, anak seorang oknum polisi Dari Kejari Jantho yang tinggal di Desa Hamparan Perak, Deli Serdang. “Senjata seperti ini banyak sama bapak kawanku itu dan bapaknya Polisi,” kata MEDAN (Waspada): Kejaksaan Tinggi Sumut (Kejatisu) tersangka yang berprofesi sebagai tukang becak itu. menerima pelimpahan berkas perkara dan barang bukti dua Dony minta warga tidak panik menghadapi aksi perampokan tersangka kasus penganiayaan disertai penculikan dari Kejaksaan yang menggunakan senjata api (senpi) yang marak belakangan Negeri Jantho, Aceh, Senin (28/9). ini. Sebab dari beberapa kasus yang ditangani, pihaknya Menurut Kasipenkum/Humas Kejatisu Edi Irsan Tarigan, berkeyakinan senjata yang digunakan pelaku adalah pistol mainan. tersangka yang diserahkan ke Kejatisu adalah Azhari alias Tengku “Walaupun demikian tetaplah waspada dan bila ada warga yang Alue bin Ibrahim dan Burhanuddin bin alm Syarifuddin. Kedua- melihat atau menjadi korban, segera melapor atau SMS ke nomor nya terdaftar sebagai anggota Komite Peralihan Aceh (KPA). Waspada/Rustam Effendi PARAH: Jembatan yang menghubungkan tepat pendaratan ikan (TPI) di Kelurahan Bagan Deli, Kecamatan Medan Belawan 0813 7642 7222,” ujar Dony. (cre) “Locus delictinya memang di Aceh, namun atas pertimbang- an kondusivitas proses persidangan maka dialihkan ke Kejatisu,” ini rusak parah dan tidak diperbaiki. Jembatan ini merupakan satu satunya penghubung di daerah itu. Foto diambil pekan lalu. ujarnya seraya menambahkan berkas perkara kedua tersangka murni tindak pidana dan tidak ada hubungannya dengan Polsekta Medan Baru kapasitasnya terlibat dalam struktur di KPA. Tangani 30 Kasus Judi Menurut Tarigan, atas perbuatan yang dilakukan kedua tersangka, Kejari Jantho menjerat keduanya dengan pasal, 333, 351 dan 365 ayat 2 yo 55 ayat 1 ke 1 jo pasal 65 ayat 1 KUHPidana. Tarigan mengatakan, awal terjadinya perkara itu pada 20 April 2008. Kedua tersangka saat berada di Pos KPA di Desa Bandar Judi MEDAN (Waspada): Polsekta Medan Baru sampai 27 Septem- ber 2009 menangani 30 kasus judi dengan 48 tersangka diantaranya judi toto gelap (togel), bola dan kartu joker. “Dari para tersangka disita barang bukti uang Rp1.375.000, Segera Diberantas Labernut Kab. Jantho, Aceh Besar, melakukan penganiayaan 12 unit handphone, 66 lembar potongan kertas berisikan rekapan serta penculikan terhadap dua saksi korban, Syawaluddin bin nomor togel, 2 buku mimpi, 18 pulpen, 2 buku notes togel, 2 set Marhaban dan Ibrahim Yusuf. Mereka dituduh melakukan bola bilyar, 1 kalkulator, 1 set kartu joker,” kata Kapolsekta Medan perusakan terhadap satu unit alat berat proyek di bawah Baru, AKP M Adenan AS, SH.SIK kepada Waspada melalui telefon pengawasan kedua tersangka. selular, Senin (28/9) malam. Selain itu, kedua tersangka juga merampas sepeda motor Disebutkan Adenan, para tersangka ditangkap sejak Juli sampai dan membawa kedua saksi korban keluar dari wilayah Jantho. MEDAN ( Waspada): Poltabes Medan segera tiap kali polisi hendak mering- yang beroperasi secara sem- saat ini, mereka ini wajah-wajah baru di kawasan Kota Medan Setelah berhasil kabur dari kedua tersangka korban kemudian kusnya. Kendati demikian, bunyi-sembunyi. dan Deli Serdang. melapor kepada polisi. (h05) memberantas dan menangkap seluruh bandar judi Poltabes Medan tidak akan ting- Masih Ditahan Menurutnya, berkas BAP tersangka sudah ada yang dilimpah- di Medan yang telah menjadi target operasional (TO). gal diam untuk menindaklan- Sementara itu, ratu judi Acu kan ke JPU karena sudah P-21 (sempurna) dan ada juga masih dalam proses pemberkasan. “Kita terus melakukan razia judi BAP Tersangka Pembunuh “Tidak ada pandang bulu. juga telah memiliki tekat untuk juti atensi Kapolri dalam mem- berantas perjudian. dan dua orang rekannya Abeng dan ST masih ditahan di dalam secara rutin sesuai komitmen pimpinan Polri. Selain itu juga kasus tindak pidana lainnya dan narkoba,” tegasnya. (m31) Pengusaha Valas Siapapun bandar judinya jika memang masih berani bero- menindak tegas setiap anggo- tanya yang terbukti melakukan Diharapkan, masyarakat agar mendukung polisi dalam sel Reskrim Poltabes Medan. Ketiga tersangka kasus judi togel Segera Dilimpahkan perasi akan diringkus dan ditin- pembekingan terhadap kasus memberantas kasus perjudian. itu masih terus menjalani peme- Warga Keluhkan Sikap dak sesuai kepentingan hu- perjudian dalam jenis apapun. Apabila masyarakat mengeta- riksaan secara intensif di Unit MEDAN (Waspada): Poltabes Medan segera melimpahkan kum,” tegas Kapoltabes Medan “Jika terbukti dan menjalani hui ada beroperasi perjudian Judi/Sila Reskrim Poltabes. Oknum Jaksa Dan Hakim Berkas Acara Pemeriksaan (BAP) tersangka pembunuhan Kombes Pol. Drs Imam Margo- hukuman diatas 3 bulan, akan agar melaporkannya ke Polta- Sebagaimana dikatakan Pengusaha PT Surya IndoValas (SIV) Medan ke Kejaksaan Negeri no, Senin (28/9). diusulkan kepada atasannya bes Medan guna penindakan Kombes Pol Drs Imam Margo- MEDAN (Waspada): Nikmah Yapinas, 60, warga Jalan Raya (Kejari) Medan. lebih lanjut. no beberapa hari lalu, bahwa Menteng Medan, korban pemalsuan surat tanah yang dilakukan Diakui Kapoltabes, masih agar oknum polisi yang mem- terdakwa, Mariyani Nasution, mengeluhkan prilaku seorang oknum “Sekarang ini tersangka Richard masih menjalani ada beberapa orang lagi bandar bekingi perjudian itu untuk Dari hasil pengamatan di ketiga tersangka itu akan ditin- pemeriksaan secara itensif. Dalam dua pekan ini, pihak jaksa di Kajari Medan, AH, dan seorang majelis hakim, K, yang judi yang menjadi TO. Namun dipecat,” tegasnya. berbagai kawasan di Medan, dak lanjuti hingga kepersida- tidak kooperatif kepadanya. Hal ini disampaikan Nikmah di redaksi kepolisian selaku penyidik masih melengkapi berkas sebelum identitas para bandar judi itu Dijelaskan Kapoltabes, dari seperti kawasan Cemara, Per- ngan dan barang bukti yang dilimpahkan ke Kejari Medan,” kata Kanit Jahtanras, AKP Waspada, Senin (28/9). masih dirahasiakan guna mem- hasil penyelidikan di lapangan juangan, Helvetia, Menteng, Su- disita dari mereka sudah cukup Nikmah mengatakan, sebagai korban, dirinya berhak Faidir, Sabtu (26/9). perlancar pengintaian anggo- bahwa para bandar judi yang karamai, Teladan, Simalingkar, kuat untuk memenuhi unsur Dijelaskan Faidir, pihaknya masih memintai keterangan mengetahui tuntutan terdakwa agar mengetahui vonis yang tanya di lapangan. diduga masih beroperasi di Serdang, Patumbak, Pancing, sebagaimana pasal yang dike- dijatuhi kepada terdakwa, sebelum keputusan vonis diputuskan. tersangka dan para saksi-saksi serta mengumpulkan barang Selain target meringkus Medan cara kerjanya sangat rapi Tembung, Gaperta, Sunggal, nakan kepada para tersangka bukti. Bila pemeriksaan sudah selesai dan bukti sudah “Terdakwa sudah sampai tuntutan. Saat saya menanyakan ke para bandar judi, Kapoltabes dan bahkan terbilang licin se- masih saja ada perjudian togel tersebut. (m39) majelis hakim, dia menyuruh saya ke jaksa. Saya dioper-oper seperti dikumpulkan, akan kita limpahkan ke Kejaksaan. Seperti diberitakan sebelumnya, pengusaha penukaran bola,” katanya. Valuta Asing (Valas) yakni PT Surya Indo Valas Medan, Junan alias Ajun, 42, warga Jalan Yos Sudarso No.1 Medan, ditemukan tewas membusuk di dalam kamar mandi lantai dua gedung Anggota DPRD Medan Dituntut 8 Bulan Namun saat Nikmah menanyakan tuntutan terdakwa, jaksa sepertinya menghindar. “Saya disuruh datang ke Kantor Kejari Medan, Senin (24/8). Tapi saat saya datang ke sana, saya tidak dilayani. Dia pergi begitu saja setelah tamunya keluar dari kosong Jalan Krakatau No. 102 Medan, Jumat (18/9). Korban tewas dibunuh Richard Leo, 26, warga Jalan Brigjend Damai Yona: Saya Hanya Ingin Bertemu Anak ruangannya. Sebagai korban saya tidak diperdulikan. Saya pengen Katamso Gg. Datuk No. 63 Medan, yang saat ini menjadi tahu vonis yang dijatuhi berapa tahun,” ujarnya. tersangka. MEDAN (Waspada): Ang- pasal 335 ayat 1 ke 1 KHUPidana 13:30. sution. Katanya, dalam mem- Untuk mengetahui tuntutan terdakwa bukan tanpa alasan Mertua korban, Apuk, yakin jika kasus pembunuhan dan gota DPRD Kota Medan, Damai yang dijeratkan terpenuhi,” Terdakwa sempat memar- buat tuntutan jaksa hanya ber- karena ada rasa kekhawatirannya, saat vonis diputuskan terdakwa perampokan terhadap menantunya itu berencana. Pasalnya, Yona Br Nainggolan dituntut 8 tandas JPU. kirkan mobilnya persis di depan pedoman pada perbuatan for- hanya dihukum satu bulan masa percobaan. “Dia kena dua pasal, sebelum ditemukan tewas, Jumat lalu, pagi itu A Jun ketika bulan masa percobaan 1 tahun Bahkan saksi Rohim, me- pagar masuk ke dalam rumah mal berdasarkan berkas. “Seha- satu pasal membuat dan menggunakan surat palsu tanah, dan hendak pergi ke tempat yang dijanjikan Richard, sempat di Pengadilan Negeri (PN) Me- ngemukakan, terdakwa saat serta hampir 1 jam bertahan di rusnya jaksa juga mengungkap kedua pasal 263 tentang penguasaan tanah tanpa hak. Itu ingin pergi dengan anak buahnya. Namun saat itu Richard dan, Senin (28/9). Dia didakwa mendatangi rumah korban lokasi itu. Pemilik rumah dan kebenaran materil dalam tuntu- hukumannya minimal lima tahun,” ujarnya. melarang. “Makanya kita yakin ini pembunuhan berencana,” melakukan penyerangan ke sempat emosi dan mengeluar- keluarganya merasa terancam, tannya,” kata Ojak Nainggolan. Nikmah juga mengeluh tentang perubahan jadwal sidang jelasnya. (m39) rumah Erik LTP Siahaan di Jln kan kalimat ancaman “siapa hingga tidak berani keluar dari Kliennya Damai Yona, kata yang biasanya dilakukan hari Rabu dirubah menjadi hari Senin, Samanhudi Medan. yang ke luar akan kami habisi”. rumah. Ojak Nainggolan, sama sekali tanpa sepengetahuan dirinya sebagai korban. “Perubahan jadwal tidak diberi tahu ke kita, tiba-tiba sidangnya sudah sampai tuntutan “Terdakwa terbukti secara Selain Rohim, saksi lain Ingin Ketemu Anak tidak melakukan perbuatan Polsekta Medan Baru sah dan menyakinkan bersalah yang diperiksa di persidangan Usai menjalani persidang- kriminal. Yang dilakukannya saja,” katanya. (cmai) melakukan perbuatan tindak adalah korban Erik LTP Siahaan, an, Damai Yona Nainggolan, hanya berupa usaha seorang Tingkatkan Pengamanan pidana sesuai pasal 335 ayat 1 Supen, Effredy, Suherman, dan kepada wartawan membantah ibu untuk bertemu dengan Besok IKA UII Sumut MEDAN (Waspada): Untuk menciptakan Kamtibmas ke 1 KHUPidana, “ papar Jaksa M. Afandi, serta dua anggota tuduhan JPU. Katanya, dia da- anaknya yang masih balita. kondusif dan mengantisipasi aksi kejahatan apalagi disaat Penuntut Umum (JPU), Lila Nasution, SH. polisi. Keterangan mereka menguatkan dakwaan JPU. tang ke rumah Erik LTP Siahaan hanya ingin ketemu anaknya ‘’Itu saja. Tidak lebih,’’ tam- bahnya. Halal Bi Halal masyarakat merayakan lebaran Idul Fitri, Kapolsekta Medan MEDAN (Waspada): Ikatan Keluarga Alumni Universitas Islam Baru AKP M Adenan AS,SH,SIK, bersama personelnya secara Di hadapan majelis hakim Atas tuntutan itu, terdak- yang masih balita. Kesannya, kata Ojak, JPU diketuai Wahidin, SH, JPU Lila wa yang hadir di persidangan Didampingi kuasa hukum- dalam membuat tuntutan me- Indonesia Sumatera Utara (IKA-UII Sumut) menggelar acara halal terus menerus secara rutin melakukan patroli di wilayah bi halal di Hotel Arya Duta, Rabu (30/9). hukumnya. Nasution, SH, mengatakan Da- mengenakan pakaian warna nya Ojak Nainggolan dan Ray- ngharuskan Yona, bersalah. Pa- mai Yona, melanggar pasal 335 coklat didampingi kuasa hu- mond B. Pardede,Yona, menga- dahal, seorang jaksa seharusnya Hal itu diungkapkan Ketua Harian IKA UII Sumut H. Ir. Soleh Pantauan Waspada di lapangan, Minggu (27/9), personel Idoan Siregar didampingi Sekretaris Rahmad El Mujamil, ST di Polsekta Medan Baru baik mengendarai mobil dan sepeda ayat 1 ke 1 KHUPidana. “Untuk kumnya, Ojak Nainggolan ku sangat merindukan anaknya dapat membuat penjelasan sekretariat IKA UII Sumut Jalan Garuda No. 78 Sei Sikambing B motor berpatroli di beberapa ruas jalan antara lain Jalan itu, kami mohon agar majelis akan menyampaikan pledoi yang sudah sejak 9 Januari 2009 kalau Damai Yona Nainggolan, Medan, Senin (28/9). Gatot Subroto, Iskandar Muda, Gajah Mada, Darussalam, hakim menghukum terdakwa,” (pembelaan) pada sidang 5 tidak pernah ketemu. “Apa tidak tidak bersalah. Dikatakan Soleh Idoan Siregar yang juga ketua panitia pelaksana KH Wahid Hasyim, S Parman dan lokasi lainnya yang dinilai pinta JPU. Oktober 2009. pantas saya bertemu anak sa- Begitupun, kedua kuasa halal bi halal, acara digelar dalam rangka memperkokoh tali silatu- rawan aksi kejahatan. Menurut JPU, berdasarkan Pada persidangan sebelum- ya,” katanya dan melanjutkan: hukum ini berkeyakinan, hakim rahmi yang sudah terjalin dan sekaligus memperkenalkan para Disela-sela melakukan patroli, AKP Adenan mengatakan, keterangan sejumlah saksi dan nya JPU dalam dakwaannya “Saya harus bertemu dengan yang menyidangkan perkara ini Pengurus IKA UII Sumut yang akan dilantik. patroli yang mereka lakukan ini sesuai instruksi Kapoltabes terdakwa di persidangan dite- me-ngatakan, terdakwa Damai anak saya,’’ katanya. mampu bersikap adil, dengan “Semoga dengan adanya halal bi halal ini dapat memperkokoh Medan, Kombes Pol Drs Imam Margono, agar suasana Kam- mukan ada persesuaian. “Se- Yona Br Nainggolan menda- Kuasa hukum Yona, Ojak membuat putusan, membe- tali silaturrahmi yang sudah terjalin para alumni IKA UII di Sumut,” tibmas kota Medan tetap kondusif. Selain melakukan patroli mua unsur perbuatan pidana tangi rumah korban, Selasa 2 Nainggolan, mengaku kecewa baskan klien mereka dari jelasnya. pihaknya juga menurunkan personel ke pusat-pusat yang dilakukan terdakwa sesuai dan 3 Maret 2009 sekira pukul dengan tuntutan Jaksa Lila Na- tuduhan. (h05) Diharapkan Soleh, para alumni IKA UII di Sumut yang belum perbelanjaan antara lain plaza dan pasar. mendaftarkan diri agar segera mendaftarkan di sekretariat IKA UUI Sumut. Acara yang digelar bernuansakan religius ini dihadiri Pengamanan yang dilaksanakan ini secara langsung mengedepankan kegiatan pencegahan, penangkalan dan didukung kegiatan intelijen, kegiatan penindakan serta Pembunuh Naya Miraza Walikota Medan sekaligus memberikan bimbingan dan arahannya. (rel/m39) penegakan hukum guna mewujudkan dan memelihara stabilitas Kamtibmas yang aman serta tertib dan lancar. Adenan juga mengimbau petugas-petugas satpam harus Dihukum 18 Tahun Penjara peduli dan proaktif menjaga lingkungan di tempat tugasnya MEDAN (Waspada): Mar- Guru Besar Prof Bachtiar Hasan menyampaikan secara singkat darsih Miraza ketika itu masih untuk menghindari terjadi hal-hal yang tidak diinginkan. handi Sitompul, 26, pelaku Miraza meninggal dunia. kronologi peristiwa. Terjadi tertidur pulas di dalam kamar. Sebab, satpam sebagai Pam Swakarsa dan perpanjangan pembunuh istri guru besar Uni- Sebelum majelis hakim tanggal 11 April 2009 sekitar Tiba-tiba Bachtiar Hasan Mira- polisi.(m31) versitas Sumatera Utara (USU) menjatuhi hukuman itu, Bam- pukul 20:30. Terpidana masuk za masuk ke dalam kamar dan Onaya Siti Kadarsih Miraza bang menyebutkan hal yang ke rumah korban melalui pintu terdakwa bersembunyi di da- Teruskan Nama Besar dihukum 18 tahun penjara oleh majelis hakim dalam persi- memberatkan dan meringan- kan. Hal yang memberatkan, di lantai II yang dalam kondisi terbuka. Setelah itu, terpidana lam kamar mandi yang ada di kamar itu. Mandailing dangan yang digelar di Penga- dilan Negeri (PN) Medan. perbuatan terdakwa tergolong sadis. Bukan hanya telah me- bersembunyi di salah satu ruangan menunggu sampai Namun, saat keluar dari da- lam kamar, terlihat oleh Bachtiar MEDAN (Waspada): Pengurus Daerah Himpunan Keluarga Vonis majelis hakim dike- nimbulkan kerugian materil pukul 24.00. Miraza. Tak ingin aksi kejaha- Besar Mandailing (PD HIKMA) Sumatera Utara mengadakan tuai Bambang Utomo lebih namun juga non materi, yang Setelah pukul 24.02 , terpi- tannya diketahui, terpidana acara halal bi halal di kediaman Ketua Umum PD HIKMA H.Tama- ringan dua tahun dari tuntutan membuat keluarga korban trau- dana turun ke lantai I dan duduk memukul kepala sebelah kiri nah Lubis di Jalan Prof HM Yamin, SH Medan, Sabtu (26/9). Jaksa Penuntut Umum (JPU) ma dan mengalami kesedihan diruangtamumenunggukorban Bachtiar dengan linggis. Melihat Ustadz Amhar Nasution memberikan tausiyah agama dalam yang meminta agar terpidana akibat kehilangan anggota ke luar dari dalam kamarnya. Onaya Siti Kadarsih terbangun, acara tersebut yang menekankan tentang arti pentingnya dihukum 20 tahun penjara. keluarga. Sambilmelihat-melihatisirumah terpidana memukulnya dengan penguatan tali silaturahim guna mengembangkan semangat “Saya menyatakan pikir-pikir “Sedangkan hal yang me- yang bisa diambilnya. linggis persis di atas tempat tidur. kebersamaan untuk membangun bangsa yang dimulai dari atas putusan itu,” ujar JPU Fitri ringankan, terdakwa belum per- Ia sempat mengambil kunci Dalam keadaan terkapar, lingkungan keluarga. Sumatri, SH kepada wartawan nah dihukum dan berlaku baik mobil untuk mengambil barang terpidana meminta korban Ketua Umum PD HIKMAH, Tamanah Lubis, mengatakan, usai sidang, Senin (28/9). dan sopan dalam setiap persi- dalam mobil seperti tape mobil menyerahkan uang sebesar Rp1 perlu melestarikan dan mengembangkan seni budaya Dalam amar putusan maje- dangan. “Atas pertimbangan itu dan monitor. Namun, karena juta. Namun, korban menyata- Mandailing yang memang sudah cukup dikenal di seantero lis hakim mengatakan, terpida- terpidana dijatuhi hukuman 18 menimbulkan cahaya dan suara kan tidak memiliki uang dalam ini. Bahkan ke negara tetangga Malaysia dan banyak sekali tokoh- na telah terbukti secara sah dan tahun penjara,” ucap Bambang terpidana mengurungkan jumlah itu di dalam rumahnya. tokoh Mandailing yang telah berkarya secara Nasional maupun menyakinkan melakukan per- Utomo. niatnya. Karena tidak mendapatkan ke- Internasional seperti Adam Malik sebagai Wapres dan Jenderal buatan pidana yang mengaki- Mendengar putusan itu, Sekitar pukul 05.00, korban inginannya, lalu ia hanya meng- Besar AH Nasution dan sekarang ada Adnan Buyung Nasution, batkan hilangnya nyawa orang majelis hakim mempersilahkan Prof Dr Bachtiar Hassan Miraza ambil dua telefon genggan milik Anwar Nasution, Todung Mulya Lubis dan lain-lain. Kepada lain, sebagaimana diatur dan terdakwa untuk menempuh ke luar dari dalam kamar me- korban yang terletak di dalam generasi muda, Tamanah berharap dapat meneruskan nama diancam pasal 365 ayat 4 KHUP jalur hukum jika keberatan atas nuju dapur. Saat itu juga terpi- kamar. Waspada/Rustam Effendi besar Mandailing. tentang pencurian disertai de- putusan itu. Namun, terdakwa dana masuk ke dalam kamar Setelah behasil, terpidana SAMPAH: Dua anak nelayan bermain di atas tumpukan Hadir pada acara itu, antara lain, Samuel Lubis, Marwan ngan kekerasan yang menye- hanya menyatakan piker-pikir. korban dan mengampil perhia- selanjutnya ke luar melalui atap sampah di belaknang rumah warga Kelurahan Bagan Deli Efendi, Efdi Boy Nasution, HMD Sakti Hasibuan, Dr Arsyad babkan kematian. Sementara, JPU Fitri Sumarni san yang terletak di atas meja dan bersembunyi di rumah Kecamatan Medan Belawan. Tumpukan sampah itu sangat banyak Lubis, Yasir Ridho Lubis, Prof Dr. Arif Nasution, Sigit Pramono Kekerasan yang dilakukan menyatakan hal serupa. kamar tidur korban. kostnya Jalan Djamin Ginting sehingga membuat pantai di sekitar itu jorok. Foto diambil pekan Asri dan Kamaluddin Harahap. (cmai/rel) terpidana mengakibatkan istri Sebelumnya dakwaan JPU Sedangkan Onaya Siti Ka- Medan. (h05) lalu.
  • 12 Opini WASPADA Selasa 29 September 2009 Menatap Perekonomian RI Masa Depan Bagi mendorong pemulihan eko- Terbuka akses perekonomian pada da- Oleh Bachtiar Hassan Miraza nomi yang lebih cepat perlu diperha- erah sekeliling maupun pada daerah tikan beberapa hal. Pertama, pemba- lainnya pada berbagai sektor kegiatan. ngunan masa mendatang agar lebih Ketiga, memperbesar peran pe- B anyak pihak yang tidak meli- kecil 5 persen sementara nilai tukar memperhatikan masalah pemerataan, merintah daerah dengan memberikan hat bahwa ketenteraman rupiah berada pada kisaran Rp 10.000 baik daerah maupun sektor agar kepin- kewenangan dan pembiayaan pemba- yang terjadi selama berjalan- per dolar Amerika Serikat. Walaupun cangan ekonomi yang ada selama ini ngunan yang lebih sepadan sesuai de- nya kegiatan politik (pemilu secara rata rata pencapaian ini terhitung dapat dihilangkan. Pemerataan pem- ngan pembangunan wilayah yang dan pilpres) baru-baru ini sebagai suatu rendah tapi dapat kita maklumi karena bangunan secara sektoral dan daerah hendak dikerjakan. Dengan berbagai kondisi yang menyebabkan terjaganya perekonomian Indonesia saat ini baru mampu memperkuat daya dorong mekanisme pemerintah pusat dapat stabilitas ekonomi dan sekaligus ikut dalam tahap pemulihan. Bagaimana pertumbuhan ekonomi itu sendiri. Kita menyerahkan bagian dari pemba- mendorong pemulihan ekonomi Indo- mempercepatnya dan meningkatkan- hendaknya tidak melihat manfaat jangka ngunan ekonomi nasional pada pe- nesia. Setidak-tidaknya tidak sampai nya pada masa mendatang adalah suatu pendek yang sifatnya instant tapi ber- merintah daerah karena secara tepat mengganggu jalannya pemulihan eko- tantangan bagi kita. Kita harus banyak pikir jangka panjang walau manfaat nya merekalah yang lebih tahu perma- TAJUK RENCANA nomi yang sedang berjalan. Memang masih ada satu langkah lagi yang me- berpikir dan meninggalkan cara cara baku yang berjalan selama ini. Pemu- saat ini adalah kecil. Indonesia masa mendatang sangat memerlukan daya salahan dan prioritas pembangunan di daerahnya. Pemerintah daerah di- nyangkut kegiatan politik yang erat lihan ekonomi tidak bisa kita lakukan dorong bagi menumbuhkan perekono- dorong meningkatkan laju pertum- hubungannya dengan stabilitas eko- dengan cara cara biasa tapi harus ada mian nasional. Daya dorong inilah yang buhan daerah dengan memanfaatkan terapi khusus bagi mempercepat pe- harus dikejar bukan manfaat jangka sumberdaya dan tenaga kerja lokal. Biarkan Hukum Bicara nomi yaitu pembentukan pemerin- tahan baru. Sebagaimana biasa pem- mulihan dimaksud. Oleh sebab itu kita pendek. Pembangunan adalah sebuah Akhirnya, apa yang hendak kita bentukan pemerintahan baru tidak perlu mencari dan lebih merinci lang- proses yang berjalan secara bertahap tuju nantinya adalah meningkatkan saja menjadi perhatian masyarakat kah langkah yang akan kita tempuh pada dan berakumulasi. daya beli mayarakat melalui pencip- K asus yang mencuat di jajaran KPK dan Polri saat ini harus dilihat dari di dalam negeri tetapi juga masyarakat kwartal IV ataupun setelah pemerintah- Kedua, adalah sasaran pembangun- taan kesempatan kerja dan pening- dua sisi. Sisi positif dan negatif. Yang positif dilanjutkan, sisi negatif luar negeri, khu-susnya investor luar an baru terbentuk. an yang harus tertuju pada pembangun- katan pendapatan masyarakat sebagai jangan diteruskan. Oleh karena itu, semua pihak hendaknya menahan negeri. Dunia usaha di dalam negeri Lima tahun ke depan, pemerintahan an infrastruktur, khususnya infrastruktur kelompok pengguna (users/demand- diri untuk melakukan intervensi (negatif) karena memperburuk upaya juga tidak luput ikut memperhatikan- baru adalah lambang pembangunan yang dapat membuka dan menembus ers) atas barang yang dihasilkan. De- penegakan hukum, termasuk Presiden tidak boleh mengintervensi nya karena pembentukan pemerin- ekonomi Indonesia. Baik buruknya ma- kantong kantong wilayah produktif. ngan demikian terjadi dorongan pada tahan baru tersebut memberikan isya- sa depan perekonomian Indonesia di- Pembukaan akses ke wilayah produktif pertumbuhan sektor produksi yang kedua lembaga independen itu. rat arah dari pemerintahan yang akan tentukan oleh siapa yang dipercaya du- merupakan suatu persyaratan pertum- dapat menciptakan bangkitnya sektor Keluarnya Perppu untuk mencari tiga Plt pimpinan KPK setelah Antasari Azhar datang, khususnya arah perkembang- duk mengurus perekonomian itu. Maka buhan ekonomi secara merata sekaligus konsumsi untuk selanjutnya. Kita tidak ditetapkansebagaitersangkakasuspembunuhanNasruddin,dandualainnya–Chandra an ekonomi dalam negeri. marilah kita berdoa semoga para men- memperkuat daya dorong pertum- dapat menyatakan yang satu lebih Hamzah dan Bibit Samad Riyanto—ditetapkan sebagai tersangka dalam kasus Saat ini kita sudah berada pada teri yang duduk dalam pemerintahan buhan ekonomi itu sendiri. Kita tidak penting dari lainnya karena pada da- penyalahgunaan wewenang/kekuasaan kemudian (versi Kapolri) tersangkut kasus kwartal III tahun 2009. Diharapkan pada yang akan datang adalah para menteri menghendaki pertumbuhan hanya sarnya kedua sektor tumbuh secara suap,menuruthematkitasudahmerupakantindakanintervensidariPresidenterhadap kwartal ini kondisi perekonomian akan yang mengetahui permasalahan inti terjadi pada satu wilayah karena akan serentak dan saling mendukung. Sin- semakin baik jika dibandingkan dengan ekonomi bangsa dan mencarikan solu- menimbulkan dampak memperlemah kronisasi keduanya merupakan pro- KPK. Perppu itu pun menimbulkan pro dan kontra. sinya sesuai dengan struktur perma- pertumbuhan itu. Ia harus berjalan se- ses pertumbuhan ekonomi yang akan kwartal II sebelumnya. Kwartal II me- Kita berharap Perppu menetapkan tim lima untuk mencari Plt KPK yang kosong nunjukkan bahwa kinerja ekonomi ma- salahan bangsa ini. Bukan mereka yang cara merata bagi mempercepat pertum- menciptakan kesejahteraan masyara- berjalan sukses. Artinya, mereka yang terpilih benar-benar berkualitas, berani kro Indonesia berjalan positif dengan berpikir di luar kebutuhan bangsa, tapi buhan secara simultan. Dimulai dari kat secara keseluruhan. menjalankan tugas berat KPK untuk memberantas korupsi tanpa pilih kasih. hasil pertumbuhan ekonomi mencapai berpikir harmonis sesuai permasalahan manfaat yang mungkin relatf kecil me- Oleh karena itu tugas tim lima sangat berat, dalam waktu singkat harus dapat lebih kurang 4 persen, laju inflasi lebih dan kebutuhan bangsa. nuju pada manfaat yang relatif besar. Penulis adalah pemerhati ekonomi mencari Plt KPK yang segera dapat bekerja di lembaga pemberantasan korupsi itu. Jika salah pilih, dampaknya sangat negatif bagi masa depan bangsa dan negara, PKS Dan Sejarah Kota Medan khususnya upaya pemberantasan korupsi ke depannya. Wajar saja kalau banyak pihak yang menolak campur tangan pemerintah dalam hal ini Presiden SBY dalam mengatasi masalah KPK. Apalagi, KPK meski ditinggal ketuanya Antasari Azhar masih tetap bertaring dalam mengejar para koruptor. Bahkan, dengan dijatuhkannya status tersangka terhadap Chandra dan Bibit, dua pimpinan melawan kekuasaan kolonial. Pers yang Medan dan sekitarnya pada tahun 1946 KPK yang tersisa masih sanggup menjalankan tugas-tugas KPK karena memang sistemnya sudah berjalan dengan baik. Oleh Budi Agustono mengecam dan mengejek kekuasaan ko- lonial dan arogansi pemilik modal (perke- pecah revolusi sosial yang merenggut ratusan korban jiwa. Tidak lama sesudah Maraknya kasus Polri dengan KPK berawal dari kecurigaan KPK terhadap salah bunan)semakinmeradikalisasipergerakan berakhir amuk revolusi sosial, Belanda Intisari seorang petinggi Polri terlibat dalam kasus Bank Century. Sangat disesalkan, mengapa petinggi Polri sampai mengetahui kalau ia sedang dalam inceran KPK untuk disadap? S etelah pelantikan anggota Dewan Perwakilan Rakyat Daerah Medan tanggal 15 September lalu, Partai Keadilan Sejahtera (PKS) langsung meng- Langkat, yang mengakui kedaulatan Belanda sampai terbentuknya pemba- ngunan kota Medan tahun 1910-an, maka hampir lima puluh tahun itulah kota Me- kebangsaan. Gejolak pergerakan kebang- saan lokal berjalin kelindan dengan dina- mika pergerakan kebangsaan di Jawa. KetikaGubernurJenderalDeJongmenjadi ingin kembali menjajah Sumatera Timur lewataksipolisionil(clash)yangmelahirkan perang kemerdekaan. Di masa ini Belanda membentukNegaraSumateraTimuryang gelar rapat kerja (raker) fraksi untuk me- dan beserta infrastruktur modernnya penguasa utama di Hindia Belanda pada didukung Kesultanan. Namun, NST han- Pastilah ada orang dalam KPK yang nyusunprogramkerjakedepan.Salahsatu dibangun untuk kepentingan politik dan tahun 1930-an, suasana pergerakan tam- cur berantakan lantaran mendapat perla- Proses hukum menja- membocorkannya. Itu menunjukkan kalau program yang disusun adalah usulan me- ekstrasi ekonomi kolonial ke negeri induk pak lumpuh dan tidak berdaya. Gubernur wanan dari rakyat. Memasuki tahun 1950- di acuan.Tak ada kebal orang-orangdarikepolisianyangditempatkan masukkan sejarah kota Medan menjadi mata pelajaran tambahan di sekolah. kapitalisme (Belanda dan negara Eropa lainnya). Di sepanjang kekuasaannya pe- Genderal De Jong sangat konservatif dan andenganmeningkatnyakonstelasipolitik diKPKbisajadimasihmemilikirasasolidaritas, tetap mendambakan Belanda tetap ber- sebagaidampakdaripolitiknasionalpecah hukum. Oknum KPK sa- tidak senang pimpinannya disadap KPK Menurut Ikrimah Hamidy, Ketua FPKS merintah kolonial Belanda dan hegemoni kuasa ratusan tahun lagi. Akibat kebijakan pemberontakan daerah. Setelah pem- DPRD Medan, pelajaran sejarah kota perkebunan membawa dampak politik, politiknya yang reperesif, karena aktivitas berontakan daerah dipadamkan berlang- lah dihukum, pimpinan untukditangkapkarenaujung-ujungnyaakan Medan itu penting untuk mendidik agar ekonomi, sosial, dan budaya. Oleh karena, politiknya banyak pemimpin pergerakan sung nasionalisasi perusahaan Belanda, mempermalukan institusi Polri. Kalau tidak Polri salah juga menjalani ada yang membocorkan, bagaimana para siswa mengetahui karakter dan dampak politik kekuasaan kolonial mem- punyaimagnitudeyangbesar,maka ketika banyak yang ditangkap. Apa yang terjadi termasuk perkebunan. Setelah itu tahun sejarah kotanya guna menimbulkan di tahun 1930-an di Jawa berimbas di Me- 1960-an partai politik (PNI, Masyumi, NU, proses hukum. mungkin Kepala Badan Reserse Kriminal kecintaan terhadap daerahnya. terjadisuatuperistiwapolitikdiluarMedan dan dan sekitarnya, Residen SumateraTi- PKI, dan Parkindo) dan organisasi massa (Kabareskrim) Mabes Polri Komjen Pol Susno Selama ini, banyak siswa yang tidak dapat berpengaruh ke wilayah lainnya. mur danpemilikmodal(perkebunan)me- seperti Serikat Buruh, Serikat Petani, dan Duajisampaitahudirinyadisadap?Meskipun mengenal dan merasa asing dengan Misalnya, perang Sunggal atau sering dise- nindak keras kaum pergerakan yang ber- sebagainya memainkan peranan penting ia tidak secara implisit menyatakan KPK lah yang menyadap dirinya, namun terjadinya sejarah kotanya. Padahal itu penting agar butperangBatakyangmeletuptahun1872 akibat padamnya gerakan kebangsaan di dalampolitisasimasyarakat.Dimasainilah ‘’perang’’antaraKPKdanPolridenganistilah‘’cicak’’lawan‘’buaya’’sudahmenunjukkan kelak bisa lebih mencintai dan melesta- sebagai protes orang Karo terhadap do- wilayah ini sampai menjelang tahun 1942. konflik politik aliran mewarnai wilayah hal itu. rikan tempat-tempat bersejarah yang ada minasi perkebunan dan kekuasaan Sultan Ketiga, tahun 1942 –1945 adalah masa ini. Puncak dari konflik politik itu adalah di daerah tersebut. Kota Medan punya Deli yang merampas tanah ulayat mereka pendudukan Jepang sampai perang ke- gerakan 30 September 1965. Periode 1950- Kalau akhirnya tim pengacara Wakil Ketua KPK nonaktif Bibit Samad Riyanto bukan terjadi di Medan, tetapi dampak banyak peninggalan sejarah, salah satu merdekaan. Masa pendudukan Jepang an- 1960-an merupakan zaman kelabu dan Chandra M. Hamzah menyatakan akan melaporkan Kabareskrim ke Inspektorat cara melestarikannya adalah dengan politiknya sangat terasa sekali di sekitar membawa perubahan politik dalam per- diMedandansekitarnya.Dikatakankelabu Pengawasan Umum (Irwasum) Mabes Polri, hal itu perlu diberi dukungan. Apalagi memberikan pengetahuan dan pema- Medan. Masuknya kekuasaan Belanda gerakan kebangsaan. Di masa ini kaum karena masih banyak historical events kalau KPK berani menangkap petinggi Polri yang terlibat kasus korupsi. Kita memang haman kepada generasi muda lewat tahun 1861 yang diikuti dengan mengalir- pergerakankebangsaanmendapat tempat yang belum terungkap sampai sekarang. menyesalkan mengapa KPK kelihatannya malah takut sehingga banyak kasus korupsi pelajaran di sekolah (Waspada Online, 17 nya modal kolonial sampai awal abad dalamkekuasaanJepang.Jepangmemberi di Polri yang disebut-sebut media tidak terungkap ke permukaan. Begitu juga kasus September 2009). keduapuluhtahun,mendorongperubah- jabatan di pemerintahan kepada kaum Mencerdaskan korupsi di kejaksaan. Baru kasus Urip saja yang berhasil diungkap KPK dengan barang Usulan program kerja PKS ini patut an besar dalam bidang politik dan eko- pergerakan tidak lain untuk mendukung Periodesasi sejarah kota Medan di atas bukti sangat lengkap karena pelakunya tertangkap basah. diacungi jempol karena usai pelantikan nomidisekitarMedan.Menciutnyakekua- politik perangnya dengan Sekutu. Meski masih umum dan memerlukan diskusi PKSbukannyatenggelamdalamgemuruh saan Kesultanan, perubahan birokrasi memihak kaum pergerakan, tetapi Jepang lebih lanjut. Jika PKS ingin memasukkan Melihat sistem kerja KPK yang lambat, meskipun wewenangnya sangat besar suka cita, tetapi langsung menggelar rapat tradisional patrimonial ke birokrasi mo- tetap mempertahankan relasinya dengan sejarah kota Medan menjadi mata pela- sehingga terkesan sebagai lembaga ‘’super body’’ namun kasus korupsi yang kerja fraksi. Menariknya lagi dan ini dern (kolonial), pengelolaan politik yang Kesultanan. Namun di masa ini terjadi jaran di sekolah dapat mempertimbang- berhasil diungkap relatif masih sedikit (kecil). Namun begitu, kita patut memberi mungkin tidak pernah terpikirkan partai represif sebagai akibat kekuasaan kolonial perubahan struktural di tingkat bawah kan periodesasi di atas. Namun, bila seja- apresiasi kepada KPK karena sebelumnya upaya pemberantasan korupsi lainnya yang ada di DPRD Medan, PKS yang mengutamakan keamanan dan yaitu kelompok etnik lain yang bermigrasi rah kota Medan disajikan tidak utuh dan mengalami gagal total. Polri dan Kejaksaan dinilai tidak bertaring, sehingga mengusung program memasukkan se- ketertiban, kekerasan politik di luar batas kesekitarMedandidorongJepangmengo- tidak komprehensif dengan menghilang- dibentuklah KPK. jarah kota Medan menjadi mata pelajaran kemanusiaan oleh pemilik modal (perke- lah tanah dengan menanam padi dan kan aspek strukturalnya tidak saja akan Justru itu, tim lima dalam mencari Plt pimpinan KPK tidak perlu memasukkan tambahan di sekolah. Soal sejarah kota bunan) adalah contoh dari perubahan jagung, satu hal yang tidak pernah terjadi merugikan masyarakat, tetapi justu orang-orang dari Polri dan Kejaksaan. Sebab, selama ini saja mereka sudah gagal. Medan menjadimatapelajaran disekolah politik tersebut. Sedangkan di bidang eko- sebelumnya. Sementara pihak penduduk membuat masyarakat Sumatera Utara Kalaupun ada, orangnya harus bersih, berani, seperti Baharuddin Lopa. Orang-orang mungkin tidak menarik partai lainnya nomi, Medan menjadi termasyhur dalam asli (Melayu) tidak senang dan marah atas bingung dan terasing dengan sejarahnya karena tidakbisamencuriperhatianpublik masyarakat international karena salah apa yang dilakukan Jepang karena dengan sendiri.Olehkarenaituuntukmewujudkan dari Parpol juga harus dihindarkan karena akan menimbulkan ‘’conflict interest’’ yang suka dengan isu sexy, apalagi soal satu penghasil tembakau bermutu dunia. masuknya pendatang mengolah tanah salah satu agenda Fraksi PKS DPRD mengingat banyak politisi yang ditangkap KPK selama ini. sejarah tentu akan semakin luput dari Selainitu, Kesultanan(Deli)melaluikonsesi membuat etnik Melayu kehilangan hak Medan, PKS perlu mengajak Dinas Pen- Kalauadausulandariberbagaipihakkepadatimlimasebagaitindaklanjutkeluarnya perhatian, kalau bukan terabaikan dalam tanah yang diberikan kepada pemilik istimewanya sebagai penduduk asli. Hal didikan dan Kebudayaan, Masyarakat Perppu agar Plt pimpinan KPKdipilih dari orang dalam atau mantan pimpinan KPK pembahasan agenda partai. Sebaliknya, modal tumbuh menjadi salah satu aktor inilah yang mendorong meletupnya Sejarawan Indonesia Sumatera Utara, dan sebelumnya, hal itu cukup rasional. Tentu sangat riskan kalau ternyata Plt pimpinan PKS menganggap sejarah kota Medan ini ekonomi dalam masyarakat kolonial. De- konflik pertanahan antara pendatang dan Departemen Sejarah Fakultas Sastra USU, KPK yang baru ternyata antek-anteknya Orba dan punya kedekatan hubungan dengan sangatpentingdanprinsipilkarenabanyak ngan kekuatan ekonomi inilah Kesultanan penduduk asli. Konflik tanah ini berhim- dan pemangku kepentingan lainnya para koruptor kelas kakap sehingga semua rahasia KPK dijualnya, maka hancurlah masyarakat, terutama siswa dan kalangan Deli menegakkan dan membangun sim- pitan dengan persoalan etnik sehingga duduk bersama mendiskusikan sejarah KPK.HancurnyaKPKberartijugamenghancurkancitraPresidenSBYyangmengeluarkan terpelajar lainnya yang tidak mengerti bol budayanya seperti mendirikan Istana konflik tanah bergeser menjadi konflik kota Medan. Agenda Fraksi PKS DPRD sejarah kota Medan. Namun, PKS tidak Maimoon, Masjid Raya, Gedung Kerapat- etnik. Selain itu Jepang juga membentuk Medan ini merupakan pekerjaan besar perppu. Hal ini sangat tidak diharapkan! merinciapadanbagaimanaisisejarahkota an, dan sebagainya. Heiho, Gyugun, Bompa, Talapeta dan karena jika terlaksana, PKS Medan telah Harapan kita, biarkan hukum bicara. Siapa pun yang bersalah harus diproses Medan yang diusulkan menjadi mata Kedua, tahun 1900 – 1942 merupakan sebagainya. Kelahiran organisasi semakin memberikan konstribusinya dalam men- sesuai hukum yang berlaku. Tidak hanya tersangka di KPK, tetapi juga petinggi Polri pelajaran di sekolah. Tulisan ini akan masa perkembangan nasionalisme. Mun- meradikalisasi kaum pergerakan menyua- cerahkan dan mencerdaskan masyarakat jika bersalah harus diajukan ke pengadilan. Kalau semuanya mengacu pada proses mencoba membentangkan tema-tema culnya pergerakan kebangsaan (nasio- rakan kemerdekaan. Namun begitu di Sumatera Utara. hukum pastilah rakyat senang, dan masa depan bangsa menjadi cerah.+ tertentu secara diakronik untuk mengisi nalisme) awalnya dipelopori oleh lahirnya masa ini pula banyak penduduk yang di- muatan sejarah kota Medan sebagaimana Budi Utomo, Sarikat Islam, Partai Nasional rekrutmenjadiromusha,kerjapaksatanpa Penulis adalah staf pengajar Jurusan yang diagendakan dalam program kerja Indonesia(PNI)yangtokoh-tokohnya ber- upah, yang dipekerjakan ke berbagai da- Sejarah Fakultas Sastra USU. Hubungi kami FPKS DPRD Medan. Berdasarkanperiodesasiadabeberapa asal dari Jawa. Kemudian gerakan kebang- saan yang mulanya dari Jawa itu pada erah. Jepang kalah perang dengan Sekutu tahun 1945 dan Indonesia menguman- halyangperludisampaikanuntukmengisi tahun 1920-an kepemimpinannya mulai dangkan kemerdekaan. KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada muatan sejarah kota Medan. diambil-alihpemimpinlokal.Parapemim- Keempat, 1945 – 1965 adalah masa Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM Pertama, terbentuknya sejarah kota Medan (modern) tidak berdiri sendiri dan pin lokal inilah yang melawan penguasa kolonial, kapitalisme, imperalisme, dan kemerdekaan sampai meletusnya peris- tiwa 1965. Di Sumatera Utara, terutama SUDUT BATUAH Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tidak pula dapat diterangkan dengan pen- hegemoni perkebunan. Dengan mene- Medankemerdekaandiproklamirkanagak Faks Tata Usaha: (061) 4531010. tanggal 25 Februari 1988 jelaskan tunggal. Pembentukan sejarah riakkan anti-kapitalisme, anti-imperialis- terlambat. Akan tetapi, pada masa ini ke- E-mail Redaksi: redaksiwaspada@gmail.com * Presiden ajak rakyat pesta batik Anggota SPS No. 13/1947/02/A/2002 kota Medan terkait erat dengan perluasan me, dan anti-feodalisme gerakan nasio- tegangan politik, terutama sesudah ber- 2 Oktober KANTOR PERWAKILAN kekuasaan Belanda pada pertengahan nalisme mendapat tempat di kalangan dirinyalaskar-laskar,konflikpolitiksemakin - Takutnya harga batik pun ikut Percetakan: PT Prakarsa Abadi Press abad 19 ke Sumatera Timur. Akan tetapi buruhperkebunan.Kaumburuhdiberba- menajam. Seturut dengan itu partai politik melambung Bumi Warta Jaya Jalan Letjen Suprapto/Brigjen Katamso No. 1 kota Medan sendiri dibangun bukan oleh gai dikantong-kantongperkebunanmulai yang dengan beragam ideologi bermun- Jalan Kebon Sirih Timur Dalam No. 3 Medan 20151 pemerintah Belanda, namun perkem- terlibatdalampergerakannasional.Dalam culan.Demikianpuladengankonfliksosial * Rakyat tak ingin kabinet SBY Jakarta 10340 Tel: (061) 6612681 kaitannya dengan kelahiran nasionalisme, Tel: (021) 31922216, Faks: (021) 3140817. bangan dan pertumbuhannya lebih ba- antara rakyat dengan Kesultanan semakin diisi politisi Isi di luar tanggung jawab percetakan nyak difasilitasi oleh pemilik modal asing di awal abad 20 masyarakat Karo melawan membubung tinggi. Bagaimana mana - Maklum ‘talk only’ Jalan Ratu Syafiatuddin No. 21 C Harga iklan per mm kolom: dari berbagai negara yang diwakili dalam penguasa kolonial yang mesin perangnya peran antar laskar memperebutkan sum- Banda Aceh 23122 Tel & Faks: (0651) 22385 BW Rp. 11.000,- bentuk perkebunan. Para pemilik mo- jauh lebih modern itu. Perlawanan orang ber daya lokal yang hasilnya dibarter de- * Masyarakat kembali kecam FC Rp. 30.000,- dal kolonial inilah yang meletakkan pon- Karo ini, dalam batas-batas tertentu meru- ngan persenjataan modern di Semenan- pemadaman listrik Jalan Iskandar Muda No. 65 Lhokseumawe dasipembangunankotaMedan.Jikadilihat pakan munculnya nasionalisme (etnik) jung Malaya dan peran laskar dalam - Habis terang datanglah gelap, Halaman depan BW Rp. 33.000,- Tel: (0645) 42109 he...he...he Halaman depan FC Rp. 90.000,- darimasuknyaBelandakeSumateraTimur lokalpertamadisekitarMedan.Disamping mempertahankankemerdekaanmerupa- el D o Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm tahun 1861 melalui kontrak politik dengan itu, pada periode ini pula bermunculan kan sebuah episode yang menarik. Na- Wak kesultanan Asahan, Serdang, Deli, dan pers yang menjadi instrumen perjuangan mun, belum genap 12 bulan merdeka di WASPADA Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
  • WASPADA Selasa 29 September 2009 Opini 13 Label Halal, Bukan Label Haram tegas telah memberikan pengaturan tentang hewani, dan bahan penolong untuk produk cial responsibility), yaitu kepedulian dan 10 ayat (1) Peraturan Pemerintah Nomor 69 PenggodokanRUU-JPH juga diharapkan makanan dan minuman. olahan. Pada prinsipnya semua bahan pa- komitmen moral perusahaan terhadap Tahun 1999 tentang Label dan Iklan Pangan. terhindar dari conflict of interest, yang dapat Telaah tentang kehalalan panganan nganan tersebut adalah halal, kecuali yang kepentingan masyarakat, terlepas dari kal- Kondisi ini pulalah yang melahirkan perbe- merugikan dan membahayakan konsumen dan/atau barang tidak saja terhenti demi diharamkan oleh syari’at Islam. Padangan kulasi untung dan rugi perusahaan. Salah daan sanksi atas penyalahgunaan label jalal, muslim sendiri, sehingga dapat menjadikan kesehatan, namun jauh dari itu, kehalalan Islamterhadappanganantidakhanyahalalan satu tanggung jawab sosial perusahaan sehingga bukan tidak mungkin akan menim- fungsi pengawasan terhadap produsen panganan atau barang yang dikonsumsi saja, namun juga harus thayyiban. Dalam tersebut adalah perlindungan terhadap kon- bulkan kesulitan dalam penetapan sanksi menjadilemahdalamhalpenerbitansertifikat sangat terkait dengan penciptaan perilaku beberapa ayat Alquran, kata halalan selalu sumen. Perlindungan konsumen memiliki yang harus diterapkan terkait dengan penya- halal. Karena kehalalan suatu produk meru- manusia. Artinya dengan mengkonsumsi diiukuti dengan kata thayyiban, hal ini me- cakupan yang luas, meliputi perlindungan lahgunaan label halal. pakan kepentingan umat untuk mendapat- panganan dan barang yang jelas kehalal- nunjukkan, masyarakat Muslim harus meng- terhadap konsumen barang dan jasa, yang Jika Singapura yang berpenduduk ma- kanhaknyamengkonsumsibarangdan/atau annya, maka akan melahirkan perilaku konsumsi panganan yang halalan dan thay- berawaldaritahapkegiatanuntukmendapat- yoritas non-muslim dijadikan perbanding- jasa yang berkualitas dan sehat yang di- Oleh H Fadly Nurzal, SAg manusia yang baik pula. Dari sudut pan- yiban dari sisi zat, proses produksi, distribusi, kan produk hingga sampai akibat-akibat dari an dengan Indonesia yang berpenduduk wajibkanSyariatIslam.Maka,biarkanlahDPR dang akidah, mengkonsumsi panganan tujuanproduksi,hinggapadaakibatmenkon- pemakaian produk tersebut. mayoritas Muslim, maka akan nyata, per- RI dan Pemerintah, secara bijak dan men- dan barang yang halal merupakan ibadah sumsi panganan itu. Maka panganan yang Labeladalahsetiapketeranganmengenai hatian Singapura terhadap warga Muslim dengarkan aspirasi masyarakat khususnya T erminologi ‘halal’ dan ‘haram’ bagi umat muslim. halal dari segi zatnya dapat menjadi haram, pangan yang berbentuk gambar, tulisan, cukup besar. Hal ini dibuktikan, Singapura umat Islam guna menyempurnakan me- memang lekat dengan Islam, tapi Jika seluruh umat Islam pendudukan ketika cara memproduksi dan tujuan men- kombinasi keduanya, atau bentuk lain yang telah menetapkan Badan Sertifikasi Halal nyempurnakan pembahasan RUU-JPH. setiapagamamemilikikriteriahalal mayoritas Indonesia mengkonsumsi pa- konsumsinya melanggar ketentuan-keten- disertakan pada pangan, dimasukkan ke Singapura, Majelis Ulama Islam Singapura dan haram-nya masing-masing. nganan dan barang yang halal, sama ar- tuan syara’. dalam, ditempelkan pada, atau merupakan sebagai lembaga satu-satunya yang berwe- Penutup Dalam agama Yahudi dikenal kata ‘kosher’, tinya bahwa pemerintah sedang memper- Konsumen dalam Islam, tidak semata- bagian kemasan pangan. Sedangkan ma- nang menerbitkan sertifikat halal, Hal ini Pada hakikatnya, kepedulian dan tang- mirip dengan halal, namun kriterianya siapkan masyarakat yang berperilaku baik. mata mengkonsumsi kebendaan hanya kanan halal adalah pangan yang tidak terlihat dari keberadaan Sertifikat Halal gungjawab perusahaan terhadap konsumen berbeda. Seperti juga Umat Islam, orang- Jika alur pikir ini yang digunakan, maka didasarkan pada rasionalisme semata, tetapi mengandung unsur atau bahan yang haram MUIS telah terbit sejak tahun 1978. Bahkan muslim adalah wujud kepentingan untuk orangYahudi juga cukup berhati-hati terkait sesungguhnya pengesahan Rancangan juga konsumen untuk kerohanian, sosial dan atau dilarang untuk dikonsumsi umat Islam, di negara-negara sekuler sekalipun seperti perusahaan itu sendiri guna mendapatkan dengan makanan yang dikonsumsi. Undang-Undang Jaminan Produk Halal lingkungan. Allah SWT memerintahkan ke- baik yang menyangkut bahan baku pangan, Eropa telah mengatur tentang label halal, keuntungan. Keuntungan itu diperoleh dari Indonesia yang penduduknya mayori- (RUU-JPH) harus disegerakan untuk men- pada umatnya. Dalam hal ini konsumen, bahan tambahan pangan, bahan bantu dan hal ini menunjukan keseriusan mereka tanggung jawab dan kepedulian terhadap tas muslim, sampai saat ini belum memiliki jadi UU, demi keselamatan masyarakat untuk mengkonsumsi makanan yang baik, bahan penolong lainnya termasuk bahan untuk melindungi hak-hak wargannya, konsumenmuslim,yangdirealisasikandalam peraturan atau undang-undang yang tegas Indonesia. halal dan bermanfaat bagi manusia, juga pangan yang diolah melalui proses rekayasa khususnya konsumen muslim. bentuk kepercayaan publik dan kemudian mengatur tentang label halal. Karena itu Perlu dipahami, pembentukan UU JPH memanfaatkan segala anugerah-Nya sebagai genetika dan iradiasi pangan, dan yang pe- Pemerintah Republik Indonesia me- bergerak ke arah pemetikan hasil dari ke- makanan yang beredar di pasaran, dapat sebagai payung hukum yang mengatur wujud ketaatan kepada-Nya. ngelolaannyadilakukansesuaidenganketen- nyerahkan kewenangan untuk menerbit- percayaan publik. dikategorikan syubhat. Mengapa syubhat? tentang label halal, bukan untuk meme- Karena itu pula, tujuan konsumen mus- tuan hukum agama Islam. kan sertifikasi halal kepada Majelis Ulama Terkait dengan kehalalan produk pangan karena memang meragukan, tidak ada ja- nangkan masyarakat mayoritas dan menga- lim dalam mengkonsumsi panganan ber- Terkait dengan keselamatan konsumen Indonesia (MUI) melalui Piagam Kerjasa- dan barang, biasanya konsumen merupakan minan makanan tersebut halal. Halal me- lahkan warga minoritas, dan bukan pula tujuan untuk mengabdi dan merealisasikan muslim, baik secara akidah, rohaniah mau- ma Departemen Kesehatan, Departemen golongan yang sangat rentan diekpsloitasi miliki pengertian yang sangat luas, yakni mengunggulkan satu agama dan mengker- tujuan yang dikehendaki Allah Swt. Fuqaha’ pun jasmaniah, dalam mengkonsumsi ma- Agama, dan Majelis Ulama Indonesia Ta- secara buruk oleh produsen, terlebih lagi ter- halal dari segi bahan, proses dan cara mem- dilkanagamalain.Sesungguhnyapengaturan memberikan empat tingkatan bagi kon- kanan, minuman serta bahan olahan lain hun 1996 tentang Pelaksanaan Pencantum- hadap konsumen muslim. Kondisi ini dapat perolehnya, hingga pada akibat mengkon- labelhalalmerupakanjaminanhukumuntuk sumen dalam mengkonsumsi panganan, bergantung pada informasi produk itu. Maka an Label Halal pada Makanan. Sedangkan meruntuhkankepercayaankonsumensecara sumsinya. melindungi hak-hak warga negara. Bagi ma- yakni: (1) Wajib, untuk menghindari dari informasi yang menyesatkan konsumen pelaksanaan pencantuman Label Halal publik terhadap produsen itu, yang akhirnya Ternyata sejumlah pasar di Indonesia, syarakatyangtidakmembutuhkanlabelhalal, kebinasaan. (2) Sunnah, agar mampu melak- muslim tentang kehalalan produk akan menjadi kewenangan Departemen Kese- merugikan pihak produsen sendiri, karena baik restoran, rumah makan, tempat pemo- silahkan.Namunbagimasyarakatyangmem- sanakan ibadah secara paripurna. (3) Mubah, merusak keselamatan akidah, rohaniah dan hatan yang didasarkan atas hasil pemba- produknya tidak dikonsumsi lagi oleh kon- tongan hewan, maupun pasar tradisional butuhkan jangan pula dihalangi untuk men- sesuatu yang lebih dari sunnah sampai batas jasmaniah konsumen muslim itu. hasan bersama antara Departemen Kese- sumen. belum sepenuhnya memberikan jaminan dapatkan jaminan halal itu. kenyang.(4)Makruh,melebihibataskenyang Hal ini pulalah yang mengaharuskan hatan, Departemen agama dan Majelis Pengaturan label halal sesungguhnya halalterhadapprodukyangmerekapasarkan. dan menggangu aktifitas. (5) Haram, mem- minuman serta bahan olahan lain harus Ulama Indonesia. tidak dimaksudkan untuk mematikan atau- Permasalahannya adalah, tidak semua umat Merugikan bahayakankeselamatanbaikjasmani,rohani, memiliki label, baik label halal untuk dikon- Rancangan Undang-undang Jaminan pun melemahkan aktifitas produsen, tetapi muslim memiliki pengetahuan yang cukup Ketiadaan jaminan label halal terhadap dan akidah. sumsiumatIslammaupunlabelharamuntuk Produk Halal (RUU-JPH) yang sedang digo- justru sebaliknya. Sebab pengaturan lebel untuk mengetahui apakah pagangan dan produkpanganandanbarang,sesungguhnya dikonsumsiselainumatIslam.Karenasesung- dok DPR RI merupakan angin segar bagi halal diharapkan mampu mendorong iklim barang yang akan dikonsumsinya halal 100 sangat merugikan masyarakat muslim. Ke- Variasi guhnya antara halal dan haram harus jelas, masyarakat Islam di Indonesia, dengan dan persaingan usaha yang sehat, serta persen. resahanitutampaknyatapadasaatmenjelang Variasi produk panganan dan barang maka produk minuman serta bahan olahan harapan produk barang dan/atau jasa yang diharapkan dapat melahirkan perusahaan Bagisetiapmuslim,pengetahuantentang bulan Ramadhan dan Syawal. Momentum padasatusisimemberikanmanfaatbagikon- lain juga harus memiliki kepastian hukum beredar nantinya harus melewati pemerik- yangtangguhdalammenghadapipersaingan kehalalan produk makanan yang akan di- seperti ini kerap sekali dimanfaatkan oknum sumen, karena kebutuhan akan produk yang apakah produk itu halal atau haram untuk saan apakah produk tersebut halal atau sehat melalui penyediaan barang dan jasa konsumsinyamenjadisangatpenting,karena pedagang dengan menjual panganan dan diinginkan dapat terpenuhi, serta semakin dikonsumsi umat Islam. Bukankah hukum haram untuk dikonsumsi oleh masyarakat yang berkualitas. Label halal bukanlah hantu terkait dengan ketenangan hati dalam me- barang yang tidak jelas halal-haramnya, terbuka lebar kebebasan untuk memilih bertujuan untuk menciptakan keadilan, muslim. yang menakut-nakuti produsen ataupun laksanakan aktivitas penghambaan dirinya bahkan kadaluarsa. Padahal umat Muslim aneka jenis dan kualitas produk yang sesuai kemanfaatan, dan kepastian? Terlepas dari perdebatan yang sedikit virus yang mematikan produsen. Jadi, tidak kepada Allah. Islam mengajarkan kepada dalam mengkonsumsi makanan, minuman dengan keinginan dan kemampuan. Pada Selama ini pengaturan label halal hanya panjang tentang apakah sertifikasi halal di- perlu takut, karena yang dibutuhkan label umatnya untuk mengkonsumsi makanan serta produk-produk lainnya membutuhkan sisi lain, fenomena itu mengakibatkan ke- diatur dalam beberapa pasal diberbagai serahkan kepada pemerintah atau tetap halal bukan label haram. wallahu a’lam dan minuman yang halal dan baik, termasuk jaminan keselamatan, baik jaminan kesela- dudukan produsen dan konsumen tidak peraturan perundang-undangan saja, yakni: dipegang MUI, namun kita semua berharap, bissawab… barang-barang yang digunakan dalam matanJasmani,rohanimaupunkeselamatan seimbang, dimana daya tawar konsumen Pasal 34 ayat (1) Undang-undang Nomor 7 lembaga yang berwenang menerbitkan ser- kehidupan. Itulah pula sebabnya kehalalan aqidah. berada pada posisi yang lemah. Tahun 1996 tentang Pangan, Pasal 8 ayat (1) tifikasihalalnantinyamemilikiteknologiyang Penulis adalah Ketua DPW Partai Persatuan makanan dan barang-barang mendapatkan Secara umum ada tiga kategori makanan Secara etis, setiap perusahaan mempu- hurufhUndang-undangNomor8Tahun1999 cukup, serta memiliki tim auditor yang kua- Pembangunan (PPP) Sumut dan Ketua Majelis perhatian serius dalam Islam. Al Quran secara yang dikonsumsi manusia, yakni; nabati, nyai tanggung jawab sosial (corporate so- tentang Perlindungan Konsumen, dan Pasal lified dan kompeten. Alumni Fakultas Syariah IAIN Sumut. Baliho Rahudman & Pilkada Medan warga kota. Sebab, koordinasi yang hangat memperlihatkan bakatnya di dalam me- Dengan terbacanya minat Rahudman miliki kandidat lainnya. tersebut tentunya akan semakin memper- manfaatkansegalapeluang.Lagipula,kesem- Paling tidak, para figur lainnya harus Oleh Choking Susilo Sakeh mudah Pejabat Walikota melaksanakan patan kan tidak pernah datang dua kali. maju sebagai kandidat pada Pilkada Medan, semestinya harus dicermati oleh menyiapkan logistik dua kali lipat diban- semua programnya hingga ke masyarakat. Sah dan tidak salah. Yang salah adalah banyak figur yang sudah lebih dahulu me- ding pilkada tanpa incumbent. Kalau aspek Ada yang berbeda pada lebaran di nya untuk kesemarakan Kota Medan me- Andai para lurah dan kepling ikut me- jikalau minat Rahudman maju sebagai kan- masang niat untuk maju. Paling tidak, me- itu sudah tersedia, ya, monggo, para figur Medan kali ini! nyambut Idul Fitri 1430 H. masang baliho ucapan selamat bersama didat pada Pilkada Medan dilarang, karena reka harus mendesain ulang strategi komu- kainnya silakan maju terus pantang mun- D i puluhan tempat, minimal pada Bung, bisa dibayangkan kemeriahan PejabatWalikota Medan, maka kesan yang itu dianggap melanggar hak asasi Rahud- nikasi yang telah dilakukannya selama ini. dur. 21 lokasi, terdapat baliho relatif bagaimana yang akan muncul di Medan muncul tentunya akan lebih meluas lagi.. man sebagai warga negara. Strategi komunikasi yang telah disusun Nah, sampai beberapa saat ke depan besar berisi ucapan selamat Idul- andai 161 lurah yang ada juga ‘diperintah- Tapi, untuk tahap awal okelah, pada mo- Yang diharapkan Rahudman dari ba- oleh para peminat, tentunya menjadi ber- menjelang Pilkada Medan, ada beberapa fitri dari Pejabat Walikota Medan, Rahud- kan’ untuk ikut membuat baliho. Dan se- men berikutnya mungkin para lurah dan liho-baliho itu kemudian adalah : mudah- beda tatkala incumbent ikut muncul. Ber- momen yang bisa dimanfaatkan untuk man Harahap, bersama camat di masing- lanjutnya, kemeriahan pun akan semakin kepling bisa dipaksa ikut-ikutan. mudahan banyak warga yang mendukung bagai prakiraan yang sudah disusun, pun berbaliho ria. Momen Idul Adha disusul masing wilayah kecamatan. Mau tidak menjadi-jadi lagi, jika ratusan kepling juga Namun berhubung Pilkada Medan su- minatnya untuk muncul sebagai salah satu harus didesain ulang. Natal dan Tahun Baru 2010, menantang mau, baliho semacam ini menjadi barang diwajibkan membuat baliho serupa. Asyik… dah di pelupuk mata, maka membaca ba- kandidat pada Pilkada Medan yang akan Andai pertarungan pada Pilkada Me- para kandidat untuk menyiapkan baliho- baru di Medan. Sebab, selama ini baliho Sepintas, baliho-baliho ucapan selamat liho pak Pejabat dan pak Camat itu mau berlangsung awal tahun depan. dan semula diperkirakan akan berlangsung nya. Namun mesti diperhitungkan secara ucapan selamat hanya dibuat oleh Wali- Idul Fitri dari Pejabat Walikota Medan di- tak mau boleh dikaitkan dengan niat lain Dengan demikian, mestinya kita juga penuh warna-warni karena dilaksanakan tepat materi dan desain baliho —terutama kota, Wakil dan Sekda Medan. dampingi para camat tersebut, bisa me- yang ada di benak Rahudman. Benar bah- membaca baliho Rahudman dan para ca- tanpa kandidat incumbent, namun kini, dari aspek komunikasi— setelah kehadiran Sepintas, disadari atau tidak, keber- nimbulkan kesan bahwa dalam tempo se- wa salah satu tugas Rahudman Harahap mat tersebut dalam konteks Pilkada Me- warna pertarungan akan menjadi lain de- sang incumbent. adaan baliho ini telah menambah kesema- singkat-singkatnya Rahudman Harahap sebagai Pejabat Walikota Medan adalah dan. Apalagi jika kita amati kebijakan Ra- ngan kemunculan niat Rahudman untuk Untuk selanjutnya, bersiaplah untuk rakan Idul Fitri di kota berpenduduk sekitar sebagai Pejabat Walikota Medan telah mempersiapkan pelaksanaan Pilkada Me- hudman sebagai Pejabat Walikota Medan, ikut maju. Sebab, sebagai incumbent, tentu kalah… dua juta jiwa ini. Sampai pada tahap ini, mampu melakukan koordinasi yang ha- dan. Namun sah-sah saja jika kemudian hampir semuanya mengarah kepada kebi- Rahudman mempunyai peluang yang le- tentunya kita berterima kasih kepada Pe- ngat, bahkan juga ‘diterima’ oleh seluruh Rahudman Harahap memanfaatkan segala jakan yang populis. Rahudman belum se- bih besar dalam menjajakan dirinya -–an- Penulis adalah jurnalis, Direktur Eksekutif jabat Walikota Medan beserta ke 21 camat camat yang ada di Pemko Medan. peluang yang ada untuk ‘menjajakan’ diri- kalipun memperlihatkan kebijakan yang tara lain dengan memanfaatkan parangkat Konsultan Komunikasi Publik “Citra Media yang telah berkenan menambah anggaran- Ini tentu kabar menggembirakan bagi nya.Tokh, jejak rekam Rahudman memang struktural bagi perbaikan kota. yang ada— dibanding peluang yang di- Communication” Medan. Tingkatkan Iman Dan Takwa Pasca Idul Fitri yang kusut. Istilah dan kebiasaan halal tradisi di mana di akhir Ramadhan aktivitas kan, laki-laki maupun perempuan, merde- saja kita pernah berbuat salah. Dengan bihalal pada perayaan hari raya Idul Fitri ibadah menurun karena sibuk memikirkan ka maupun budak. demikian maka implementasi hadist Ra- Oleh Fauzil Husni, S.Si tampaknya lebih dikaitkan dengan suatu dan mempersiapkan hal-hal tersebut di Zakat fitrah setidaknya mempunyai sulullah yang menyatakan bahwa puasa opini yang bersandarkan pada definisi Idul atas, dan muncul suatu ungkapan yaitu dua sasaran pokok yaitu pertama untuk Ramadhan bisa menghapuskan dosa-dosa I dul Fitri yang tengah kita rayakan Kebiasaan ini mungkin berawal dari pema- Fitri yaitu kembali suci yaitu suci dari dosa- umat muslim di akhir Ramadhan bukan mensucikan diri dari segala perbuatan yang yang telah lalu lebih sempurna dengan merupakan salah satu dari hari-hari haman kita bahwa Idul Fitri merupakan dosa. Untuk itulah lahir tradisi maaf-ma- disibukkan dengan Lailatul Qadar tetapi sia-sia dan keji, dan kedua untuk menye- saling memaafkan karena dosa kita yang besar agama Islam. Dalam Islam, Idul ajang untuk bermaafmaafan. Sehingga dari afan. Mengapa harus ada halal-bihalal? disibukkan dengan lailatul bakar. nangkan orang-orang tidak mampu teruta- berkaitan dengan orang lain baru bisa Fitri dan Idul Adha merupakan dua hari sana muncullah kebiasaan mudik, dan juga Karena dosa kita yang berkaitan dengan Terlepas dari apakah arti Idul Fitri yang ma fakir dan miskin pada 1 Syawal. Oleh terampuni bila orang yang bersangkutan raya yang diagungkan dan menjadi ke- bertamu. Karena tradisi bertamu ditambah orang lain baru dihapuskan bila orang sesungguhnya, tidak ada yang salah se- sebab itulah diwajibkan kita membayar telah memaafkan, sehingga jadilah kita banggaan umat Islam. Secara umum, umat rasa senang setelah melewati ujian berat tersebut telah memaafkan. Padahal tidak benarnya dengan tradisi-tradisi lebaran zakat fitrah. Zakat fitrah lebih diutamakan orang-orang yang suci kayaumin wa- muslim di Indonesia biasanya lebih meme- maka dilampiaskan dengan memakai pa- ada perintah untuk saling bermaafan pada di atas. Cuma, apakah hanya sebatas itu untuk tidak dibayar dengan uang, walau- ladathu ummuhu. riahkan Idul Fitri, padahal di dalam Islam kaian yang baru, dalam hadist juga dika- Idul fitri, yang ada yaitu pada saat akan me- kita memaknai Idul Fitri? Padahal, ada pun ada ulama yang membolehkan, kare- Hal yang terakhir ini, mungkin sering Idul Adha itu lebih agung seperti terlihat takan bahwa Idul Fitri bukan dengan ber- masuki bulan Romadhan, dan juga arti dari beberapa hal pokok yang berkaitan dengan na dikhawatirkan uang tersebut digunakan kita abaikan, padahal inilah visi yang paling di daerah Aceh dan di sejumlah negara pakaian yang serba baru. Di sisi lain karena Idul Fitri yang sebenarnya adalah kembali Idul Fitri, yang lebih penting dilakukan untuk hal yang tidak baik oleh si penerima. penting dari perayaan hari raya Idul Fitri. Islam lainnya. tradisi bertamu pula, maka tak enak rasa- berbuka. untuk memeriahkan Idul Fitri agar menjadi Selain itu, bertakbir atau menguman- Selama ini, di Indonesia sudah menjadi Khusus di Indonesia, sepertinya bebe- nya jika tidak menyajikan panganan yang Efek dari semua ini adalah banyak har- lebih bermakna. Hal-hal tersebut antara dangkan takbir di malam Idul Fitri merupa- tradisi, apabila Ramadhan usai, maka ak- rapa hal yang paling menonjol dari keme- nikmat kepada tamu yang datang di hari ga dagangan yang naik sehingga tradisi lain menunaikan zakat fitrah yang tentu- kan suatu sunnah yang dilakukan berkaitan tivitas ibadah pun selesai. Sesuai dengan riahan Idul Fitri adalah tradisi mudik yang kemenangan itu. inilah yang menyebabkan orang-orang nya sduah kita bayar. Zakat fitrah adalah dengan perayaan Idul Fitri. Di dalam Al- arti Idul Fitri “kembali berbuka” dan Syawal dibalut dengan nuansa maaf maafan (halal Sebenarnya istilah halal bihalal sendiri kurang mampu merasa kesusahan, karena zakat badani yang harus dikeluarkan setiap qur‘an Allah berfirman “Wa litukmilul “peningkatan”, berarti pula kita kembali bihalal) serta tradisi memakai pakaian baru diambil dari bahasa Arab halla yahullu yang bingung memikirkan dana untuk itu se- individu muslim yang masuk dalam kate- i‘ddata wa litukabbirullaaha a‘laa maa membuka lembaran baru, maka seyo- dan sajian makanan yang beraneka ragam. artinya meluruskan (mengurai) benang mua. Dan yang lebih buruknya, muncul gori mampu sesuai dengan yang disyariat- hadaakum wa la‘allakum tasykuruun ” (Al- gianya dalam membuka lembaran baru baqaroh 185). Bertakbir pada malam Idul setiap individu haruslah berpikir dan be- Fitri mengandung makna rasa syukur ke- rencana untuk sebelas bulan yang akan sayang kelompok ini selalu menghindar dan mengabaikan tuntunan Sunnah nabi SAW pada Allah SWT atas nikmat dan rahmat- datang dengan melakukan peningkatan terutama pada kaifiat Ibadah – Ibadah Maqdha yang sudah diUndangkan oleh Rasulullah nya terlebih nikmat iman dan Islam yang hal-hal yang baik dan mengurangi hal-hal SAW melaui Hadist – Hadist beliau yang Shahiha dan Maqbula. diberikan Allah, sehingga kita mampu me- yang buruk yang selama ini telah diperbuat. Kalau saja ilmu Manthiq atau Logika selau pengendali akal manusia berfungsi nunaikan dan menjalani ujian yang begitu Maka benarlah suatu ungkapan yang me- maksimal maka ibaratkan jika kita berkonsultasi kepada Dokter Specialis Penyakit berat yaitu ibadah puasa Ramadhan. De- nyatakan bahwa “puasa kita pada bulan Dalam karena keluhan sesuatu penyakit. Kita mengharapkan kesembuhan atas Idzin ngan kalimat takbir Allaahu akbar, kita ini bukan sekadar untuk menghapuskan Mengharap Syafa’atnyaTapi Mengabaikan Sunnahnya Allah SWT tapi kita sendiri melanggar dan mengabaikan petunjuk Dokter Konsultan kita terutama dalam pengendalian diri tentang konsumsi makanan/minuman yang mengakui tiada daya upaya kami untuk menunaikan perintahMu kecuali karena dosa-dosa yang telah lalu, tetapi juga jadikanlah ia sebagai tabungan kita untuk Setiap kesempatan Pengajian natau Majelis Ta’lim atau ceremonial bernu7ansa Da’wah terkesan berlebih-lebihan alias tidak petunjuk Dokter, akhirnya semua menjadi sia- kebesaran dan limpahan rahmatMu. Selain sebelas bulan yang akan datang”. Sehingga selalu terucap kata-kata :”Ke4pada Allah kita bermohon kiranya SHALAWAT dan SALAM sia. itu takbiran juga berguna untuk mengu- jadilah kita orang-orang yang beruntung disampaikan kepada Rasulullah Muhammad SAW beserta keluarganya,sahabat dan yang Maka demikian halnya dengan syafa’at, untuk memperoleh tidaklah segampang mandangkan syiar Islam kepada seluruh seperti yang dikatakan Rasulullah yaitu I’tiba pada sunnahnya beliau sampai akhir hayat kita atau hingga akhir zaman kelak”. membalekkan telapak tangan. Syafa’at adalah hak istimewa yang diberikan Allah jagat raya. Tentu saja kita disunnahkan kita termasuk orang yang beruntung apa- Versi lain menyebutkan:”marilah kita menyampaikan Shalwat dan Salam KITA HADIAHKAN SWT kepada Rasulullah SAW pada waktu digelarnya Mahkamah Rabuul Jalil kelak untuk melaksanakan shalat Ied berjamaah. bila hari ini lebih dari pada hari kemarin, kepada Baginda kita Rasulullah Muhammad SAWse,oga dengan shalawat yang kita dan diperuntukkan bagi ummat Muhammad SAW yang memenuhi persyaratan dan Hukumnya adalah sunnat muakkad. dan sebaliknya jika tidak jadilah kita orang- sampaiakninsyaAllahkitamendapatkansyafa’atnyadihariakhirkelak“kemudianserentaklah seleksi Super Maximal Ketat. orang yang merugi atau pun yang dilaknat jama‘ah menyahutinya dengan lafadz Amiiiin. Oleh sebab itu jangan pernah bermimpi untuk memperoleh syafa’at dari Rasulullah Saling memaafkan Allah. Semoga kita termasuk orang-orang Kedua bentuk kalimat diatas serupa tapi tak sama lalu dimana bedanya ? Shalawat kalau saja SUNNAH – SUNNAH BELIAU (RASULULLAH MUHAMMAD SAW) terutama Memang anjuran saling memaafkan yang benar-benar menjadikan Ramadhan itu adalah do’a kita kepada Allah SWT untuk Rasulullah Muhammad SAW, para keluarga tentang Ibadah-Ibadah maqda yang justru kita ingkati secara terang-terangan padahal adalah pada saat akan memasuki bulan sebagai madrasah dan akhirnya menjadi beliau, sahabat beliau dan para Thabi’in beliau yang setia dan menjunjung tinngi, Risalahnya sudah dipermaklumkan,sementara golongan yang kita sebut-sebut minoritas Ramadhan, tetapi tidak ada salahnya kita orang-orang yang beruntung, di mana mempertahankan keutuhan Sunnah beliau (Rasulullah SAW) dengan tidak mebgenal yang yang berpegang teguh kepada Sunnah Rasulullah SAW menjadi musuh nyata kita juga memeriahkan Idul Fitri dengan saling iman dan takwa kita meningkat pasca Idul menyerah walau terkadang kelompok minoritas ini selalu mendapat diskriminasi dari hanya dikarenakan Taqlik Klasik. memaafkan bukan sekadar bermaaf-ma- Fitri ini. sekitar lingkungan dengan alasan Taqlik Klasik. afan, sehingga dengan sikap saling me- Sedangkan kelompok yang menghadiahkan Shalawat dan juga mengaharap syafa’at Mahlil Hamdani maafkan, tanpa seseorang itu meminta Penulis adalah alumni Pon-Pes Ar- dari Nabi Muhammad SAW dihari Akhirat kelak disebut kelompok Taqlik Mayoritas tapi Pemerhati sunnah maaf pun, kita sudah memaafkan, karena Raudhatul Hasanah dan mahasiswa kita tidak seluruhnya tahu kepada siapa pascasarjana USU.
  • 14 Selasa, 29 September 2009 WASPADA HARGA BELUM TERMASUK FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa SUZUKI Carry Real Van DRV Thn. 96. Merah mulus, Tape, VR, BR, Jok kulit, BK Asli Medan, mesin bagus. TOYOTA Kijang Super Thn. 92. BK Medan asli. W. Merah metalic. AC, Bursa Bursa Bursa TERCECER 1 BPKB Spd. Motor Honda Thn. 2005. BK 4279. Bursa AUTOMOTIVE Siap pakai. Terima pasang AC. Rp. 40,5 juta/nego. Tape, VR, Lengkap, siap pakai. Mulus. RENTAL MOBIL BUTUH UANG ELEKTRONIK PQ. Pemilik Kristina Br. Sembiring. AFD. VIII PERCETAKAN Informasi Pembaca 0812 6578 790 - 777 88 647 Hub. 0813 6114 8433 Kuala Sawit Kec. Batang Serangan Langkat. JUAL BELI PS 1, 2, 3 TV, Keyboard, Mixer, Power, Bursa Automotive SUZUKI Futura DRV 1.5 Thn. 2001. RENTAL MOBIL MURAH ANDA BUTUH DANA Laptop, LCD Projector, Handycam, Camera, Kulkas, AC : Air Condition PS : Power Stearing TOYOTA FORTUNER - G TH. ‘08. Rp. 250.000/Hari (Kijang Kapsul). Harian, Jaminan Apa Saja, Sertifikat Tanah. M. Cuci, Tape compo, LCD, dll Hub. MARKET HILANG/TERCECER Hijau met. AC/RT/VR. Mulus, Siap L. BR CL : Ban Radial : Central Lock PW RT : Power Window : Radio Tape Kota. Nego. Rp. 55 Jt. Serius Warna hitam, komplet, Ban Ra- Bulanan, Jemput Tamu, dll. HP. (061) 664 77734 Proses Cepat, Syarat Mudah. Hub. ELECTRONIC Telp. 821.0097 - 6690.0693 Jl. Setia Budi No. 424 B dekat Simp. Ring Road 1 Buah BPKB Mobil. BK 12 FP dial, manual. Rp. 325Jt. Solar Jl. / 0813 9779 1077 (TP). (Khusus Muslim) 061-8222774, HP 0816 314 1807 . ND DB : Nippon Denso : Double Blower VR EW : Velg Racing : Electric Window Hub. (061) 77799419 / 76820955 a/n. Moch. Ichsan. Alamat SM. Raja No. 200. Dpn. Sklh Eria ANDA BUTUH DANA TUNAI Komp. Tasbi Blok HH No. 22. Kel. CHEVROLET Long Bed Pick Up Thn. 88 Asli Medan. Body seksi, mesin bagus. Harga 26 Jt. Damai. Hub. 061-77584982 SUZUKI Katana Thn. 92. Hijau metalik, BK Bln 6.10. VR, BR, AC, RT, Telp. 7863182 HP. 0812 6300 0077 Hg. 37,5Jt. Kembar Ponsel - 0812 6038 5555 KEMBAR MOBIL Jl. Tritura No. 8K - HP. 0812 6058 6666 APV ‘06 RENTAL Harian/Bulan, Terima Antar Jemput Anak Sekolah, Harapan I, SMU I dan sekitarnya. Jaminan BPKB Sepeda Motor / Mobil. Bunga Ringan, Data Bisa dijemput. BPKB Aman. Hubungi: (061) 66477734 / 0813 9779 1077 AC BARU “HARGA” SPECIAL SEWA - PANASONIC INTERTER - MITSUBISHI ELECTRONIC - SAMSUNG - LG - AUX - DAST Tj. Rejo Mdn. No. BPKB 8669516-B TERCECER/ HILANG SUZUKI Carry DRV Th. 2003 W. Hitam. Colt - Diesel Pump Truck, Mobil sehat2, Karyawati, supir Ibu2. Hub. 0813 70430 346 Bursa 5 PK & 3 PK FLOOR STANDING - GENERAL - CHANGHONG - SHARP PLASMA CLUSTER - FUJI - DAIKIN Surat Tanah Atas Nama CHEROKEE 4X4 M/T ‘95 BK Mdn, AC, RT, Lengkap. BK Mdn Asli Cat dan mesin KOMPUTER siap pakai. VR, BR 31”, PS, PW, CL, AL, EM, Biru Met, mulus. Siap pakai. Harga 58Jt Nego. Hub. 0811 652506 Jenis Mobil Th. Hrg IKHLAS RENT CAR HUB: TOKO SUPER ELECTRONIC Abdul Rahman Siregar, DP 20 Jt, Angs: 2,2 Jt Hub. 7670.0976 SUZUKI Katana Thn. 87 dijual. 1. Colt Diesel Dam PS.125 ‘07 215Jt Dalam Kota: Innova G 300rb, Avanza G: 270rb Luar Kota: Innova G 350rb, Avanza G : 330rb Termasuk OBRAL LAPTOP SPEKTAKULER Jln. Sutomo No. 139 C (Simp Gandhi) Tel. 7347810 - 7360741 terletak di Jl. Bukit Kencur, DAIHATSU Espass 1.6 ‘96, P. Sorong, Warna merah, AC, Tape, BK 2. Colt Diesel PS 120 ‘06 175Jt supir Non BBM. Hub. 0852 61182 406 - 91312308 TERMURAH LEBARAN Tel. 77982281 MEDAN INSTALASI & PEMASANGAN Lingkungan 02 Kec. Mrh Maron Met, AC, RT, VS, BR, Jok Klt, Medan asli, mulus. Serius TP. Hub. 3. Colt Diesel PS 120 ‘99 135Jt SERVICE, REPARASI AC - KULKAS Gebyar Habiskan Stok Gudang. Toshiba, Rp. Hrg. Mulai Rambutan T. Tinggi DP 15 Jt, Angs. 1 Jt 0813 7000 7127 / 061-6949 0067 4. Colt Diesel Truck PS 100 ‘00 110Jt ALAT PELACAK KENDARAAN Acer, Fujitsu, HP Merk Terkenal & Kwalitas Service 2 Hub. 0813.7588.7306/ (061) 76700.976 SUZUKI KATANA GX 93/94 5. Toyota Dyna 125 HT ‘03 120Jt With GPS Tracking System no. 1. Didesain dgn Tampilan yg Elegans, Bursa Luas ±25x25m KONSTRUKSI DAIHATSU Rocky Th. ‘94 BK Medan. Warna hitam, AC, TP, VR, BR, CL. BK Asli Medan, Fasilitas Lengkap. Internet Wifi, Bluetooth, KOMUNIKASI mulus, orisinal, siap pakai. Harga Rp. 41Jt/ Bursa Dengan iTrack anda setiap saat dapat mengetahui kamera. Bisa dipakai utk segala keperluan. W. Hitam. Cat dan mesin mulus. Siap * Keberadaan Mobil anda * Laju Kecepatan Mobil Bursa Jt-an WC Nego. Hub. 6625188 / 0813 6214 8312 pakai. Harga Nego. Hub. (061) 6626 705 - HP. 0852 7080042 SUZUKI AMENITY TH. 90 SEPEDA MOTOR * Rute Perjalanan * Berbagai Aktifitas Lainnya Terjamin & Digaransi.Miliki segera...... Mencoba sampai puas oke-oke saja. -Medan Mall Lt. Dsr - 0812 6455 7274 MAU JUALAN PULSA...????? ALAT MUSIK ANDA TUMPAT - SEDOT HONDA 100% BARU DAIHATSU Espass 1.6 Thn. 2003. W. Biru met. AC DB, VR, RT, BR, cantik, mulus. Warna hitam. Velg Racing. AC, Tape. BK Mdn asli. Mobil masih orisinil. Rp. Semua Type, Cash/Credit. Tersedia Hub. Kami: ITrack Medan -Millenium Lt. Dsr -Medan Plaza Lt. Dsr -Aksara Lt. Dsr - - - 081396930390 0812 6085 2666 0813 9742 2213 DENGAN MOMENTUM REFILL AJA!!!!! TECHNICS KN - 7000 Hub. 8219951 Jl. Setia Budi No. 2 H. 51,5Jt/Nego. Hub. 0815 314 7717. 30Jt. Hub. 0812 64 150 194 Komp. Asia Mega Mas Blok LL No. 32 Dijual Cepat. Harga Damai. Jl. Mustafa G. Mawar No. 6 A. SUZUKI CARRY MINIBUS TH. 84. Program murah, Proses Cepat. Telp. 0813 6075 0388 - 7321 726 - 77872232 -Paladium Lt. Dsr -Binjai Super Mall - - 0813 7666 9353 0813 6125 4113 061.76216.595 - 0813.76704.595 Hub. 66900693 - 0813 6240 4002 WC Warna merah. Velg Racing. Tape. Hub. Aron. 08388 591614 Kunjungi Situs kami: iTrack.iqios.com Buruan......Ribuan org sdh memiliki, Anda???? MomentuM TUMPAT/ SAL. AIR DAIHATSU Taruna CSX Thn. 2000 Asli Medan, Mulus, siap pakai. Mobil sgt mulus sekali. Rp. 14Jt. Refill efill Bursa Hub. 8477835 Lengkap. Harga 86 Jt damai. Hub. 0812 650 8819 Hub. (061) 766 74 598 HONDA KHARISMA Thn. 2004. WASPADA xpress Bonus Hingga JUTAAN Rupiah !!!! PERCETAKAN (061) 77077334 SUZUKI APV Type-X Th. ‘07. Silver, Mulus, hitam, siap pakai. Harga PASTI UNTUNGGG !!!!!! www.momentumrefill.com Jl. Gaperta Gg. Partiasa No. 8 Bergaransi 3 Bulan DAIHATSU BARU DP RINGAN komplit. Mulus sekali. Blk DP. 35Jt. Sdh. 6,4Jt/Nego. HP. ( 0 6 1 ) WC Xenia VVT-i...DP 15 Jt-an, Angs. 3 Jt-an TUMPAT/ SAL. AIR Terios TX...DP 20 Jt-an, Angs. 4 Jt-an Bayar 9x. Jl. SM. Raja No. 200 Kembar 66477734 / 0813 9779 1077 Service Serius Hub. AGUSTINA Ponsel. Dpn Sklh. Eria - 0815 3373 3688 HONDA TIGER 2008 Dijual BU Jarang 845.8996 ELEKTRONIK (0852 7003 9888 / 7630 4788) pakai, sangat mulus, hitam, Velak Resing. 0812.631.6631 TOYOTA Innova- G Th. ‘08. Silver, M Belakang Cakram. P. Panjang. 18Jt/ AHLI TO S H I BA , S O N Y, P O LY T RO N, S A M S U N G , S H A R P, S A N YO , Bergaransi/ Setia Luhur 160 F Nego. Hub. 0813 9725 1113 DAIHATSU Taft GT 4x4 Th. ‘85. Bensin. Komplit, mobil mulus seperti TV SANKEN, FUJI, DIGITEC, LG, JVC, W. Hitam. BK Panjang. VR, AC Dingin, TV CHINA, DLL. Murah, Full Garansi Tumpat Sedot Tape, mesin gerdang sehat. Hrg. 39Jt/ baru Rp. 192Jt. Jl. SM. Raja No. 200. DIJUAL OVER KREDIT SIGIT. 76547004 - 0812 6067 7344 Jl. Brayan Medan WC 0812 642 71725 Yamaha Vixion ‘07 merah maroon, Nego. Hub. 061-77679495 Kembar Ponsel - 0811 613107 mulus. Sisa angsuran 12x727rb, Pajak bln 9 Kembali DP. 10 Jt Nego. Terima TERCECER / HILANG 8442246 Telp.: FORD PICK UP 4X4 TOYOTA Kijang Capsul New LSX (diesel) Tukar tambah shogun RR/SP. Ranger Single Cabin, Thn 2006, Masih orisinil, Terawat dari baru, Hrg Thn. 2002. BK Asli Mdn. Wrn. Hijau tua met. PS, CL, AC, Tape, BR, VR, jok kulit. Hub. 0819 858 589 TERCECER 1 BPKB No. 8985729-B, BK 701 EC. Pemilik ADI Ada Garansi Electric Mirror. Body & mesin sgt mulus Bursa . PAK WC 0813 7035PIAN Rp. 108 Jt Hub. 0812.657.1372 Drs. Risno Johannes. Jl. SM. Raja Gg. (unit banyak, ada wrn silver & putih) skl (sehet, terawat, original). Hub. 0812 6013 966 (Asun). Hrg. Rp. 117Jt/Nego. Purnama No. 11 Medan. Hub SERVICE/ASESORIS MOBIL HONDA CITY NEW-IDSi 04/05 TIPTRONIC, BK Mdn, Htm Met, Jok Klt, Full body kit, VR 17”, BR, AC, PW, EM, ABS, Air Bag, DP 37,5 Jt, Angs. 3,9 Jt Hub. 76700.976 TOYOTA Kijang Jantan Thn. 96 . Tipe lengkap. AC, Tape, VR, PW, PS, Dash- board sedan mulus. Siap pakai. 55Jt/ Nego. Hub. 0816 310 4197 / 7790 5359 SHAMPOO MOBIL / KERETA. Untuk Door Smeer Rp. 5.000/ Liter. Tel. (061) 76688574 TERCECER 1 BPKB No. 9134029 - B BK 1591 EZ. Pemilik PT. Mitra Kerinci, Jl. RA. Kartini No. 23 Medan. TUMPAT 7291 WC TUMPAT, Sal. AIR, K. Mandi TUMPA MITSUBISHI BARU TOYOTA Kijang Commando Short 6 Speed TERCECER BPKB Mobil Toyota Kijang BK 1571 H a/n. Tel. 7878078, 77008458 Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... Thn. 87. Mulus, luar dalam. Mesin sehat, VR, BR, RTP, AC. Hrg. 38Jt Nego. Hub. 0812 6477 Harian Pemda Tk. I Sumatera Utara. Jl. P. Diponegoro NARO SERVICE Jl. Sisingamangaraja No. 30 Medan. No. BPKB A5752333-B. Bagi Serius Hub. (061) 76728071 / 0812 653 3319 7088. Lampu, Bumfer, Grand Extra. WASPADA yang menemukan hub. (061) 77084760 SUZUKI Carry Pick Up 1.3 Dijual. Thn. 1997. Plat BK Asli Medan. Warna biru. TOYOTA Kijang Krista DSL ‘02/01, Face Lift, Silver Met, AC DB, VR 16”, Tempat Iklan Anda TERCECER 1 (Satu) bh Asli BPKB BK 4144 KS FD STNK, buku kit panjang. Tinggal pakai. jok klt, Mls, DP 36 Jt, Angs. 3,63 Jt a/n. Hendra Limbong. Jl. Sekip Peminat Hub. 061-773870 - 061-77387024 Hub. (061) 76700.976 Hub.4576602 No. 87-A Medan. CD KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK DIGITAL Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop) MINI & EFEKTIF IKLANKAN PRODUK ANDA Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta: Harian WASPADA Untuk informasi lebih lengkap hub TEL. (061) 4576602 FAX. (061) 4561347
  • Ekonomi & Bisnis 15 WASPADA Selasa 29 September 2009 Bank Indonesia Jamin Tak Nasabah Minta SBY Turun Tangan Atasi Kasus Bakrie Life Sembunyikan Data Century JAKARTA ( Waspada): Nasabah PT Asuransi Jiwa Bakrie (Bakrie Life) telah Life yang telah memberikan jaminan produk menyimpang dari prospektus. ngatakan, produk Bakrie Life dengan nama Diamond Inves- ta tidak sesuai dengan apa Pasar Saham hingga 80 persen. Hal itu sama sekali menyalahi prospektus awal. JAKARTA (Antara): Bank “Ini masih interim belum hun sebelumnya, permintaan “Kalau gak ada UU ten- melayangkan surat kepada “Kita, para nasabah me- yang tertera didalam prospek- “Itu kan, menyalahi pros- Indonesia (BI) menjamin final atau masih sebagian, uang pecahan kecil pada le- tang JPSK, bisa-bisa kita sa- Presiden Susilo Bambang minta agar Presiden memerin- tus perusahaan. pektus yang kita ketahui dima- pihaknya tidak menyem- mungkin data interim itu be- baran tahun 2009 ini lebih ling tunggu. Jadi harapannya Yudhoyono agar ikut serta tahkan Menteri Keuangan “Sesuai dengan pros- na dalam prospektus, dikata- bunyikan data-data terkait rubah pada waktu dia melaku- besar. bisa selesai,” kata Darmin. membantu masalah gagal untuk memeriksa Bakrie Life. pektus, keunggulan produk kan diamond investa diinves- Bank Century dalam proses kan pemeriksaan lebih lanjut,” “Tahun lalu permintaan Dia menyebutkan seba- bayar dana mereka senilai Dimana Ketua Bapepam seha- Diamond Investa menitikbe- tasikan secara hati2 dan audit investigasi oleh Badan katanya. uang kecil gak banyak seperti gian besar materi dalam Rp 360 miliar. rusnya menunjuk kepala biro ratkan pada pengelolaan dan aman,” katanya. Pemeriksa Keuangan (BPK). Budi menyebutkan, BPK sekarang. Permintaan uang RUU itu tampaknya sudah Dalam surat dilayang- pemeriksaan dan penyelidi- pengembangan investasi yang Para nasabah itu berharap “Dari BI, tidak ada data memang intensif melakukan kecil melebihi prediksi,” ka- disepakati, dan tinggal 1 kan pada tanggal 14 Sep- kan melakukan pemeriksaan optimal melalui instrumen bisa mendapatkan perlindu- yang disembunyikan, kecuali pemeriksaan dalam kasus tanya. atau 2 yang masih harus tember 2009 tersebut dije- menyeluruh terhadap Bakrie investasi obligasi sebesar 90 ngan, termasuk dari Bapepam. data rahasia kita tidak bisa Bank Century. Pada Sabtu (26/ dibahas. laskan, para nasabah meng- Life,” ujar perwakilan nasabah persen, saham 5 persen dan Dalam surat tersebut, Nasabah jawab, kalau mau diperiksa 9) juga masih ada pertemuan RUU JPSK Menurut Darmin, UU hen dak i Presiden SBY yang ditemui wartawan di Ka- deposito sebesar 5 persen,” juga menuntut agar Bapepam oleh BPK ya silahkan,” kata para pengawas bank sehingga Sementara itu mengenai tentang JPSK akan meru- memberikan penugasan wasan Permata Hijau, Jakarta, katanya. mendesak Bakrie Life untuk Deputi Gubernur BI, Budi Ro- tidak ada keraguan. RUU tentang Jaring Pengaman pakan protokol untuk kepada Menteri Keuangan Senin (28/09). Namun nyatanya, belaka- menyediakan dana segar hadi di Jakarta, Senin (28/9). “Kami pihak yang diperik- Sistem Keuangan ( JPSK), menghadapi krisis atau me- agar memeriksa dan meng- Nasabah yang menolak ngan diketahui Bakrie Life untuk pembayaran mereka. Pemeriksaan oleh BPK da- sa, mereka minta apa, kami Deputi Gubernur Senior BI, ngantisipasi kalau ada krisis ungkap manajemen Bakrie disebut namanya itu juga me- menginvestasikan dananya di lam kasus Bank Century hing- harus kasih,” katanya. Darmin Nasution mengata- sehingga negara yang mem- ga saat ini belum final namun Sementara itu mengenai kan, pihaknya tetap berharap punyai protokoler seperti itu BPK akan menyampaikan laporan sementara kepada DPR. kondisi alat pembayaran saat lebaran, Budi mengatakan, berbeda dengan lebaran ta- RUU itu dapat disetujui pe- ngesahannya menjadi UU oleh DPR masa bakti saat ini. mestinya lebih siap meng- hadapi kondisi kalau ada goncangan. Subsidi Pupuk Susut, HPP Beras Rupiah Terpuruk Di Atas 9.700 Wajib Naik JAKARTA ( Waspada): akan semakin tertekan terle- itu belum dimakan inflasi,” Susutnya anggaran subsidi bih ancaman El Nino pada katanya. oleh upaya peningkatan infra- JAKARTA (Antara): Kurs Merosotnya rupiah itu ter- Apabila investor kembali yang positif terhadap ru- pupuk pada tahun 2010 tahun depan. Pada tahun ini, HPP Gabah struktur pertanian di pedesaan rupiah terhadap dolar AS di utama disebabkan kenaikan ke pasar Indonesia, maka piah. Kondisi ini juga didu- menjadi hanya Rp 11,3 Demikian disampaikan Kering Panen (GKP) mencapai seperti jalan, irigasi dan lain- pasar spot antarbank Jakarta, mata uang Indonesia cukup peluang rupiah untuk kembali kung oleh membaiknya bur- triliun dari tahun ini berkisar oleh anggota Dewan Penga- Rp2.400 per kg, Gabah Kering lain. Senin (28/9) merosot tajam tajam menjelang lebaran Idul menguat akan terjadi, katanya. sa Wall Street setelah tiga Rp17 triliun,harus diim- was (Dewas) Perum Bulog Giling (GKG) Rp3.000 per kg “Makanya HPP harus di- hingga melewati angka Fitri akibat tinggi kebutuhan Bahkan, lanjut dia rupiah hari merosot akibat data in- bangi dengan kenaikan Har- Kaman Nainggolan dalam dan beras Rp4.600 per kg. sesuaikan secara proporsional Rp9.700 per dolar, karena pela- masyarakat terhadap rupiah, akan dapat mendekati angka dikator ekonomi AS seperti ga Pembelian Pemerintah acara halal bihalal di kantor Diharapkan dengan adanya dengan kenaikan harga pu- ku pasar melepas rupiah aki- ucapnya. Rp9.300 per dolar, apalagi sisa indeks kepercayaan kon- (HPP) untuk beras/gabah Bulog, Senin (28/9). kenaikan minimal 10 persen puk,” serunya. bat memburuknya bursa re- Menurut dia, koreksi ter- waktu yang hanya tinggal tiga sumen cenderung mele- petani minimal 10 persen. “HPP itu sudah seharus- ditambah tingkat inflasi, maka Dengan demikian margin gional. hadap rupiah saat ini dinilai bulan ini memberikan arti mah, ucapnya. Jika tidak maka para petani nya naik 10 persen minimal, tekanan terhadap petani ta- petani tidak melorot tajam Nilai tukar rupiah terha- wajar setelah mengalami ke- hun depan akibat naiknya atau paling tidak, bisa stabil dap dolar AS menjadi Rp9.720- naikan cukup tajam hingga ongkos produksi harga pupuk dari margin 30 persen yang Rp9.730 per dolar dibanding penutupan hari sebelumnya mencapai angka Rp9.580 per dolar. Inflasi Hingga September Capai 3 Persen naik akibat susutnya subsidi pupuk dapat dikurangi. diharapkan, karena umumnya para petani di Indonesia me- Rp9.650-Rp9.665 atau turun “Kami memperkirakan JAKARTA (Waspada): Bank Indonesia (BI) memper- kenaikan potensi inflasi dan diprediksikan bisa mencapai “Kita harapkan dengan miliki lahan yang sedikit, mar- 70 poin. koreksi ini tidak akan berlanjut kirakan inflasi pada bulan September 2009 akan mencapai 4 persen. Hartadi juga mengatakan, permintaan uang kartal demikian petani bisa menca- gin 30 persen cukup mengim- Pengamat pasar uang hingga mencapai angka 3 persen secara year on year (yoy). yang menurun pada saat hari raya kemarin juga diperkira- pai tingkat keuntungan usaha bangi pendapatan riil petani. Harry Kurniawan di Jakarta, Rp10.000 per dolar,” ujarnya. Hal itu dikatakan Deputi Gubernur Bank Indonesia kan akan menyumbang kenaikan inflasi. petani yang wajar kita ambil Biasanya HPP beras/ga- Senin (28/9) mengatakan, pa- Dia mengatakan pasar (BI) Hartadi A Sarwono ketika ditemui di Gedung Bank “Itu termasuk (permintaan uang kartal), karena dengan dari 30 persen (margin) per bah baru akan dikeluarkan oleh sar uang didominasi aksi lepas Indonesia dinilai masih positif Indonesia, Jakarta, Senin (28/09). adanya resesi sebagian pendapatan orang berkurang,” hektarnya,” ucapnya. pemerintah setiap awal tahun rupiah oleh pelaku pasar se- dibanding pasar Asia lainnya “Kalau kita bisa menjaga pasokan dan distribusi barang jelasnya. Dia menegaskan subsidi dengan mempertim-bangkan hingga mata uang Indonesia akan kembali diserbu pelaku domestik yang baik maka inflasi (yoy) pada bulan Sep- Selain itu, Hartadi mengungkapkan, pertumbuhan pupuk harus tetap ada, jika inflasi, bahkan lebih jauh lagi tertekan, akibat memburuk- asing, karena prospek pasar- tember 2009 bisa mencapai 3 persen,” ujarnya. ekonomi Indonesia sampai akhir tahun akan berada di pun ada pengurangan maka harus dipertimbangkan ke- nya bursa Wall Street. nya masih tinggi. Ia menambahkan, sampai akhir tahun 2009 masih ada posisi 4 persen.(dtc) hal itu harus dikompensasi naikan harga pupuk. (dtc) Bursa Bursa RUMAH DIJUAL Bursa LOWONGAN KERJA Jl. Air Bersih Gg. Melati No. 4, LT. 25x12,5m, MATERI BANGUNAN PROPERTY Hrg 250 Jt, Sertifikat Hub. 0812.6442.4373 DICARI JASA PEKERJA KONTRUKSI Bidan, Perawat dan PRT Informasi Pembaca RUMAH DIJUAL Menerima segala jenis bangunan Design Johor Indah Permai Blok A No. 3, Gambar bangun baru renovasi, Gedung Hub. 0813.7164.1555 - (061) 7657.8941 Bursa Property 3 KT, 2 KM, LT. 319m, Sudut, Sarana perumahan Taman Keramik, Interior GR : Garasi LB : Luas Bangunan lengkap Telp. 786.4023 Klening Servis dll, dengan Tenaga Kerja KM : Kamar Mandi LT : Luas Tanah yg handal DICARI TUKANG PANGKAS KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu OVER KREDIT Rumah T. 36, LT. 8x12, P. Cendana Asri Namorambe Desa Jaba Hub kami Jl. Air Bersih Teladan No. 8 Telp. (061) 7872.628 - 7872.789 Berpengalaman, Jaminan 40.000 SHM: Sertifikat Hak Milik Namombelin sdh berjalan 6 thn, Sisa kredit 9 thn, Angs. 240 Rb/ bln, Hrg 12 Jt HP. 0812.6363.416 - 0813.7007.7621 Alamat: Jl. Karya Jaya No. 298 RUMAH DIJUAL Perum. Tj. Permai 14 Blok N/ Hub. 0852.9788.2803 - 0852.6217.1165 ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150 DIJUAL CEPAT Hub. 0852.6144.3233 No. 1 Tj. Gusta Medan, LT. 200m, 1 Ruko 3 Tkt di Marelan Raya T. 600, SHM, LB. 170m2/sudut, SHM, KT 5, KM 2 LT. 4x28, LB. 4x16m, Lkp, PLn, PAM, Telp, Siap Hub. 0813.6177.4931 huni, Hrg Rp. 650 Jt/nego LOWONGAN MEK & TK. LAS 2 unit Rmh Permanen (Gandeng) di Jl. AMD Ling. 36 Titipapan, SHGB, Masing2, LT. 6x22m, Beberapa org mekanik alat2 DIJUAL CEPAT LB. 6x12m, Siap huni, Hrg @Rp. 160 Jt/nego berat (Doser, Beko, Greder, Ruko 2½ Tkt Uk. 7x21m, Ada Hub. 0813.7164.1555 R usaha, Grosir, 4 KT, 4 KM, Full (061) 7657.8941 (Maaf TP) PAGAR EURO Loder), Mekanik mobil Diesel, keramik,Telp, Air Bersih di Binjai GALVANIS Tk. Las alat berat, Tk. Cat alat berat, Pengalaman diatas 5 thn Peminat hubungi:- 0831.9897.3540 - 0813.6179.1839 - (061) 69680806 TANAH Lamaran lengkap diantar ke: DIBAYAR TINGGI GURU PRIVATE UMUM TG. BALAI - ASAHAN TANAH DIJUAL Jl. Medan - Tg. Morawa Km. 10 Gg. Dame No. 30 Telp. (061) 7867.451 DICARI NAZIR MESJID Mafia, B. Inggris utk TK, SD, SMP, SMA SMS data 0852.6210.3287 DIJUAL RUMAH LT. 1679m2, Jl. Jend. SUdirman Km. 4, Luas 1240m, SK. Akte Notaris, Lokasi pinggir jalan Klambir V Kampung. Tanaman Duku, Rambutan R Lokasi strategis Harga Rp. 1,5 M/ nego DIBUTUHKAN Syarat-syarat: DICARI TK. PANGKAS MUSLIM Peminat serius hub. Tato 0819.840.733 (berbuah), Durian, Kelapa Harga 75 Rb/meter nego EUROMESH BAJA U-50 KOLOM PRAKTIS Bklrga Hub. J. Brasa Pangkas Mantap EURO R Tenaga kerja/ karyawan bergerak 0813.9649.3777 Hub. 0812.6489.8982, TP di bidang perbengkelan bersedia ditempatkan di Psr. Merah, Pdk. - Usia min. 40 thn & sudah Millenium dpn Mesjid Assyakirin Jl. Besar Delitua No. 38 HP. 0812.6417.2978 BAJA U-50 - Bursa DIJUAL CEPAT DICARI BAGI HASIL TANAH SIAP PAKAI - Kelapa, Setia Budi, posisi sebagai: (Jaminan berdamai) PERABOT 1. Tk. Bubut berkeluarga 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka > 2 Ha dekat Kota, Strategis LEBIH PRAKTIS & HEMAT - DARI BESI BETON 2. Kpl. Mekanik LOWONGAN KERJA 9 Gedung Johor. Ukuran tanah 15 PRODUKSI: TEMPAHAN MURAH 3. Pem. Mekanik 4. Tk. Cat - Berpaham pada Al-Qur’an & Dibutuhkan Lulusan SMK jurusan Akuntansi, x 24 M2. Ukuran rumah 12 x 16 M2. Utk buat Ruko/ Perumahan PT. REZEKI PRIMA JAYA ABADI -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Lamaran diantar ke: persyaratan: Kamar 4 buah, Garasi 1 buah, SHM, Jl. Sutomo No. 436 Medan 20231 Hub Telp. (061) 6618116 - 6616802 Hub. 0853.6120.5673 BENGKEL STAR SERVIS Jl. Setia Budi Psr. V No. 435/ 88-S As-Sunnah/ Muhammadiyah 1. Wanita IMB. Hub.0819 2112101 (samping Bank Maspion) SPRING BED DIJUAL MURAH 2. Usia max. 23 tahun Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 LOWONGAN KERJA - Bisa menjadi Imam & Khatib 3. Paham dan mampu dalam bidang RUMAH TOKO (RUKO) DIJUAL DUA PINTU TANAH DAN SAWAH DIJUAL Fax. (061) 415.7504 SUMUT - INDONESIA Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Harga: 240 Juta (nego) Spring Bed 5 kaki 2 lapis Rp. 1.075.000 KE MALAYSIA Akuntansi/ Pembukuan ± 2890 mtr, SHM di Desa Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Alamat: Jl. KL. Yos Sudarso Km. 6,5 Tanjung Diperlukan segera Tenaga Kerja Indonesia untuk ditempatkan secara resmi di - Bersih & mampu merawat mesjid 4. Dapat mengoperasikan Komputer dengan baik Mulia depan Pabrik Garuda Mas Luas Tanah: 8x12m Bintang Meriah Kec. Bt. Kuis, Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong Rp. 900.000 Rp. 1.000.000 perusahaan electronics sbb: Harga Rp. 277 Juta/nego 1. Shin Etsu (M) Sdn. Bhd (100 org) - Company/ Langsung 5. Mampu berkomunikasi dengan baik Luas Bangunan: 8x11m Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 Lokasi: Shah/ Alam - Selangor 2. Sumitomo Metal (SMI) Electronics Devices (M) Sdn. Bhd Diutamakan dari luar kota Lamaran diantar langsung ke: HP. 0812.600.6002 - 0813.9784.0330 Hub. 0812.6040.1953 (50 org) Jl. Nibung Baru No. 61-63 Petisah Medan Lokasi: Bayan Lepas - Pulau Pinang 3. TIM Electronics Sdn. Bhd (30 org) - Company/ Langsung Hub. 0813.9673.8171 Paling lama 3 hari setelah iklanini terbit RUKO RP 350 JUTA . JUAL TANAH CEPAT/ B.U Bursa Lokasi: Bayan Lepas - Pulau Pinang Dan Rumah Type 45 di Griya 1. Jl. Sei Tuan No. 49 M. Baru, Uk. 13x40m, PENGOBATAN 4. Sony EMCS (M) Sdn. Bhd (100 org) - Company/ Langsung Lokasi: Seberang Prai - Pulau Pinang Ladang Bambu Jl. Jamin SHM, Listrik, Air Tembok keliling, Sudah 5. Finisar (M) Sdn. Bhd (50 org) DIBUTUHKAN DIBUTUHKAN SEGERA Ginting Km. 14 Medan timbun, IMB, Siap bangun BUTUH ALAT BANTU DENGAR? ALAT BANTU Lokasi: Ipoh, Perak Beberapa orang tenaga kerja Hub. 821.3007/ 0812.6356.735 2. Jl. Bunga Sedap Malam IX/ depan Hub. MELTRA HEARING AID MELTRA Gaji & Fasilitas: 1. Gaji pokok TEKNISI/ SERVICEMAN berpengalaman dibidang 0812.6000.6519 Badan Sar, Ring Road NG. Surbakti, Jl. Kediri No. 36 Medan Tel. 4516161 2. Tunjangan: Kehadiran, shift, makan, pekerja asing, perhidmatan Panasonic Sentra Service, perawatan & kecantikan kulit L. 1.147m2, Bentuk Trapesium Bursa 3. Perlindungan asuransi Indonesia & Malaysia membutuhkan: Strategis Pembeli serius hub. BUSANA / AKSESORIS 4. Jaminan perlindungan kesehatan Syarat: 5. Asrama & perlengkapannya - Tamatan SMK Electro/ Sederajat 1.Wanita maximal 25 tahun 0812.6005.561 - (061) 762.15551, TP PECI MURNI 6. Transportasi ke tempat kerja (PP) 7. Pakaian kerja (uniform) - Usia max. 21 thn, 31 bulan 8. Cuti tahunan, cuti umum dan cuti sakit 2.Berpengalaman minimal October 2009 9. Levi subsidi 100% 1 tahun 10. Kesempatan Kerja lembur (OT) - Belum menikah 11. Berangkat naik pesawat - Pria 3.Mahir, pedicure/ medicure TEMPAHAN ISTIMEWA 12. Dan lain-lain kemudahan Persyaratan pendaftaran: - Bersedia di training 4.Ramah, jujur, rajin H. ADAM AKIL HSB 1. Wanita, usia 18 - 30 thn - Tidak buta warna, berbadan 5.Berpenampilan bersih & Jl. Setia Budi No. 49 A 8223975 2. Pendidikan SMU/SMK/ MA 3. Fotocopy KTP, Ijazah & KK 2 lbr sehat menarik 4. Pasfoto warna 3x4 cm 4 lbr Lamaran diantar langsung ke: Lamaran lengkap di tujukan ke: 5. Sanggup kontrak kerja 2 tahun 6. Mendapat izin orang tua PANASONIC SENTRA SERVICE Harian Waspada dengan kode Ingin Promosikan - Tidak dikutip biaya pendaftaran - Bagi yang lulus seleksi akan dikenakan biaya penempatan secara tunai bertahap atau angsuran Jl. Willem Iskandar No. 265 Medan “SEGERA 2009” paling Produk Anda melalui potongan gaji di Malaysia Telp. 664.5650 - (061) 7714.7600 lambat 10 hari terhitung iklan Pendaftaran setiap hari kerja, langsung ke: Perusahaan Penempatan Tenaga Kerja Indonesia Swasta Lamaran berlaku untuk 8 hari sejak iklan ini dimuat ini diterbitkan Harian MINI & EFEKTIF WASPADA PT. TIMURAYA JAYA LESTARI DIBUTUHKAN SEGERA Izin Menteri Tenaga Kerja No: KEP 788/MEN/2006 Jl. AH. Nasution, Ruko Tenaga Asri, No.1 Sp. Pos, Pd. Bulan - Medan Telp. 822.7419 LOWONGAN KERJA HP. 0812.6035.7181 - 0813.6159.5866 - 0813.6100.3033 RESMI KE MALAYSIA (Belakang Bank Mandiri Sp. Pos) Dibutuhkan Tenaga Kerja Wanita untuk di pekerjakan pada perusahaan Electronic terkemuka di Malaysia. Kilang COMPANY, bukan Kami adalah distributor electric dan Media yang Tepat IKLANKAN phone stabilizer akan memasarkan LOWONGAN KERJA KE MALAYSIA KONTREK (OUT SOURCING), sebagai berikut: 1. WESTERN DIGITAL M SDN. BHD produk kami terbaru dan - 0813 7628 2301 061-6846 2888 PRODUK ANDA untuk Iklan Anda BIDANG WAITRESS & WAITER 2. SANYO AUTOMEDIA M. SDN BHD, SEBRANG PRAI 061- 6846 3888 Sebuah Hotel berbitang lima TANJUNG membutuhkan beberapa orang Syarat-syarat pendaftaran dan seleksi: sebagai: RHU RESORT yang berlokasi di Pulau 1. Wanita Umur 18 s/d 30 tahun SALES Pengobatan Alat Vital H. Suhendar Langkawi, Malaysia, memerlukan 2. Pendidikan minimal SMP sederajat 3. Membawa Fotocopy Ijazah, KTP, Kartu Keluarga beberapa pekerja laki-laki & perempuan (asli di bawa sewaktu interview) sebagai Waiter & Waitress 4. Membawa phas photo warna 3x4: 3 lbr A. RINCIAN GAJI Dengan kualifikasi /persyaratan: Dengan persyaratan sebagai berikut: 1. WESTERN DIGITAL (M) SDN. BHD 1. Perempuan berumur antara 19 - 30 tahun - Gaji Pokok : RM 450/ bln 1.Pria/Wanita usia 20 - 35 tahun. - Tunjangan kehadiran : RM 50/ bln 2. Laki-laki berumur antara 19 - 30 tahun 2.Minimum tamatan SMU/Sederejat (Tanjung Rhu Resort) - Tunjangan shift - Tunjangan makan : RM 107/ bln : RM 16,50/ bln 3.Memiliki Sepeda Motor dan SIM C Besar dan panjang di tempat Klinik H. Suhendar di bawah 3. Pendidikan minimal SMU, SMIP, Diploma - Tunjangan lainnya - Bonus: Bonus Prestasi dan tahunan : RM 57 - RM 78/ bln 4.Mampu berkomunikasi dgn baik Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung 4. Dapat berbahasa Inggris aktif 2. SANYO AUTOMEDIA SDN. BHD Ditangani secara profesional 5. Memiliki pengalaman kerja di Hotel - Gaji Pokok : RM 430/ bulan 5.Disiplin,mempunyai motivasi tinggi H. SUHENDAR - Tunjangan Kehadiran : RM 60/ bulan dan siap bekerja keras memenuhi Alami bukan suntik, menggunakan Restoran atau Cafe exklusif - Tunjangan Berdiri - Bonus : RM 1/ hari : RM 40/ bulan target. metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat (Vintage Bulgaria Restaurant & Bar) 6. Kontrak kerja 2 tahun - Tunjangan Makan : RM 0.50/ hari - Tunjangan di bagian Mesin: RM 60/bulan 6.Insentif/komisi memuaskan. Paling aman tidak ada efek samping untuk berhati-hati terhadap pengobatan 7. Mendapat izin dari orang tua/ keluarga - Tunjangan Makan (Waktu Lembur/ Overtime): sejenis yang mengaku-ngaku kerabat Fasilitas dan gaji: a.2Jam atau Lebih: RM 1.50, B. 4 Jam atau lebih: RM 2.50 H. Suhendar sudah di kenal sebagai pakar - Tunjangan Shift: a. Petang: RM 3, b. Malam (8 Jam): Surat lamaran lengkap/ CV dan 1. Gaji memuaskan RM 8, c. Malam (12 Jam): RM 10 dilampirkan Pasphoto dan KTP kejantanan yang sudah berpengalaman, atau saudara, soal cara boleh sama 2. Uniform, Duty Meals, Asrama & Trans B. FASILITAS sanggup mengatasi keluhan alat vital khusus tapi keahlian yang membedakan - Levy subsidy 100% terbaru (scan) dan dikirim paling port disediakan - Asrama, tiket pulang, kemudahan kesehatan, pria, memperbesar, memperpanjang 3. Dilindungi asuransi selama bekerja asuransi, berangkat naik pesawat terbang lambat 7 (tujuh) hari setelah iklan (garansi), meningkatkan Untuk keluhan dan pengaduan silahkan Jika berminat segera mendaftar dengan - Bagi yang tidak mampu dapat mencicil biaya pemberangkatan ini terbit ke e -mail: kekerasan, tambah Mahar hubungi langsung: membawa foto copy Ijazah, KTP, dan C. JADWAL PENDAFTARAN/ SELEKSI: mandiri_hrd55@yahoo.com kuat dan tahan lama Rp. 500 ribu Pasphoto warna, Curiculum Vitae (Daftar - Setiap Hari Kerja H. SUHENDAR HP. 0812.131.6364 - Selama libur lebaran kantor tetap buka untuk dalam berhubungan Jl. Tempuling No. 43 B - Serdang Riwayat Hidup) & Resume dapat diantar informasi dan pendaftaran MINI & EFEKTIF langsung ke alamat berikut: C. Untuk Perusahaan Sanyo Automedia boleh yang (masuk Gg. Sado) Medan Testing akan dilaksanakan awal mantan/ eks TKI Sanyo Prai dan Bayan Lepas bulan Oktober (Tanggal akan Segera daftarkan diri anda sekarang juga ke: Telp. (061) 663.4220 dikonfirmasikan lebih lanjut) PT. MUTIARA KARYA MITRA Saksikan !!! SIUP NO: 629/MEN/2006 Interaktif bersama Bpk. H. SUHENDAR PT. SAHARA FAJARINDO CORP JL. KAPTEN MUSLIM NO. 89 C MEDAN TELP: (061) 845.2956 (DEKAT RSU SARI MUTIARA) IKLANKAN di TVRI Nasional Medan. Setiap Sabtu JALAN KANGKUNG NO. 61 MEDAN 20153 TELP. 415.7621 - 455.1305 Contact Person: Mega 0813.6220.2213, Ecy: 0813.7515.5055 PRODUK ANDA Malam Minggu Pukul 20.00 WIB
  • 16 Ekonomi & Bisnis WASPADA Selasa 29 September 2009 Tiket Pesawat Meroket 200 Persen MEDAN (Waspada) : Se- sanksi kepada operator airline balik meningkat. “Disitu per- negeri baik dari Singapura, minggu lebaran berlalu harga melanggar berat sekali yaitu mintaan seat meningkat harga Kuala Lumpur dan Penang tiket rute dalam negeri Medan- pencabutan izin operasional. juga meningkat, sehingga ba- tujuan Medan juga masih Jakarta di Bandara Polonia Me- Pantauan, hingga Senin nyak calon penumpang me- meningkat menyebabkan dan mencapai Rp1,6 juta lebih. (28/9), masih banyak warga ngeluh,” ujar Muni. sejumlah airline menga- Berarti ada kenaikan 200 masyarakat yang balik ke Ja- Muni dan May membe- dakan extra flight hingga persen selama pergerakan karta mengeluh harga tiket ti- narkan, harga tiket Rp1,6 juta Selasa (29/9). arus balik Lebaran 1430 H, dari dak terjangkau saat padat pe- untuk kelas Yengky (Y), tiket Fetty, warga Jalan Kapten harga tiket penerbangan re- numpang. Bahkan untuk kelas lainnya rata-rata sudah Muslim, saat mendarat di guler selama ini antara Rp500 memperoleh seat pesawat juga habis, yang terjual harga kelas Bandara Polonia Medan de- ribu hingga Rp550 ribu sekali susah. tinggi, itupun susah diperoleh ngan penerbangan Air Asia jalan. Sementara itu Muni, agen baik melalui penerbangan Ga- menyatakan, ribuan orang Sebelumnya Adminis- tiket dari Kings Travel Medan ruda Indonesia, Lion Air, Bata- Medan melancong ke Kuala trator Bandara (Adban) Polo- dan Maizuar, agen tiket dari via Air, Sriwijaya dan jenis pe- Lumpur, selama suasana nia Medan Razali Abubakar Raya Utama Travel (RUT) Me- nerbangan lainnya. Lebaran. mengingatkan jajaran airline dan ketika dikonfirmasi mem- Sementara arus penum- Plaza-plaza tempat pen- agar jangan menjual tiket me- benarkan, harga tiket sejak pang dari Medan tujuan Ja- jualan pakaian dipadati lebihi tarif batas harga atas Sabtu, Minggu dan Senin (28/ karta bahkan Batam, hingga orang Sumatera Utara dan Rp1,6 juta sekali jalan. 9) melambung tinggi, banyak Senin sore masih padat, se- Medan pada umumnya. Namun kenyataan di lapa- permintaan. hingga pihak airline berpe- “Melancong ke luar negeri ngan, warga yang balik ke Ja- Penyebabnya karena per- luang menjual tiket harga menyenangkan, kami sudah Reuters karta harus mengeluarkan bia- mintaan seat pesawat bagi tinggi. seminggu disana,” ujarnya. TERGULING: Investor sedang berbincang di depan papan elektronik saham di Taiyuan China, Senin (28/9). Indeks saham ya lebih dari batas harga atas, para calon penumpang arus Bahkan, arus balik dari luar (m32) China terguling tiga persen dalam sesi akhir perdagangan kemarin karena jatuhnya pasar global dan prospek ekonomi yang merosot secara berkelanjutan. Usaha Pedagang Tak Diproteksi, Beras, Migor Turun Usai Lebaran Ratusan Juta Kontribusi PD Pasar Diboikot MEDAN ( Waspada): Harga bahan kebutuhan po- sih tingginya pasokan dari berbagai daerah sentra pro- pertanian diantaranya cabai merah lokal dari Rp32 ribu per pokok selama beberapa hari sempat naik, namun setelah MEDAN (Waspada): PD meninjau ulang jabatan Dirut dan tempat lainnya, akibatnya Sementara itu Dasrial sa- kok seperti beras dan minyak duksi ke pasar tradisional Me- kg turun menjadi Rp25 ribu itu turun drastis setelah buruh Pasar Medan diduga bakal me- dan Direktur Operasional PD pengunjung sulit naik ke lantai lah seorang pedagang pasar goreng (migor) di sejumlah dan sehingga beras IR 64 kua- per kg, sedangkan kentang, normal pekerja, katanya. ngalami kerugian tidak sedikit, Pasar Medan karena selama II, sebutnya. tersebut membenarkan kon- pasar tradisional, usai leba- litas I dari Rp173 ribu per ka- tomat, dan wartel tetap stabil Sedangkan turunnya har- ratusan pedagang lantai II Pa- menjabat tidak ada menun- Uang dari PKL disi pasar Aksara yang sudah ran mengalami penurunan rung 30 kg dijual menjadi yakni di kisaran Rp7000 per kg. ga beras, menurut Rahmat, sar Aksara yang dirugikan aki- jukan kinerja sebagai penge- Disamping itu banyak sangat memprihatinkan aki- sangat tajam, sementara itu Rp165 ribu, katanya. Menurut Rahmita Tarigan akibat banyaknya pasokan bat pengelolaan tidak jelas lola pasar yang baik, katanya. pedagang menyaksikan para bat tidak adanya kepedulian harga gula pasir masih ber- Sementara itu walaupun pedagang sayuran di Pusat hasil panen dari daerah pro- akan memboikot pembayaran Menurut Yuni, pedagang petugas PD Pasar menerima pengelola pasar hanya tahu tahan di Rp10 ribu per kg. tingkat kebutuhan masyarakat Pasar Medan, turunnya harga vinsi Nanggroe Aceh Da- retribusi sebanyak ratusan juta Aksara, boikot dilakukan aki- sejumlah uang dari para PKL mengutip kontribusi tanpa Menurut R Sembiring, mulai kembali turun ke titik bahan pokok hasil pertanian rusalam seperti Tamiang, Aceh rupiah. bat selama bertahun-tahun agar memuluskan usaha ber- melindungi usaha pedagang. pedagang bahan pokok di normal seperti hari biasa sebe- tersebut didorong menurun- Timur hingga Lhokseumawe Menurut tokoh pedagang pasar dibiarkan terlantar me- jualan ditempat terlarang se- Menurutnya usaha peda- Pasar Aksara, Senin (28/9), lum Ramadhan, harga gula nya permintaan masyarakat ke Medan. Aksara, Muslim Sikumbang ngalami kebocoran dan kotor hingga menjadi saingan pe- gang selama Ramadhan me- harga minyak goreng curah pasir di pasaran masih mahal usai lebaran sehingga pasokan Kondisi tersebut juga ber- bersama ratusan pedagang tanpa direnovasi secara serius dagang resmi, sebutnya. ngalami penurunan akibat tanpa merek usai lebaran dan belum turun dan tetap lebih banyak. samaan dengan panen di lantai II, Senin (28/9), meren- oleh PD Pasar sebagai penge- Terhadap kondisi tersebut PKL menjamur dan dibiar- mengalami penurunan dari bertahan di Rp10 ribu per kg, Di samping itu banyaknya sejumlah kabupaten lain di canakan boikot tidak memba- lola, sehingga banyak barang pihaknya telah berulangkali kan oleh petugas PD Pasar di Rp8.500 per kg menjadi ujarnya. pasokan tersebut juga akibat Sumatera Utara seperti Deli yar retribusi ratusan juta ru- dagangan rusak terendam air. menghubungi dan memberi- Aksara, pasar kelas I A de- Rp7.500 per kg. Penurunan tersebut juga pengaruh suasana libur leba- Serdang, Kisaran, Serdang piah sampai PD Pasar melaku- Selain itu PD Pasar secara tahukan ke pihak PD Pasar, ngan jumlah kontribusi dan Harga beras juga menga- diikuti bahan pokok lainnya ran selama sepekan yang me- Bedagai, Asahan dan lainnya, kan pengelolaan yang benar sengaja tidak melindungi namun Direktur Operasional uang kebersihan yang mahal lami penurunan akibat ma- khususnya jenis komoditi ngakibatkan harga bahan sebutnya.(m40) di pasar itu. usaha pedagang resmi dengan Martua Simanungkalit ber- dibiarkan terlantar. Para pedagang Aksara cara menata pedagang kaki sama Dirut Mustafa Sutan Na- Sebagai pedagang me- mendesak Walikota Medan Rahudman Harahap kembali lima (PKL) berjualan ke dalam pasar seperti di tangga masuk sutuion tidak pernah turun ke Pasar Aksara, ujarnya. ngatakan pihaknya sangat setuju memboikot uang kon- tribusi sebanyak ratusan juta Asahan Butuh Industri Kelapa Terpadu kepada PD Pasar sampai pe- KISARAN (Waspada) : Di- rencana pengembangan su- sahaan swasta, nasional mau- masyarakat sekitarnya, serta RI Belum Siap Lepas Subsidi BBM ngelolaan pasar tersebut di- lakukan secara benar oleh rektur Eksekutif Pondok Il- miah Potensi Asahan (PIPA) dah didengungkan Badan Perencanaan dan Pemba- pun perusahaan asing yang tertarik untuk mengembang- membentuk beberapa plasma berbentuk home industri dari JAKARTA (Waspada): Indo- mengubah paradigma subsidi Sementara itu harga mi- Dirut PD Pasar. Zaid Afif, Senin (28/9) me- ngunan Daerah (BAPPEDA) kan kebun kelapa menjadi per- perusahaan pengelola. nesia masih belum siap untuk dari subsidi harga ke subsidi nyak mentah jatuh di perda- Untuk menyelesaikan nyatakan, pengembangan Asahan sejak 2007 lalu. Namun kebunan besar. Dari home industri ini, melepaskan subsidi BBM. Hal langsung, sebagaimana yang gangan Asia, Senin (28/9), di persoalan tersebut DPRD industri kelapa terpadu di areal hingga kini, komoditas kelapa Padahal, sebut Zaid, baik tambahnya, juga bisa dihasil- ini dikarenakan harga energi akan diterapkan G20 untuk tengah berlanjutnya kekhawa- Medan dan Walikota dihim- perkebunan tanaman kelapa lokal masih berupa tanaman inti kelapa maupun limbahnya kan serbuk kelapa untuk ba- alternatif di Indonesia masih negara berkembang. tiran atas permintaan energi bau segera meninjau ulang lokal yang memiliki luas 44,641 perkebunan rakyat dan masih dapat dimanfaatkan dan men- han dasar kompos atau media lebih mahal daripada harga “Yang kita lakukan adalah di Amerika Serikat, pengguna jabatan Dirut PD Pasar yang ha dengan kapasitas produksi dikelola secara tradisional. jadi nilai jual cukup lumayan. tanam intensif. Sementara sa- BBM. mebgubah subsidi harga minyak terbesar di dunia, kata telah hampir setahun men- dari 30,526.95 ton (kopra ba- Dijelaskan, Asahan saat ini Batang pohon kelapa bisa dija- but atau serat kelapa yang te- Hal ini disampaikan Ketua menjadi subsidi langsung se- analis. jabat namun bgelum mela- sah) di Asahan hingga seka- memiliki sejumlah sentra tana- dikan indutri mebel, lidi kelapa lah dipisahkan dari serbuknya Komisi VII, Airlangga Hartanto perti BLT dan raskin, tapi harus Kontrak berjangka utama kukan pembenahan yang rang belum tercapai. man perkebunan kelapa meli- bisa bernilai eksport. Semen- (cocopeat) dapat diolah pabrik di sela-sela acara Halal Bihalal dikembalikan kepada rakyat,” New York, minyak mentah baik di pasar, sebutnya.(m40) Sementara, kata Zaid, puti Kec. Sei Kepayang, kawasan tara batok kelapa dapat diolah menjadi karpet setelah dipress di Departemen ESDM, Jalan ujarnya. light sweet untuk pengiriman pesisir Kec. Air Joman dan pesi- menjadi arang kelapa. dan ditenun. Medan Merdeka Selatan, Ja- Menurut Purnomo, peme- November, turun 21 sen men- sir pantai Kec. Tanjung Balai. Seharusnya, lanjutnya, in- “Sebenarnya banyak sekali karta, Senin (28/9). rintah kini memang masih jadi 65,81 dolar AS per barel, “Potensi baik ini perlu pengka- dustri pengelolaan kelapa ter- manfaat dari pohon kelapa. “Negara-negara maju me- menyediakan anggaran sub- sebagaimana dikutip dari AFP . jian ulang dan benar,” kata Zaid padu dapat segera dibangun Tinggal bagaimana kita me- mang tidak ada subsidi BBM sidi BBM Rp 50 triliun. Pro- Minyak mentah Brent didampingi Sekretaris Eksekutif dengan konsep pengemba- ngolahnya lebih serius dan apalagi G8. Negara kita belum gram pengurangan subsidi North Sea untuk pengiriman PIPA, Aziz AR Panjaitan. ngan teknologi tepat guna. Ke- maksimal,” pungkas Zaid yang siap melepaskan subsidi BBM BBM diharapkan bisa me- November turun 39 sen men- Keduanya dalam kesem- mudian dioperasikan dengan mengaku sekolah dibiayai dari karena energi alternatif yang mangkas angka subsidi itu jadi 64,72 dolar AS. Kekhawati- patan itu juga menjelaskan metode industri partisipatif, hasil perkebunan kelapa disiapkan harganya masih hingga setengahnya. ran terhadap permintaan tentang belum adanya peru- melibatkan petani kelapa dan keluarganya. (a10) lebih tinggi dari harga fosil “Jadi nanti subsidi hanya energi AS muncul kembali se- fuel,” ujar Airlangga. Menurut Airlangga, besa- Rp 15-20 triliun. Suatu saat nanti subsidi hanya elpiji dan telah data dikeluarkan Jumat menunjukkan pesanan barang Lonjakan SMS XL ran subsidi BMM baru bisa di- turunkan kalau pengemba- BBM dan energi terbarukan,” tambahnya lagi. tahan lama turun 2,4 persen pada Agustus terhadap eks- Sepanjang Lebaran Lancar ngan energi alternatif ber- Terkait subsidi listrik, Pur- pektasi pasar untuk kenaikan Trafik SMS tertinggi, dalam kurun tiga hari sejak H-2 langsung di Indonesia. nomo mengatakan, nantinya sebesar 0,4 persen. hingga hari H Lebaran, terjadi pada 19 September (H-1 “Itu jalan dulu baru kita untuk daerah-daerah yang Barang tahan lama adalah Lebaran), yakni sekitar 270 juta SMS. bisa turunkan subsidinya,” penduduknya kaya tidak akan mereka cenderung berusia tiga “H-1 Lebaran tercatat sebagai trafik tertinggi SMS XL, ujarnya. diberikan. tahun atau lebih, seperti mobil yakni 270 juta SMS dari 100 juta SMS di tahun sebelumnya, Untuk mendukung pe- “Harga listrik di Pondok dan peralatan, dan mewakili naik signifikan hingga sekitar 170 persen,” ucap kata Manager ngembangan subsidi energi al- Indah akan lebih mahal dari segmen kunci dari sektor ma- Public Relations XL Febriati Nadira, di Jalarta. ternatif (Bahan Bakar Nabati/ harga listrik di Tanjung Priok. nufaktur. Dibandingkan hari H Lebaran, Ira menuturkan, XL hanya BBN) tersebut, lanjut Airlang- Jadi kita ingin PLN itu sekarang “Berita ekonomi interna- mencatat sekitar 240 juta SMS dari kurang lebih 100 juta ga, pemberian subsidi tersebut tahu persis dimana pantasnya sional pada umumnya menge- SMS di tahun sebelumnya, atau melonjak hingga 140 persen. sudah dibahas di DPR. itu mereka tidak perlu subsidi cewakan ekspektasi pasar, se- Sementara itu, untuk trafik layanan data (GPRS) XL “Jadi disubsidi dulu untuk listrik, seperti Menteng dan hingga pasar minyak dan lo- tertinggi justru jatuh pada hari H-2 Lebaran, yakni sekitar sampai ke skala keekonomian. Pondok Indah nggak perlu di- gam dan kurang terdorong,” 2,7TB. Jika dibandingkan dengan trafik sebesar 0,65TB di Waspada/H. Rusli Ismail Kenapa disubsidi karena mu- subsidi,” ujar Purnomo. analis dari Commonwealth tahun sebelumnya, XL mencatat pertumbuhan pesat 315 LENGANG: Suasana Jalan dan pertokoan di Jalan Ratu Syafiatuddin, Kota Banda Aceh, yang liltiplier efeknya besar untuk Dia menambahkan, PLN Bank of Australia mengatakan persen. hari-hari biasanya terkenal cukup padat. Kini kelihatan masih lengang bahkan sangat sepi industrinya dan petaninya,” kini sedang melakukan survei dalam sebuah laporan. “Pada hari H Lebaran, XL membukukan trafik data sekitar dari aktivitas transportasi atau lalu-lintas dan jual beli karena sebagian besar toko yang masih tandas Airlangga. terhadap purchasing power “Data ekonomi AS gagal 2,4TB, meningkat 328 persen dari tahun sebelumnya yang tutup total. Foto diambil Minggu (27/9). Terkait penghapusan sub- ability di berbagai daerah ter- meredakan kekhawatiran bah- hanya membukukan 0,57 TB,” ucap Ira. sidi BBM, Menteri ESDM Pur- kait perbedaan tarif listrik wa permintaan minyak AS PT Excelcomindo Pratama Tbk (XL) menyatakan trafik nomo Yusgiantoro mengata- tersebut. tetap suam-suam kuku,” kata layanan suara dan layanan pesan singkat (SMS) melonjak Pasar Tradisional Di Banda Aceh Masih Sepi kan, Indonesia memang ingin Harga minyak mereka.(dtc) selama Lebaran 2009. BANDA ACEH (Waspada): nya masih sepi, juga sebagian halaman mereka masing- “Jaringan XL aman dan sukses. Secara nasional pening- Hingga hari kedelapan pasca besar toko masih kelihatan tu- masing. Harga Ikan Di Kisaran Mulai Normal katan trafik suara mencapai 44 persen,” kata Ira. Dia menjelaskan, kenaikan trafik signifikan sudah terjadi Idul Fitri 1430 H, Minggu (27/ 9), suasana pasar-pasar tradi- tup total, sebagaimana terlihat di, Pasar Aceh, Pasar Peuna- Yang paling menyolok, suasana terlihat ramai di ber- KISARAN (Waspada): Har- kan barang maupun harganya kan menjelang hingga hari ke- sejak H-2 (18/9) Lebaran. Trafik percakapan tertinggi terjadi sional di Banda Aceh dan Aceh yong, Pasar Neusu, Pasar Lam- bagai stasiun angkutan atau ga ikan laut mulai normal di sudah berangsur normal,” tu- tiga lebaran lalu,” tutur Erlina, hari H Lebaran (20/9) dengan 925 juta panggilan, meningkat Besar, terlihat masih sepi. Na- lagang, Pasar Seutui (Kota Ban- terminal mopen yang berlo- Pusat Pasar Kisaran yang sebe- tur M. Rafi, awak truk ikan asal 30, warga Kel. Siumbut-Um- 6 persen dibanding hari H Lebaran 2008 sebanyak 870 juta mun begitu harga-harga ba- da Aceh), Pasar Keutapang, Pa- kasi di sekitar pusat pasar tra- lumnya pada Lebaran sampai Tanjungbalai yang sempat di- but, Kec. Kisaran Timur Kab. panggilan. rang khususnya kebutuhan sar Lambaro dan Pasar Indra- disional tersebut, petugas sta- hari ketiga sempat melonjak konfirmasi Waspada. Asahan yang kebetulan mem- Pada Lebaran 2009 lama percakapan mencapai 630 juta pokok masih tetap tinggi. puri (Kabupaten Aceh Besar) siun tampak sibuk dan lancar 20 sampai 40 persen dari harga Kondisi sama juga berlang- beli ikan di pasar Kisaran. menit, meningkat 40 persen dari sebelumnya 450 juta menit. Berdasarkan pantauan, dan sejumlah pusat pasar per- melayani warga yang ingin be- biasanya. sung di pusat pasar ikan Tan- Sementara ikan air tawar Sementara trafik SMS saat Idul Fitri 1430H mencapai 240 masyarakat di daerah itu ma- belanjaan lainnya. pergian dan arus balik pe- Pantauan Waspada hingga jungtiram dan Tanjungbalai. seperti Ikan Lele Rp12.000 per juta SMS, melonjak 140 persen dari 100 juta SMS tahun sih larut dalam merayakan Hingga Minggu (27/9), di mudik. Senin (28/9), suplai ikan dari “Sudah mulai normal kembali, kg, Ikan Mujahir Rp15.000, dan sebelumnya. hari kemenangan umat Islam kawasan pekan Pasar Aceh, Pa- Sementara itu sejumlah Tanjungbalai dan Tanjungti- sebelumnya sempat meroket ikan Mas Rp18.000. “Biasalah Sedangkan layanan data/GPRS melonjak 328 persen setelah sebulan penuh ber- sar Peunayong, Pasar Neusu, pedagang yang sudah mulai ram mulai berangsur pulih. harganya, maklumlah nelayan pasar Pak, kebutuhan mening- menjadi 2,44 terabites dari 0,57 terabytes. Nadira menjelas- puasa di bulan suci Ramadhan Lamlagang, (Kota Banda melakukan transaksi jual beli “Nelayan sudah mulai melaut tidak turun ke laut,” tutur Jo- kat sedangkan pasokan menu- dan Idul Fitri. Hanya sebagian Aceh), Pasar Keutapang dan di beberapa kawasan tertentu kan, secara nasional terjadi pergerakan pelanggan dari kota- kembali,” tutur S. Siregar, dis- han, 45, pemilik salah satu run maka harga akan naik. Se- kecil pedagang yang tampak Pasar Lambaro (Aceh Besar) kepada Waspada, Minggu (27/ kota besar ke sejumlah kota di daerah. tributor ikan di Pasar Kisaran. gudang ikan di Tanjungbalai. karang pasokan sudah mulai menggelarkan dagangannya. yang selama ini tertkenal se- 9), mengaku persediaan ba- Siregar menyebutkan, se- Sedangkan Udin, 40, peda- normal kebutuhan pun me- Dengan kata lain tidak terjadi gangguan pada layanan Selain aktivitas perdaga- bagai pusat pasar tergolong rang sudah menipis dan terba- jak lebaran pertama sampai gang ikan di Pasar Kisaran nurun, maka harga kembali panggilan maupun pengiriman SMS. “Peningkatan trafik ngan di kaki lima dan pasar- padat pengunjung, hingga tas. “Stoknya hampir habis, se- lebaran ketiga hasil laut yang menjelaskan, harga ikan Cin- normal seperti biasa,” tutur pe- tertinggi terjadi di Jawa Tengah yang mencapai 68 persen, pasar tradisional termasuk pa- pasca delapan hari lebaran dangkan harga sebagian besar beredar di pasaran berasal dari caro Rp7.000, Gembung Rp15. dagang ikan air tawar.(a10) dan DI Yogyakarta 58 persen,” kata Ira. sar kebutuhan pokok suasana- Idul Fitri, suasananya masih belum menunjukkan penuru- stok kulkas, sehingga distri- 000, Udang Senja Rp24.000, sepi. Hanya sekira 40 persen nan sejak terjadi kenaikan butor menawarkan ikan de- ikan Belida Rp13.000, Kelotok pedagang yang menggelar menjelang Idul Fitri beberapa ngan harga Rp10.000-Rp12.000 Rp15.000, Senangin Rp20.000, Valuta Asing Di Medan dagangannya. waktu lalu,” ujar R. Dian, se- Harga Emas Di Medan Mata Uang Jual Beli per kg, akan tetapi harga eceran Gembung Kuring Rp18.000, Maklum, sebagian masih orang pedagang barang kelon- di pasaran mencapai Rp18.000 Tongkol Rp14.000, Cumi-cumi Jenis Kadar Harga Dolar AS 9.730 9.720 tutup karena pedagang yang tong di Pasar Neusu. untuk ikan gembung. Melon- Rp10.000, Parang-parang Rp7. Dolar Australia 8.225 7.925 selama ini berdatangan dari Belum normalnya aktivitas London Murni 99% Rp304.000 Franc Swiss 9.664 9.287 jaknya harga diperkirakan 000, Gulama Rp4.000, Selar London 97% Rp290.000 Poundsterling Inggris 16.748 16.305 berbagai penjuru Kota Banda dan suasana pasar, ternyata ‘dimainkan’ oleh pengecer yang Rp7.000, Cucut Rp4.000, Ikan 24 Karat 90 s/d 93% Rp260.000 Dolar Hongkong 1.389 1.283 Aceh dan Aceh Besar bahkan menimbulkan kesulitan bagi terpaksa tidak berlebaran ka- Merah Rp12.000, dan Bawal Emas Putih 75 % Rp230.000 Yen Jepang 110,43 105,88 dari seluruh penjuru Provinsi ibu rumah tangga yang ingin rena melayani kebutuhan ma- Rp23.000. Dolar Singapura 7.230 7.000 Aceh dan Sumetera Barat berbelanja sayur-mayur untuk 22 Karat 70% Rp165.000 Euro 14.523 14.123 syarakat akan ikan. “Harga ikan laut sudah Suasa 20 s/d 35% Rp100.500 Ringgit Malaysia 2.957 2.924 (Sumbar) masih menghabis- kebutuhan sehari-hari selepas “Sekarang ini, baik paso- mulai turun dari harga sepe- kan waktu lebaran di kampung lebaran.(b21)
  • WASPADA Selasa 29 September 2009 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:18 15:27 18:21 19:29 04:48 04:58 06:12 Langsa 12:20 15:31 18:24 19:32 04:51 05:01 06:15 Sabang 12:31 15:43 18:34 19:42 05:01 05:11 06:25 Tarutung 12:17 15:24 18:20 19:28 04:46 04:56 06:11 B. Aceh 12:31 15:43 18:34 20:43 05:01 05:11 06:26 L.Seumawe 12:24 15:36 18:27 19:35 04:54 05:04 06:18 Pandan 12:17 15:24 18:21 19:29 04:47 04:57 06:11 T.Tinggi 12:16 15:25 18:19 19:27 04:46 04:56 06:10 Binjai 12:18 15:28 18:22 19:30 04:49 04:59 06:13 L. Pakam 12:17 15:26 18:20 19:29 04:47 04:57 06:11 Sibolga 12:17 15:24 18:21 19:29 04:47 04:57 06:11 Panyabungan 12:14 15:19 18:18 19:26 04:44 04:54 06:08 Bireuen 12:25 15:37 18:29 19:37 04:56 05:06 06:20 Sei Rampah12:16 15:26 18:19 19:28 04:46 04:56 06:10 Sidikalang 12:19 15:27 18:22 19:30 04:49 04:59 06:13 Teluk Dalam12:21 15:26 18:25 19:33 04:51 05:01 06:15 B. Pidie 12:25 15:36 18:28 19:37 04:55 05:05 06:19 Meulaboh 12:28 15:38 18:31 19:39 04:58 05:08 06:22 Sigli 12:28 15:40 18:32 19:40 04:59 05:09 06:23 Salak 12:19 15:27 18:23 19:31 04:49 04:59 06:13 G. Sitoli 12:22 15:28 18:26 19:34 04:52 05:02 06:16 P.Sidimpuan12:15 15:22 18:19 19:27 04:45 04:55 06:09 Singkil 12:21 15:29 18:25 19:33 04:51 05:01 06:15 Limapuluh 12:15 15:24 18:18 19:26 04:45 04:55 06:09 K. Jahe 12:18 15:27 18:22 19:30 04:48 04:48 06:13 P. Siantar 12:16 15:25 18:20 19:28 04:46 04:56 06:10 Stabat 12:18 15:28 18:22 19:30 04:48 04:58 06:13 Parapat 12:17 15:25 18:20 19:28 04:47 04:57 06:11 Kisaran 12:14 15:23 18:18 19:26 04:44 04:54 06:08 Balige 12:16 15:24 18:20 19:28 04:46 05:56 06:10 Takengon 12:25 15:36 18:28 19:36 04:55 05:05 06:19 GunungTua 12:14 15:20 18:18 19:26 04:44 04:54 06:08 Kutacane 12:21 15:30 18:24 19:32 04:51 05:01 06:15 R. Prapat 12:13 15:20 18:17 19:25 04:43 04:53 06:07 T.Balai 12:13 15:22 18:17 19:25 04:43 04:53 06:07 Sibuhuan 12:13 15:19 18:17 19:25 04:43 04:53 06:07 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:24 15:33 18:27 19:35 04:54 05:04 06:18 Lhoksukon 12:23 15:35 18:26 19:35 04:53 05:03 06:18 Diduga Hasil Curian, Polres Langkat Sita Mobil Mewah STABAT (Waspada): Sepekan singkat. Namun Ka-sat Reskrim juta tanpa diperlihatkan BPKB. enggan menyebutkan identitas ‘Bisnis penggadaian mobil terakhir Polres Langkat menahan pemilik maupun pemakai mobil mewah berplat luar provinsi Sumut mobil mewah Hyundai Santa Fee yang telah dimintai keterangan di Stabat salah satunya menjeru- Turbo B 2998 II warna hijau muda. sebelumnya. AKPWahyudi juga eng- muskan Hyundai Santa Fee Turbo gan menjelaskan kronologis pena- untuk penyelidikan polisi lebih lanjut. Dasar penahanan dijelaskan Kasat hanan apakah sewaktu razia kenda- Sementara pantauan Waspada Reskrim, AKPWahyudi, Senin (28/9), mobil raan bermotor atau adanya infor- di Mapolres Langkat, mobil yang tidak dilengkapi surat Bukti Pemilik Ken- masi masyarakat. ditahan diistimewakan, diparkir daraan Bermotor (BPKB). Keterangan lain yang dihimpun, sejajar dengan mobil perwira lain- Polisi meragukan mobil bernopol wila- sebelum ditahan, mobil tersebut nya di areal parkir samping kanan, yah Jakarta itu hasil curian maupun ilegal beberapa kali digadaikan oleh ok- tidak selayaknya mobil barang bukti dan Kasat Reskrim tidak membantahnya. num pengusaha di Stabat kepada lain yang diparkir di halaman bela- ‘’Ia, mobil tidak dilengkapi BPKB,’’ katanya yang berminat dengan harga Rp25 kang. (a38) Sidang Lanjutan DAK, Uang Miliaran Disetor Ke Terdakwa AZ STABAT (Waspada): Dalam sidang wa IG, dia membenarkan meme- AZ minta maaf dan menyebutkan lanjutan perkara dugaan korupsi penyim- rintah kedua terdakwa untuk meng- maksudnya bukan titipan kepala se- pangan DAK tahun 2007 di PN Stabat, Senin hantarkan uang kepadanya, tetapi kolah, tetapi semacam amanah. Ma- (28/9), diulas terkait terdakwa AZ meneri- digunakan untuk membeli alat pera- jelis hakim semakin bingung dengan ma uang cas miliaran rupiah dalam koper ga kebutuhan sekolah juga mem- keterangan AZ. Kemudian saat JPU Waspada/Abdul Hakim dari terdakwa IG dan AB usai pemotongan bayar utang-utang terkait program bertanyaapakahuangmiliaranituhabis TRANSPORTASI GETEK: Bukan hanya saat lebaran, transportasi getek di Desa Bukit Melintang, Kec. Wampu, Kab. Langkat yang melintasi uang DAK dari 75 kepala sekolah. Berda- DAK yang belum lunas. Melihat terpakai untuk utang program DAK Sei Wampu merupakan harapan warga untuk bepergian dari desa ke kota. Ratusan warga memanfaatkan jasa penyeberangan non stop 24 jam sarkan pengakuan saksi IG dan AB sebe- adanya kejanggalan keterangan AZ, dan membeli alat peraga, AZ mengata- itu setiap harinya karena tidak ingin menempuh satu jalur lain yang menyita waktu lama dengan kondisi jalan rusak parah. Saat lebaran, lumnya, uang miliaran itu mereka serah- majelis hakim kembali bertanya kan habis terpakai seluruhnya. Akhir- penyeberangan itu padat karena warga 10 desa di Kec. Wampu berkunjung dan dikunjungi kerabat mereka. Gambar direkam Minggu (27/9). kan kepada AZ di kediamannya di Stabat untuk memperjelas. AZ kemudian nya majelis hakim menyatakan persi- sesuai permintaannya. menyebut uang itu merupakan titi- dangan berakhir dan dilanjutkan Rabu Namun dalam persidangan Senin saat pan kepala sekolah kepadanya. (30/9) masih beragenda mende- Warga Aceh Tamiang Ditemukan Kasus Lahan Perg.Taman Siswa T.Tinggi, AZ dihadirkan sebagai saksi untuk terdak- Sesaat setelah mengatakan itu ngarkan keterangan saksi. (a38) Tewas Di Teluk Mengkudu TELUKMENGKUDU (Waspada): Azwar,22, warga Desa Ada Dugaan Persidangan Gelap Pengawasan Proyek Pembangunan Penaga, Kecamatan Bendahara, Kabupaten Aceh Tamiang, ditemukan tewas mengenaskan dengan sekujur tubuh luka TEBING TINGGI (Waspada): Per- sidangan gelap diduga terjadi di Pe- ngadilan Negeri Kota Tebingtinggi, ter- benar. Lahan seluas 4.125 M2 itu oleh terdakwa tidak dijual tapi dihibahkan kepada Perg.Taman Siswa untuk lahan Di Langkat Perlu Ditingkatkan bekas penganiayaan. Korban ditemukan warga di tepi jalan Desa Mata Pao menuju ke Sialang Buah,persisnya diareal kait kasus lahan Perguruan Taman Sis- sekolah. Sedangkan pihakTaman Siswa, STABAT (Waspada): Sejumlah kalangan terulang. Kabag Humas H Syahrizal mengutip kebun kelapa sawit milik PT.Socfindo kebun Mata Mata Pao, wa di Jalan Deblot Sundoro, Kel. Ram- mengeluarkan dana Rp75 juta untuk tokoh masyarakat mengimbau Pemkab Ironisnya, aparat Pemkab Lang- pernyataan Sekda. Menurutnya tim Kec.Teluk Mengkudu, Kab.Serdang Bedagai, Senin (28/9) bung, Kec. T.Tinggi Kota, karena no- mengganti aset yang ada di atas lahan Langkat bersama instansi terkait untuk me- kat memiliki personil pengawasan pengawas akan memprioritaskan ber- sekira pukul 07:00. mor perkara kasus itu tak ada dalam itu, kepada keluarga terdakwa. Hal itu ningkatkan pengawasan pada proyek pem- yang cukup baik melalui Inspektorat, bagaipengerjaanproyekyangberkaitan Penemuan mayat bermula dari salah seorang karyawan administrasi PN. Bahkan, terdakwa dilakukan,karenadulunyapemiliklahan bangunan yang saat ini sedang dikerjakan. nyatanya pengawasan yang mereka dengan kepentingan masyarakat ba- kebun yang akan melaksanakan tugasnya di lokasi itu. Melihat merasa telah dipecundangi Polresta, M Sabtu, sering mengibahkan lahan ‘’ Pengawasan sangat penting sehingga lakukan selama ini setali tiga uang, nyak seperti sarana perhubungan, adanya sesosok tubuh manusia yang dalam keadaan posisi Kejari dan PN Tebingtinggi, dalam pro- kepada masyarakat yang memakai mutu pekerjaan tidak asal jadi,’’ ucap se- lanjutnya. transportasi, pendidikan, pertanian telungkup tidak bernyawa lagi lalu memberitahukannya ke- ses perjalanan kasus itu sejak awal, lahanmiliknya.Atasdasaritupula,kedua orang tokoh masyarakat yang enggan di- Sementara itu guna menindak- dan kesehatan. pada aparat pemerintahan desa dan dilanjutkan ke Polsek sehingga harus ditahan di Lapas Te- terdakwa dengan persetujuan ibunya sebutkan indentitasnya menjelaskan ke- lanjuti temuan tentang beberapa Pelaksanaantugastimefektifmulai Teluk Mengkudu. bingtinggi. menghibahkan lahan itu untuk sekolah. pada Waspada di Stabat, Senin (28/9). proyek fisik yang tidak sesuai dengan Oktober 2009 dan setiap selesai me- Kapolsek Teluk Mengkudu AKP Robert Simbolon yang Adi Hariono, 44, warga Jl Deblot “Kalauitujualbelimanasegituharganya,” Dikatakan, selama ini kucuran dana bestek atau adanya proyek fisik yang laksanakantugaspengawasan,timakan menerima laporan langsung turun ke lokasi penemuan mayat Sundoro No.15, Kel. Rambung, meru- kata dia. untuk proyek pembangunan berupa sara- terbengkalai, Bupati Langkat Ngo- membuat laporan secara tertulis kepa- bersama beberapa anggotanya. Saat saku celana korban dipe- pakan salah satu terdakwa kasus du- Status lahan itu sendiri, hingga me- na perhubungan dan pendidikan cukup gesa Sitepu telah membentuk tim da Bupati Langkat. Mekanisme kerja riksa petugas menemukan sebuah dompet berwarna merah gaan pemalsuan surat dengan peng- ninggalnya pemilik lahan yakni M Sabtu besar, tetapi karena pengawasan model 86, pengawasan proyek yang dikoor- tim telah diatur dalam upaya untuk dan didalam dompet ada Kartu Tanda Penduduk(KTP). Dari gelapan hak atas barang yang tidak (ayah angkat dari ibu terdakwa Alm. perkerjaan proyek kurang berkualitas. Selain dinir oleh Sekdakab Langkat Drs H memberikan masukan kepada Kepala kartu tersebutlah petugas mengetahui identitas korban adalah bergerak, Senin (28/9). Dia, mengurai- Romana dan kakek angkat pengadu Adi pengawasan bidang pembangunan, tokoh Surya Djahisa. Daerah untuk mengevaluasi hasil-hasil warga Kabupaten Aceh Tamiang. kan kronologis perkara itu hingga sam- Rahmat), tidak jelas. Karena alas hak masyarakat tersebut juga meminta agar Bupati merespon apa yang men- pekerjaan proyek untuk kemudian ke- Untuk mengetahui dan melihat semua kondisi luka ditubuh pai di PNTebingTinggi. Dikatakan, kasus yakni Grant Sultan No.127 sampai kini pengawasan dibidang keuangan juga jadi keluhan masyarakat terha-dap pada SKPD yang bersangkutan agar korban Kapolsek Teluk Mengkudu memberitahu ke Polres itu muncul terkait pengaduan saudara tidak ada yang mengetahuinya. Namun, diperketat, sehingga kasus korupsi yang pengerjaan proyek dan sejak kepe- menjadi catatan bagi pihak ketiga yang Serdang Bedagai. Beberapa saat kemudian petugas dari iden- sepupunya bernama dr Adi Rahmat, lahan itu selama puluhan tahun, setelah sekarang ini masih digelar di PN Stabat tidak mimpinannyaakandibentuktim,kata melaksanakan pekerjaan. (a01) tifikasi yang langsung dipimpin Kasat Reskrim AKP Sonny pada 2006 ke Polresta Tebing Tinggi. meninggalnya ayah angkat mereka, Pengadu yang sejak puluhan tahun diusahai dan diambil manfaatnya oleh Marisi Nugroho Tampubolon, SIK tiba di tempat. Saat dilakukan penelitian, banyak sekali luka yang ada di tubuh korban bekas tusukan dan sayatan benda tajam. tinggal di Malaysia itu, menuduh Adi HarionodanabangnyaAgusHari-yanto, orang tua kedua terdakwa, yakni Alm. Romana dan suaminya Mugiono. Se- 12 Elemen Masyarakat Tolak Tempo Lima Jam Dalam tempo lima jam, dua dari tiga pelaku pembunuhan Azwar ditangkap dari rumah mereka masing-masing di Desa telah menjual lahan seluas 4.125 M2, kepada Perg.Taman SiswaTebing-tinggi, senilai Rp75 juta. dangkan pengadu Adi Rahmat, sejak puluhan tahun sama sekali tidak berada di tempat, karena mandah ke Malaysia. Rini Jadi Ketua DPRD Binjai Pekan Tanjung Beringin, Kec.Tanjung Beringin, Kabupaten Lalu, pada Mei 2006 itu juga terdak- ‘’Karena statusnya milik kakek angkat BINJAI (Waspada): 12 elemen masya- Golkar sebagai peraih kursi dewan Serdang Bedagai, Senin (28/9) sekira pukul 12:00 . wa menjalani pemeriksaan di Polresta kami, atas izin orang tua kami, lahan rakat yang tergabung dalam Lembaga terbanyak di daerah itu mengusung Ketiga yang ditangkap itu masing masing, JP ,21, warga dengan Juper E. Saragih. Anehnya, itu kami hibahkan, ‘’ kata Hariono. Sosial masyarakat ( LSM) dan pratisi hu- Rini Sopianti sebagai calon ketua Dusun I, Keramat Asam,Desa Pekan Tanjung Beringin,SRN,22, selama tiga tahun kasus itu mengendap Atas dasar itu pula, kedua terdakwa kum Senin ( 28/9) mendatangi DPRD Binjai DPRD Binjai. Haris Harto menga- warga Dusun Kampung Baru, Desa Pekan Tanjung Beringin di Polresta dan baru muncul kemudian tidak mengerti mengapa mereka justru menolak Hj Rini Sopianti (foto) sebagai jukan interupsi sempat menyoal (keduanya sebagai pelaku) dan Hendra ,19,warga Desa Kuala pada 2009. Lalu, 8 Mei 2009 terdakwa dituduh melakukan pemalsuan surat ketua DPRD Binjai sementara maupun pengusungan nama Rini sebagai Simpang,AcehTamiang masih sebagai saksi. Sedangkan seorang mendapat panggilan Polresta dan me- dan penggelapan lahan. “Saya merasa- defenitif. calon Ketua DPRD Binjai. lagi pelaku pembunuhan itu yakni Rz masih kabur. nghadap 12 Mei 2009. Pada pemang- kan ada skenario untuk menzhalimi Pernyataan sikap 12 elemen masya- Mengaku masih sebagai Ketua Menurut pengakuan JP di Mapolsek Teluk Mengkudu gilan pertama itu, BAP telah siap dan saya,’ kata Adi Hariono. Selain itu, ke- rakat Kota Binjai menolak Hj Rini Sopianti DPD Partai Golkar Binjai yang sah, yang merupakan pelaku utama dalam kasus pembunuhan segera dilimpahkan polisi ke Kajari. duanya heran, kenapa pengaduan Adi sebagai ketua DPRD sebagai menentang mantan Ketua DPRD Binjai periode itu kepada petugas, pembunuhan dilakukan karena dendam Sebelum ke Kejari ada jaminan dari Rahmat diproses, padahal status ber- nepotisme. Seperti dikatakan Gito Affandi 2004-2009 terang-terangan menen- lama. Tahun 2007 pipi JP pernah disayat korban gara- gara polisi, mereka tidak akan ditahan. sangkutan hanya cucu angkat, sedang dariWanacakra dan Syamsuddin Damanik tang pencalonan Rini Bahkan kapa- tidak mau mengantarkan korban ke Rumah Sakit Umum Anehnya sesampai di Kejari, pihak ibu mereka anak angkat dari pemilik serta Jaspen Pardede dari P3H, Hj Rini sitas Rini sebagai salah satu unsur Melati Kampung Pon.Waktu itu sudah larut malam dan menun- kejaksaankemudianmengeluarkansurat lahan.Tegasnya, lahan itu milik M Sabtu Sopianti adalah istri Walikota Binjai HM ketua di DPD Partai Golkar Binjai jukkan pukul 02:00.. “Karena saya tidak mau korban marah penahanan. bukan milik Adi Rahmat. Tapi pasca Ali Umri menimbulkan sistem nepotisme juga sempat dipertanyakan. dan menggores pipi saya,”kata JP Akibat sayatan pisau itu . Akibat surat penahanan No.Print- meninggalnya M Sabtu lahan itu legislatif dan eksekutif . Namun kemudian seorang ang- hingga saat ini pipi JP masih cacat sebelah kiri. 362/N-214/Rt.3/LP/i/05/2009 yang diusahai Alm Romana sebagai anak Ketika delegasi elemen masyarakat Affandi rekayasa penetapan ketua gota DPRD dari Partai Golkar, Zai- Karena itu korban ditangkap polisi dan diadili di pengadilan ditandatangani Kasi Pidum Hamka angkatdansuaminya.Bahkan,keduanya memasuki gedung DPRD Binjai , Ketua sementara dilakukan rapat di kantor nuddin Purba, SH secara tegas me- Negeri Tebingtinggi serta divonis selama satu tahun. Setelah Nasution, SH, terdakwa ditahan dari tinggal di rumah warisan M Sabtu ber- DPRD sementara Hj Rini Sopianti lang- Satpol PP Jalan Jambi,yang dihadiri ngakui Rini sebagai calon yang sah menjalani tahanan,korban pulang dan langsung pergi meran- 13 Mei- 17 Juni 2009. Persidangan per- samaanak-anaknyahinggakini.“Secara sung meninggalkan gedung wakil rakyat. Wakil Walikota, Sekdako, Sekwan diusung Partai Golkar. Kembali di- tau ke Aceh. Setelah setahun di Aceh korban pulang berlebaran tama dimulai pada 20 Mei 2009. Sete- de facto, orang tua kami yang berhak Menurut Asbat dari Pemuda Peduli DPRD Hanizar Rawi, pengurus Gol- warnai hujan interupsi antar sesama ke rumah keluarganya di Gang Dame ,Desa Pekan Bedagai, lah beberapa kali siding, barulah ter- menguasainya dan bukan Adi Rahmat,” Binjai, pemerintah sudah mencanangkan kar. “Berarti unsur pemerintah su- kader Partai Golkar di dewan terse- Kec.Tanjung Beringin, Kab.Serdang Bedagai Sabtu (26/9). dakwa mendapat status tahanan kota tegas Adi Harianto. Tapi, nyatanya fakta penghapusan Kolusi dan Nepotisme . dah ikut campur ke dalam ranah but, Rini akhirnya tetap terpilih seba- Minggu(27/9) pelaku dan korban bertemu. Saat itu korban dengan jaminan Rp50 juta. Setelah itu tak muncul di pengadilan, keluh dia. Ternyata di Binjai nepotisme dilahirkan politik,” sambung David. gai Ketua DPRD Binjai. tertawa melihat pelaku, sehingga dendam pelaku melihat menjalani beberapa kali persidangan Terkait masalah itu, JPU Fitriani, dengan merekayasa Ketua DPRD Binjai Ricuh Hj Rini Sopianti ketika ditemui korban bankit kembali. Saat korban menonton hiburan key- JPU menuntut Agus Harianto dengan SH, saat dikonfirmasi membenarkan istriWalikota HM Ali Umri. 12 elemen ma- Sidang pleno DPRD Binjai me- wartawan mengaku siap mengemban board di Desa Nagur JP menyuruh temannya SRN menjemput kurungan 1 tahun dan Adi Hariono penahanan terhadap terdakwa. “Kasus syarakat dan berbagai tokoh LSM minta netapkankomposisipimpinanDPRD, amanah. Dia berharap, masyarakat korban dengan mengendarai sepeda motor Honda Supra dengan6bulankurungan.Padahal,pasal itu memang dapat ditahan, jadi kami wakil rakyat yang baru dilantik melawan diwarnai kericuhan. Hj Rini Sopianti membantu memberi masukan yang warna hitam BK 6534 GA dan dibawa ke arena hiburan key- yang dituduhkan 385 KUH Pidana tahan,” kata dia. kezaliman dan adanya intervensi pengua- yang diusung Partai Golkar akhirnya positif demi majunya pembangunan board di Desa Bogak Besar,Kecamatan Teluk Meng- dengan hukuman maksimal 4 tahun. Di PN Tebingtinggi. Fitriani, juga sa. Serta menolak Hj Rini Sopianti sebagai terpilih sebagai Ketua DPRD Binjai. di daerah itu. kudu,Kab.Serdang Bedagai. Usai melihat keyboard di Bogak Hingga2minggukemudian,sidangselalu mengatakan jika terdakwa merasa ada ketua DPRD Binjai. Di antara delapan ama- SedangkanHermanSembiring(PDIP) Secara terpisah,Wakil Ketua DPRD Besar ketiga pelaku membawa korban ke salah satu tempat saja diundurkan dengan alasan tak jelas. penzhaliman, itu hak terdakwa. De- nah rakyat yang disampaikan disebutkan dan Bahman Nasution (Partai De- Binjai terpilih Herman Sembi-ring yang sunyi di kawasan Jalan Bogak Besar ke Desa Nagur. Bahkan, anehnya pada 17 Septem- mikianpuladengantuntutanyanghanya jangan libatkan Sekwan dan jajarannya mokrat) mendampingi sebagaiWakil mengatakan sidang pleno yang Di tempat inilah Azwar dibantai ketiganya dengan menggu- ber 2009, pengacara terdakwa me- 1 tahun dan 6 bulan untuk masing- ke dalam wilayah politik. Sebab sekwan Ketua DPRD Binjai. dilaksanakan pada hari itu sesuai nakan pisau serta menginjak wajah dan leher korban sehingga nyampaikan kepada terdakwa, sidang masing terdakwa, hal itu dilakukan ber- adalah instansi pemerintah sebagai fasi- Jalannya sidang pleno DPRD dengan tuntunan yang diamanahkan remuk dan patah. terpaksa ditunda lagi, karena nomor dasarkan pertimbangan dia semata. litator. Binjai langsung alot dan panas, sesaat Undang-undangNomor27tahun2009 Dalam kondisi sekarat korban dibopong dengan mengen- perkara tidak ada di administrasi PN Fitriani, membantah pula perkara itu 12 Elemen masyarakat minta meka- setelah pimpinan sementara legislatif Pasal 353.”Hasil rapat pleno hari ini, darai sepeda motor dan dibawa kea rah areal Perkebunan Tebingtinggi. tidak punya nomor perkara di PN Te- nisme yang dilakukan Sekwan DPRD Ha- setempat, Erna Kaloko mengetuk kita sampaikan ke Gubsu. Sehingga Kelapa Sawit milik PT Socfindo Kebun Mata Pao. Di tempat Diungkapkan,kasustuduhanpemal- bingtinggi. “Ah masak tak ada. Tapi itu nizar Rawi dalam penetapan Ketua se- palu tanda dibukanya sedang pleno. unsur pimpinan DPRD Binjai dapat itu korban diseret dan ditinggalkan begitu saja. suan dan penggelapan lahan itu tidaklah urusan PN lah,” kilah dia. (a08) mentara DPRD Binjai. Menurut Gito Apalagi saat disampaikan, Partai segera dilantik,”sebutnya.(a03/a04) Kapolres Serdang Bedagai AKBP Drs.Eri Safari yang turun langsung ke Mapolsek Teluk Mengkudu didampingi Kapolsek AKP Robert Simbolon membenarkan motif pembunuhan TBM Pelita Hati T.Tinggi Terima Bantuan Baperasda Sumut akibat dendam lama. ‘’Seorang pelaku lagi masih dalam buronan petugas karena kabur,’’ kata Kapolres. (a07) TEBING TINGGI (Waspada): Ta- untuk TBM. TBM senilai Rp50 juta. Bantuan itu, kata man Bacaan Masyarakat “Pelita Hati” Ketua TBM Pelita Hati Drs Abdul Khalik, diperoleh melalui Bagian Bina Sosial Kel. Deblot Sundoro, Kec. Padang Hilir, Khalik, MAP menyatakan syukur atas , Setprovsu dan telah digunakan sesuai Kota Tebingtinggi mendapat bantuan bantuan 300 eksemplar buku yang dibe- peruntukannya. Dari bantuan itulah, kata ratusan buku bacaan dari Badan Per- rikan Baperasda Sumut, khususnya Khalik, TBM Pelita Hati, memiliki buku pustakaan,ArsipdanDokumentasiDae- pada Kepala Baperasda Sumut Drs H Ensikplopedi Oxford Dunia Islam Mod- rah Sum. Utara. Bantuan itu, langsung Syaiful Syafri. Dikatakan, bantuan itu ern yang harganya mencapai Rp2,5 juta diserahkan,Senin(28/9),olehIndraHadi sangatbesarmanfaatnya,karenaselama untuk 6 jilid. Demikian pula dengan Kesuma Parhimpunan Nasution, ST ini, upaya pengadaan buku-buku serta pengadaansejumlahbukutafsirdiantaranya diwakili stafnya di sekretariat TBM itu. berbagai kegiatan di TBM Pelita Hati Tafsir Quran Syeikh Aid Al Qarni untuk me- Buku bantuan sebanyak 300 eksem- dilakukan melalui swadaya pengelola. ngisi rak buku TBM. “Mungkin cuma TBM plar itu, berdasarkan berita acara penye- Tingkat membaca warga di sini tinggi, ini yang punya ensiklo dan tafsir. Banyak rahan No.481.3/5959/BPAD/2009, ter- setahun belakangan mereka minta pe- masyarakat yang memanfaatkannya,” kata diri dari 78 judul buku. Buku-buku itu ngadaanbukubaru.Jadikamiupayakan Khalik. terdir dari buku agama, sosial, politik, dengan minta bantuan ke sana kemari, Hingga kini, TBM Pelita Hati Kel. Deblot Waspada/Ist Waspada/Eddi Gultom komunikasi, ketrampilan, pertanian, kata Khalik. Sundoro,perharidikunjungisekira30hingga BANTU BUKU : Baperasda Sumut memberikan bantuan buku kepada DIPERIKSA: Kapolres Sergai AKBP Eri Safari didampingi rumah tangga, cerita rakyat serta tek- Diakui pula, untuk 2007 TBM Pelita 50 orang pengunjung .Di Kota Tebingtinggi TBM Pelita Hati Kota Tebing Tinggi, sebanyak 300 eksemplar. Terlihat salah Kapolsek AKP R.Simbolon dan kedua tersangka di Mapolsek nologi. Sedangkan dana bantuan buku HatijugamenerimabantuandariGubsu sendiri, hanya terdapat dua TBM yang dike- seorang staf Baperasda menyerahkan bantuan secara simbolis dan diterima Teluk Mengkudu, Senin (28/9). itu diperoleh dari APBD Provsu TA 2009 untuk pengadaan buku dan kegiatan lola masyarakat. (a08) Sekretaris TBM Alisyah Fitri. Foto direkam, Senin (28/9).
  • 18 Sumatera Utara WASPADA Selasa 29 September 2009 Wakil Ketua DPRD Karo Adil 165 Kasus Judi Terjadi Bangun Meninggal Dunia BERASTAGI (Waspada ) :Wakil Ketua DPRD Karo Adil Bangun, Di Wilayah Polres Asahan Sabtu (26/9) sekira pukul 05:00 meninggal dunia di RSU Elisa- KISARAN (Waspada) : Sedikitnya 165 kasus dan domino, dan selebihnya judi yang tidak beth Medan akibat sakit yang sesak yang dideritanya beberapa judi masih terjadi di wilayah hukum Polres menggunakan kartu” jelas Ginting. bulan terakhir. Asahan. “ Selama Jaunuari-September, kami Oleh sebab itu, lanjut Ginting, Polres Asahan Menurut beberapa keluarga dekat, jenazah Adil disema- mengamankan 165 judi dengan 377 orang ter- akan berusaha terus mengungkap kasus judi yang yamkan di rumah duka Jalan Djamin Ginting gang Harapan sangka,” ujar Kapolres Asahan AKBP Rudy Su- masih marak di wilayah hukumnya, dan tidak Berastagi, sedangkan upacara adat akan dilakukan Selasa (29/ mardiyanto melalui Waka Polres Kompol DH akan memandang siapa pelakunya. 9) di Jamburta Ras Berastagi Ginting didampingi Kabag Binamitra AKP Zul- “ Semua akan kita sikat, siapa saja terlibat Kedatangan jenazah Adil Bangun yang dikawal Pospam fikar kepada Waspada, Senin (28/9). judi,” ujar Ginting. Ginting juga menambahkan, Berastagi hingga sampai ke rumah duka disambut isak tangis Menurut data, kata Ginting, ada peningkatan kenaikan kasus judi ini disebabkan, masyarakat keluarga begitu pula dengan sejumlah kalangan pejabat peme- masih tergiur dengan keuntungan yang bersifat kasus setiap triwulan, pada Januari-Maret sementara, dan tidak memikirkan akibat dari rintahan kabupaten Karo beserta kalangan anggota DPRD, pemuda pertama kita mengamankan 22 kasus namun tindakan mereka itu. dari organisasi dan wartawan datang silih berganti melayat. pada triwulan kedua April-Juni menjadi 54 kasus “ Dengan demikian, kami berharap masyarakat Ketua DPD Partai Golkar Karo Paulus Sitepu kepada wartawan dan bertambah lagi pada triwulan ketiga Juli- lebih cerdas dalam melakukan sesuatu, dan tidak mengungkapkan rasa duka cita yang sedalam-dalamnya karena September sebanyak 89 kasus. terjebak dalam tindakan yang melanggar hukum, merasa kehilangan kader partai yang gigih dalam membangun “ Dari 165 kasus, ada sebanyak 49 kasus togel, meskipun perekonomian kita sulit,” ungkap Karo. (a17) ditambah 110 kasus menggunakan kartu joker Ginting. (csap) TKS Dishub Batubara Pemancing Hilang Di Sungai Tewas Diterjang Kereta Api Asahan Belum Ditemukan Waspada/Sapriadi LIMAPULUH (Waspada) : Mangasi Parsoruan Sitorus,25,warga MEMERIKSA : Kapolres Asahan AKBP Rudy Sumardiyanto didampingi Waka Polres Kompol Batam berpakaian Dinas Perhubungan, Senin (28/9) ditemukan SIMPANGEMPAT,Asahan ( Waspada) : Deni, warga Jalan Kartini Kisaran, mengisi waktu DH Ginting dan Kabag Binamita AKP Zulfikar sedang memeriksa 10 tersangka penjual minyak Pemancing yang hilang akibat perahu ditumpangi luang dengan pergi memancing di Sungai Asahan, tewas ditubruk kereta api di pintu lintasan kereta api tanpa palang CPO tanpa izin intasi terkait, dan juga mengamankan 4 truk dan 3 drum serta 3 drum potong Limapuluh - Simpang Dolok. tenggelam di Sungai Asahan, Desa Sei Dua Hulu, Desa Sei Dua Hulu. Setibanya di lokasi, keduanya berisikan CPO. foto direkam Senin (28/9). Kecamatan Simpang Empat, belum ditemukan. meminta Mutiara Pamungkas, 12, warga setempat, Pagi itu korban dari tempat tinggalnya di Desa Pahang,Kec. Talawi bermaksud ke Limapuluh tempat bekerjanya di Dinas Dan, sampai Senin (28/9) sore, Kapolsek mengantarkan ke seberang sungai dengan meng- Perhubungan Pemkab Batubara. Sesampainya di perlintasan kereta api Limapuluh yang tanpa pintu, sebuah truk akan melintas di atas rel tapi sukarelawan diperlintasan itu berhasil menahannya. Tiba - tiba dari samping 4 Truk Pengangkut CPO Simpang Kawat Resort Asahan AKP Rudy Can- dra,SH bersama personelnya dibantu Tim SAR Kota Tanjungbalai dan Kepala Desa serta masya- rakat setempat, masih mencari korban dengan menyisir sepanjang aliran Sungai Asahan. gunakan perahu kecil. Permintaan itu sempat ditolak Mutiara, sebab perahunya hanya muat untuk satu penumpang. Akan tetapi, karena terus didesak, Mutiara berse- dia mengantar Sugeng dan Deni. Dan, naas, ketika Diamankan Polres Asahan truk itu dua sepeda motor berusaha menerobos. Satu unit berhasil lolos, malang bagi korban yang mengendarai Honda Supra Fit “ Belum ditemukan, kita bersama Tim SAR hendak sampai di tepi seberang sungai, perahu BK 4550 QS, kereta api yang datang dari arah Tanjungbalai menuju dan masyarakat serta keluarganya, masih me- kecil itu oleng dan terbalik hingga akhirnya teng- Medan tanpa basa - basi menghantamnya, hingga sepeda motornya nyisir aliran Sungai Asahan guna mencari kebe- gelam. Mutiara dan Deni berhasil menyelamatkan terseret sampai seratusan meter, sedangkan tubuh korban ter- radaan korban,” ujar Kapolsek Simpang Kawat diri, sedangkan Sugeng dinyatakan hilang dan lempar sejauh 50 meter hingga tewas di tempat . pir) , AH (37) (sopir) warga Desa dan 3 drum potong berisikan kepada Waspada melalui saluran telefon. sampai kemarin belum ditemukan. KISARAN (Waspada) : 4 Sebelumnya, korban, Sugeng Irawan, 38, Kapolres Asahan melalui Kapolsek Simpang Warga setempat langsung mendatangi Tempat Kejadian Perkara Penggalang, Kampung Pon Kab CPO, dan menurut keterangan truk berisikan minyak CPO warga Jalan Malik Ibrahim, Kecamatan Kisaran Kawat AKP Rudy Candra mengatakan, insiden (TKP) sementara itu petugas polantas pos Limapuluh langsung Serdang Bedagai, SY,41, (sopir) para tersangka minyak itu akan melakukan cek TKP dan mengevakuasi jenazah korban ke Puskes- diamankan Polres Asahan, warga Desa Seirampah, serta dijual kembali oleh penadah Barat, Kabupaten Asahan, bersama rekannya ini terjadi akibat perahu over kapasitas. (a37) mas Limapuluh. di Kel Seiputih, tepatnya di AN,19, IS,35, Rusli,52, SS,42, JS,44, insial AZ. Dinas Perhubungan Batubara melalui Plt Sekretaris Zainal Azhar kepada Waspada mengaku tidak mengenal korban. “Saya Simpang Tanahmerah, Kec. Airputih, Kab warga Desa Aras, Kec Air Putih, Kab. Batubara yang diduga kaki “ Sampai saat ini, kami masih melakukan pengembangan Balita Gizi Buruk Di Asahan Dirawat baru dua bulan di sini jadi tidak mengenal dia, kalau statusnya, tangan penadah digiring ke kasus, dan mengungkap siapa bukan PNS dan bukan honorer, pos tugasnya juga tidak diketahui,” Batubara, Senin (28/9) Mapolres Asahan. sebenarnya pemilik CPO dan TANJUNGBALAI (Waspada) : RSUD Tan- Sarifah, sejak lahir, kondisi anaknya tidak sehat. ujar Zainal. “ 4 truk berisikan CPO kami akan dijual kemana,” ujar jungbalai, kembali merawat balita asal Kabupaten “ Sejak lahir sudah kelihatan dia kurang sehat, dan sekira pukul 02:30. Asahan yang mengidap gizi buruk, Senin (28/9). kulit tangannya yang terkelupas ini awalnya bintik- Menurut Zainal, korban telah mengkuti seleksi sebagai tenaga tahan, dan semua tersangka se- Kapolres. honorer tapi hingga saat ini belum ada yang benar-benar lulus dang kami periksa,” ujar Kapol- Kapolres juga menjelaskan, Pasien gizi buruk itu, Lilis Susanti, 3, warga bintik merah dan bengkak,” kata Sarifah. menjadi tenaga honorer, meskipun seluruh pelamar saat ini sudah res Asahan AKBP Rudy Sumar- penangkapan ini berasal dari Dusun Pematang Kandang, Desa Pematang Sei Humas RSUD Tanjungbalai Cosmas Siagian 4 truk diamankan dise- diyanto didampingiWaka Polres informasi warga sekitar, sehing- Baru, Kecamatan Tanjungbalai Asahan, Kabu- menambahkan, meskipun pasien ini warga Kabu- berpakaian seragam Dishub dan sudah bertugas di berbagai babkan tidak melengkapi surat Kompol DH Ginting dan Kabag ga, aktivitas ini dapat digagalkan paten Asahan. paten Asahan, tapi pihak rumah sakit akan beru- pos. (a31) jalan, dan 4 truk dengan no po- Binamita AKP Zulfikar kepada oleh Polres Asahan. “ Ini semua Berat badan anak perempuan itu hanya 5,7 paya maksimal merawat dan mengobatinya hing- lat BK 988 US, BK 9835 LY, Bk sejumlah wartawan, Senin (28/9). atas kerja sama antara masya- kg, atau di bawah berat badan anak 3 tahun me- ga sembuh total. Penanganan terhadap korban, Bantuan Mensos Di Batubara ‘Macet’ 9166 TL dan B 8991 EJ serta me- nahan10 orang inisial RS, 25, (so- Selain itu, ujar Kapolres, pi- rakat sekitar,” ujar Kapolres. nurut standar Departemen Kesehatan. “ Tubuh- nya sangat kurus, lemas dan wajahnya seperti kata Siagian, akan diprioritaskan pada perbaikan gizi terlebih dahulu. Dan, lanjutnya, untuk mem- haknya mengamankan 3 drum (csap) TANJUNGTIRAM (Waspada): Warga kurang mampu yang orang tua. Idealnya, usia 3 tahun berat badan percepat pemulihan Lilis Suryani, pihaknya akan menghuni rumah tak layak huni di Kecamatan Tanjungtiram minimal 14 kg,” kata Direktur RSUD Tanjungbalai memberikan makanan tambahan pengganti ASI dan Talawi, Kabupaten Batubara merasa kecewa janji Mensos memberikan bantuan ternyata sampai, Senin (28/9) belum menjadi Truk Angkutan Kayu Rugikan Warga L.Batu Diah Retno melalui Humas Cosmas Siagian. Selain itu, lanjut Siagian, kulit tubuhnya banyak yang terkelupas dan mengendur. “ Kondisinya dan vitamin lainnya, termasuk mineral mix. “ Kami belum bisa memastikan penyebab gizi buruk anak itu. Gizi buruk bisa akibat anak kenyataan Padahal menurut warga, bantuan Mensos Rp1 miliar untuk RANTAUPRAPAT (Waspa- nya. hak PT RAPP sepertinya tidak cukup parah, sehingga harus dirawat intensif. tidak diberi asupan gizi yang cukup, dan bisa rehab rumah tak layak huni 100 rumah di Kecamatan Tanjungtiram da): Aktivitas pengangkutan Demikian halnya dengan peduli dengan keluhan masya- Dan, sebelum dibawa ke rumah sakit, pasien juga dampak mengidap penyakit yang membuat dan Talawi itu sudah berlangsung sejak dua bulan lalu. “Yang kayu gelondongan yang berasal fisik jembatan di Desa Sei Mam- rakat. PT RAPP hanya memi- ini demam selama 2 minggu,” tambah Siagian. anak enggan makan. Mudah-mudahanlah anak jelas sampai hari ini bantuan Mensos belum kami terima,” sebut dari kawasan hutan Kabupaten bang dan beberapa jembatan kirkan keuntungannya sendiri. Ibukorban,Sarifah,39,mengatakan,LilisSusanti ini bakal sembuh total, karena kita berupa mak- seorang warga di Desa Sukamaju, Tanjungtiram, Senin (28/9). Padanglawas Utara (Paluta) me- lainnya, juga mengalami hal yang Sebab, dengan menggunakan merupakan anak ke 10 dari 11 bersaudara. Menurut simal memulihkan kondisinya,” kata Siagian. (a37) Pendistribusian bahan bangunan untuk rehab rumah tak nuju pelabuhan Tanjung Sarang sama. Padahal, masyarakat jalur ini jauh lebih efisien dan layak huni ditangani Kadis Sosial Batubara yang membuat kebijakan dinilai serba aneh. Untuk memudahkan penyaluran bahan bangunan seharusnya Elang, Kecamatan Panai Hulu, Kab. Labuhanbatu diduga seba- gai penyebab rusaknya jalan dan Negeri Lama dan Ajamu, telah lama merindukan dan menan- tikan infrastruktur jalan darat berisiko rendah jika diban- dingkan melalui jalur Paluta- Kota Pinang via Bagan Batu sam- Ratusan Personel Polresta Tanjungbalai diprioritaskan panglong terdekat dengan rumah warga mendapat bantuan,seperti panglong di Tanjungtiram/Talawi .Yang aneh jembatan sepanjang jalan yang dilintasinya. Demikian siaran pers Direk- yang baik. Effendi menambahkan, kerusakan fisik jalan secara lam- pai ke pabrik PT RAPP di Kerinci (Provinsi Riau). Dengan menggunakan rute Amankan Pelantikan Wakil Rakyat sebut warga bahan bangunan pekayuan pohon kelapa, seng, semen, tepas, batubata, paku, diangkut truk dari Indrapura Airputih tur Eksekutif Lembaga Advokasi bat laun akan berdampak pada jalur air dari Negeri Lama, ong- TANJUNGBALAI (Waspada) : Sedikitnya 153 Kompol Agustinus Tarigan dan penanggung jawab Kepala Desa Sukamaju Kusrin, Senin (28/9) mengatakan bahan dan Kebijakan (Elsaka) Effendi roda perekonomian daerah kos transportasi lebih rendah. personel dari jajaran Polresta Tanjungbalai, akan AKP Jon Rinaldi Purba serta penanggung jawab bangunan bantuan Mensos belum juga sampai dan tidak jelas Panjaitan yang diterima warta- tersebut khusunya warga sekitar. Karena jalan lebih sepi, kutipan mengamankan pelantikan anggota DPRD terbuka Kasat Samapta AKP Zul Efendi,” kata penyebabnya. Begitu juga Kades Petatal Talawi,Sarwoto mengaku wan, Senin (28/9) setelah mela- Hal ini sangat merugikan ma- liar dan kutipan resmi relatif se- setempat di gedung dewan, Selasa (29/9). Sirait. dapat bantuan Mensos untuk 16 orang warga ternyata belum kukan penelusuran atas jalur syarakat setempat, Terutama dikit karena pos-pos kutipan Ratusan personel itu, terdiri dari 11 Satuan Unjuk Rasa juga menerima bahan bagunan. (a30) yang dilalui pengangkutan kayu para petani sawit yang akan jalan raya juga sedikit yang dilalui Reskrim, 10 Satuan Intelkam, 5 Satuan Narkoba, Perwira Humas AKP Lukman Sirait juga itu. menjual buah sawitnya ke dan juga jarak tempuhnya lebih 34 Satuan Samapta, 8 Satuan Pol Air, 15 Satuan menambahkan, diperkirakan pelantikan anggota Menurutnya, ditengarai se- pabrik. pendek. “Tapi sebaliknya pihak Lantas, 5 Satuan P3D dan 40 personel lainnya DPRD Tanjungbalai akan diwarnai unjuk rasa Warga Sergai Yang Hilang tiap harinya sebanyak 250 sam- “Harga sawit petani akan PT RAPP tidak memperdulikan berasal dari 5 Polsekta di wilayah Polres Tanjung- balai. puluhan mahasiswa. “ Surat pemberitahuannya sudah disampaikan mereka ke Polres Tanjung- pai 300 truk dengan muatan 25 anjlok, sebab cost transportasi kerugian yang dialami oleh ma- Di Batubara Belum Ditemukan ton melintasi jalan raya yang yang tinggi dang turunnya ren- syarakat,” tambahnya. Demikian Kapolres Tanjungbalai AKBP Mes- tron Siboro melalui Perwira Humas AKP Lukman balai,” ujar Sirait. Dijelaskan Sirait, dalam surat pemberitahuan relatif sempit dan berdaya tahan demen minyak sawit akibat Oleh karena itu, Pemprovsu LIMAPULUH(Waspada): Suriyadi,39, warga Dusun lima, Desa rendah, khususnya jalan Aek kelamaan di jalan yang rusak harus menertibkan truk-truk Sirait kepada Waspada Senin (28/9). “ Kami sudah itu, saat aksi nanti mahasiswa akan meminta dan Penggalangan, Kec. Tebing Syahbandar, Kab.Serdang Bedagai yang Nabara (Kec. Bilah Hulu) - Ne- “ ujarnya. pengangkut kayu balok (log) mengecek langsung persiapan personel dalam mendesak wakil rakyat Tanjungbalai yang telah dikabarkan hilang sejak Kamis (24/9) sekira pukul 17:00 di sekitar mengamankan pelantikan anggota DPRD besok, dilantik untuk menandatangani kontrak politik geri Lama (Kec. Bilah Hilir) – Ironisnya, tambah mantan yang melintasi jalur itu. “Jikalau kawasan perkebunan PT Socfindo perkebunan Tanah Gambus dan kordinatornya juga sudah diangkat, yakni 5 tahun ke depan. (a37) Ajamu (Kec. Panai Hulu). DirekturWALHI Sumut ini, kon- dibiarkan kerusakan jalan dan tepatnya 200 meter dari Desa Simpang Gambus, Kec. Limapuluh, Jalan Lintas Sumatera se- disi itu sudah berlangsung ham- jembatan akan hancur yang ten- Batubara, sampai saat ini belum ditemukan. (Waspada, 27/9). Menurut istri korban Ika Amriani ,31, senin (28/9) saat mem- berikan keterangan selanjutnya di Mapolsek Limapuluh, korban panjang 60 km yang dibangun tahun 2008 dengan sumber pir 3 tahun. Namun, terindikasi pihak terkait sama sekali tidak tunya akan menambah beban negara,” paparnya. Polresta Tanjungbalai Akan Tuntaskan berangkat dari rumahnya dengan tujuan hendak menyusul dirinya ke Tanjungtiram, Batubara dengan mengenderai sepeda motor dana dari APBN berbiaya Rp 120 milyar itu kini mulai rusak. Jembatan panjang yang terletak peduli. Sepertinya pemerintah membiarkannya dan pura-pura tidak tahu,” kata dia. Di lain pihak, dia meminta PT RAPP agar segera meng- hentikan aktivitasnya atau atau Kasus Penganiayaan Wartawan miliknya Yamaha Mio Soul BK 6936 SN. di Negeri Lama yang baru sele- Beberapa kelompok ma- mencari jalan keluar agar ma- Selanjutnya menurut Ika, hari keberangkatan korban dari TANJUNGBALAI (Waspada) : Kapolres Tan- Tanjungbalai Safaruddin,Tedy Erwin dan tersangka sai dikerjakan 8 tahun lalu, harus syarakat memang pernah syarakat tidak dirugikan,” tan- jungbalai AKBP Mestron Siboro menegaskan, akan BudiMulia,masihmenungguizintertulisdariGubsu Desa Penggalangan, dirinya sempat menghubungi suaminya diganti semua lantai dan besi- mempersoalkanya. Tetapi, pi- dasnya. (a27) melalui HP sekira pukul 18:30 dan dijawab oleh korban masih menuntaskan kasus penganiayaan yang diduga untuk dilakukan pemeriksaan. Surat permintaan dalam perjalanan,namun setelah ditunggu-tunggu korban tak dilakukan oknum wakil rakyat terhadap salah satu itu telah dikirimkan ke Gubsuj melalui Dir Reskrim kunjung sampai, akhirnya sekira pukul 20:00 Ika kembali meng- hubungi, namun HP korban tidak aktif lagi. Siswa SD Hadiahi Kejari wartawan media cetak di kota itu. “ Kami akan tetap memproses masalah ini sampai ke Kejaksaan,” tegas Kapolres melalui Polda Sumut,” jelas Sirait. Sebelumnya, selain organisasi jurnalis, sejumlah Lembaga Swadaya Masyarakat juga mendesak Kapolsek Limapuluh AKP TP Butar Butar, SH, ketika dikon- firmasi mengaku ada menemukan Satu buah sepeda motor Yama- ha Mark Mio Soul BK 6936 SN dan sebuah helm serta bungkusan Sidikalang Parsel “Obat Kuat” Perwira Humas AKP Lukman Sirait kepada Was- pada, Senin (28/9). jajaranKepolisianmenangkapdanmenahanoknum anggota DPRD Tanjungbalai yang diduga menga- berisi ayam yang sudah dipotong. Setelah olah TKP barang bukti , PenganiayaanituterjadiseusaiparipurnaDPRD niaya wartawan. berupa sepeda motor dan helm diamankan di Mapolsek Limapuluh. SIDIKALANG ( Waspa- dari angka global. Di sisi lain, wartawan, dia tidak bersedia Tanjungbalai, Rabu (16/9) lalu. Korban, Syamsul Pernyataan itu ditegaskan pimpinan LSM Inde- TP Butar Butar mengimbau kepada masyarakat yang melihat da):Kejari (Kejaksaan Negeri) Roder mengatakan, pemberian memberi keterangan lebih Darma Sirait, mendapat pukulan dari oknum penden Solidaritas Anak Negeri (Insani) Ahmad keberadaan korban dapat menghubungi handphone 08137619- Sidikalang Kabupaten Dairi “ucapan terima kasih” dari ke- lanjut mengingat dirinya adalah anggota DPRD itu di bagian wajah seba-nyak 3 Efendi Sibarani dan LSM Sumatera Goverment 60001. (a31) dihadiahi parsel berisi sejumlah pala sekolah kepada pengelola orang baru di institusi ini. kali, hingga tersungkur. Wacht Zulham Effendi kepada Waspada, Minggu obat kuat khusus pria. dinas pendidikan bernilai Rp Beberapa bulan lalu, Kajari Tidak itu saja, meskipun sudah tak berdaya, (27/9). Kedua pimpinan LSM itu, juga telah mela- Penyerahan dilakukan dua 100 ribu merupakan lingkaran Sidikalang, Saut Simanjuntak korban masih terus diburu dan wajahnya diten- yangkan surat perihal pengusutan dan penahanan 1 Calih Asal PG Dilantik Ketua siswa SD didampingi para teman setan yang mesti diputus. Tidak SH pernah mendampingi Gor- dang oleh wakil rakyat berasal dari partai berlam- oknum anggota DPRD Tanjungbalai,BM, kepada sekolah mengenakan seragam boleh terjadi praktik sedemikian tap Marbun SH (kala itu Kejatisu- bang Banteng tersebut. Akibat pemukulan itu, Kapolda Sumut dan Kapolres Tanjungbalai. Sementara DPRD P.Siantar diterima Dayan Rally Pasaribu, dimana diyakini sumber keua- red) guna meninjau beberapa korban mengalami luka di bibir, dan bagian wajah “ Kami melayangkan surat ke Kapolda Sumut SH Kepala Seksi Peradilan dan ngannya tetap saja dari kegiatan proyek didanai DAK. Namun, lainnya, serta luka memar di bagian kaki kiri. Selain yang intinya meminta agar kasus penganiayan itu PEMATANGSIANTAR (Waspada): Satu calon anggota legislatif TataUsahaNegaradipintumasuk sekolah. Tanpa laporan pun ko- akhir pemeriksaan itu tampak itu, menurut korban, dia mengalami rasa sakit diusut dan pelakunya ditahan, mengingat sampai terpilih (Calih) asal Partai Golkar (PG) Hj. Nurasiah Lubis yang kantor tersebut, Senin (29/9). rupsi harus diusut sebab kasus kabur. Padahal, di beberapa SD di bagian rahang, kepala pusing dan trauma. saat ini diduga belum ada proses hukum terhadap tidak turut diambil sumpah/janji dan dilantik menjadi anggota Kemasan itu kemudian dile- itu bukan delik aduan, karena- di Kecamatan Sumbul dan Sidi- Siraitmelanjutkan,dalamperkarapenganiayaan pelakunya,” kata Zulham Efendi. DPRD Kota Pematangsiantar periode 2009-2014 bersamaan dengan itu, pihak penyidik telah memanggil saksi-saksi Hal sama dikatakan Ahmad Efendi Sibarani. takkan di meja piket dan menja- nya dituntut nurani dan kejelian kalang , jaksa jelas-jelas telah 29 Calih lainnya pada Senin (31/9)akhirnya dilantik Ketua sementara antara lain Syamsul Darma Sirait. Selain itu, tambah Menurutnya, sampai saat ini, dia melihat oknum di tontotan pegawai di sana . jaksa. mencatat poin-poin dugaan pe- DPRD. Sirait, surat pemanggilan kepada saksi Abdi Nusa anggota DPRD dari partai berlambang Banteng itu, masih Pengambilan sumpah dan pelantikan itu dilaksanakan Ketua Masing-masing mereka mem- Dayan Rally merespon posi- nyelewengan sesuai fakta lapa- pelototi isi bungkusan indah itu. tif kedatangan warga sebagai ngan. Tak heran, kepala sekolah selaku Sekretaris DPRD Tanjungbalai juga telah berkeliaran,padahalpenyidiktelahmemilikibuktipermulaan sementara DPRD Marulitua Hutapea, SE disaksikan Wakil Ketua dilayangkan. yangcukup,yaknilaporankorbanditambahdengansalahsatu sementara Hotman M Lingga, SH dan 27 anggota DPRD lainnya Roder Nababan SH Direktur untuk memberi dorongan ke- pun gugup menghadapi cerca- Eksekutif LBH (Lembaga Ban- pada penegak hukum. Kepada an juru periksa itu. (a28) “ Proses penyidikan ini sedikit terhambat karena BeritaAcaraPemeriksaandanhasilvisumRSUDTanjungbalai. dalam rapat paripurna istimewa di ruang sidang DPRD Pematang- pemanggilansaksilainnyayakniparaanggotaDPRD (a37) siantar, Senin (28/9).ksanakannya pengambilan sumpah/janji tuan Hukum) Sekolah selaku anggota DPRD periode 2009-2014, masa bhakti DPRD periode penanggung jawab delegasi me- 2004-2009 berakhir.(a14) ngatakan, langkah itu ditempuh guna memberi semangat kepa- Mahasiswa Padanglawas Datangi Kapolsek Perbaungan Sita Miras da kejaksaan agar lebih gigih Pedagang Pantai Kelang memberantas praktik korupsi khususnya yang membelenggu Kantor Bupati Dinas Pendidikan. SIBUHUAN ( Waspada): Sebanyak 20 Kemudian meminta agar pemda menindak tegas PERBAUNGAN(Waspada): Kapolsek Perbaungan AKP Syahril. Menurutnya, banyak du- mahasiswa mengatasnamakan petisi peru-bahan perusahaan yang tidak peduli dan patuh CSR SH melakukan penertiban minuman keras (miras) terhadap gaan penyelewengan keuangan Front Perjuangan Mahasiswa (FPM) Padanglawas, (corporate social responsibility), menuntut tran- pedagang di Pantai Kelang yang berada di Desa Nagalawan, negara tetapi tak kunjung diusut Senin (28/9), mendatangi kantor bupati sparansi pengangkatan honor daerah. Mereka Kecamatan Perbaungan,Kabupaten Serdang Bedagai, Jumat secara serius. Akibatnya, kebo- setempat. menuding APBD 2009 banyak melang-gar undang- (25/9). coran anggaran tetap tinggi se- Dalam orasi, pimpinan aksi Ansor Harahap undang pengelolaan keuangan daerah. “Kepada para pedagang yang ada di objek wisata Pantai Kelang dang beban orang tua tetap saja menyatakan mereka menolak kepemimpinan Meminta bupati agar profesional dan sesuai dan sekitarnya Kapolsek mengatakan agar tidak melakukan berat. Pendidikan gratis pun kian statis dan tanpa visi. dengan mekanisme baperjakat dalam melakukan tindakan yang melanggar hukum seperti, bermain judi, menjual jauh dari realita. Dalam selebaran subpetisi yang dibagikan mutasi. minuman keras dan sebagainya. Hal itu untuk menghindari Dana APBN berupa DAK kepada warga, mereka membacakan prioritas- Orasi yang disertai dengan penunjukan poster terjadinya situasi yang tidak aman dan kondusif. “ jelas Syahril (Dana Alokasi Khusus) dan BOS kan perbaikan infrastruktur (jalan listrik), pe- dan spanduk di antaranya bertuliskan guru yang kepada pedagang yang berada di lokasi itu. (Bantuan Operasional Sekolah) ningkatan pendapatan rakyat, hentikan illegal menduduki jabatan struktural dikembalikan, Sebelumnya Polsek Perbaungan telah mengimbau para yang dialokasikan pemerintah Waspada/ Natar Manalu logging di Desa Sayur Matua Kec.Barumun, berakhir setelah Bupati Padanglawas Basyrah pedagang dan pengunjung agar tidak menjual dan meng-gunakan diduga disunat. Konsekwen- KORUPSI PENDIDIKAN: Beberapa siswa SD sedang berdiri Batang Lubu Sutam, Desa Pagaran Bira, Lubis menerima para mahasiswa. minuman keras. Hal itu untuk menciptakan situasi dan kondisi sinya, siswa tetap saja membeli di depan gedung Kejari Sidikalang Kabupaten Dairi sembari Kec.Sosopan), pendidikan dan kesehatan yang Dalam pertemuan tersebut, bupati menya- yang aman, nyaman dan kondusif mengingat lokasi itu merupakan buku bacaan. Kalaupun ada di- menggantungan aspirasi, menuntut penuntasan dugaan korupsi murah serta agar pemda segera merealisasikan takan siap dikritik sebagai bahan masukan untuk objek wisata yang ramai dikunjungi turis domestik. (a07) bagi, totalitasnya masih jauh anggaran pendidikan, Senin (29/9). perda tata ruang yang strategis dan visioner. mengevaluasi kinerja pemerintahan. (crif)
  • WASPADA Selasa 29 September 2009 Sumatera Utara 19 Waspada/Hasuna Damanik SIAP MAJU KEMBALI: HT Zulkarnain Damanik saat menyampaikan pernyataan kesiapan untuk maju kembali menjadi Bupati Simalungun periode 2010-2015 dihadapan para pengurus ormas Islam dan ribuan warga pada acara halal bi halal Idul Fitri 1430 H di lapangan stadion Radjamin Purba, jalan Sang Naualuh Damanik, Senin (28/9). (Waspada/Hasuna Damanik) HT Zulkarnain Damanik Nyatakan Siap Maju Pilkada 2010 SIMALUNGUN (Waspada): Damanik. 2015. hasilan HT Zulkarnain Damanik Bupati Simalungun, HT Zul- Setelah menyampaikan Dalam pernyataan itu dije- membangun silaturrahmi karnain Damanik, menyatakan pernyataan kesiapannya untuk laskan bahwa dukungan itu sebagai media komunikasi un- siap maju kembali pada pemi- maju kembali, HT Zulkarnain diberikan karena HT Zulkarnain tuk mempererat dan memper- lihan kepala daerah (bupati) Damanik, juga menyampaikan Damanik memiliki komitmen satukan umat sehingga situasi Simalungun periode 2010-2015. permohonan maafnya kepada mengembangkan dan mem- dan kondisi ketertiban dan Pernyataan itu langsung di- seluruh masyarakat Kab Sima- bangun daerah Simalungun ke- keamanan di Kab. Simalungun kemukakan HT Zulkarnain Da- lungun, dimana selama 4 tahun arah yang lebih baik. Kemudian, tetap dalam keadaan kondusif. manik, dihadapan ribuan umat memimpin pasti banyak yang Zulkarnain juga dinilai berhasil Sementara, acara halal bi Islam dan masyarakat Kab. Si- belum dapat dilaksanakan di- menyelenggarakan pemerin- halal berlangsung meriah, diha- malungun pada acara halal bi samping keberhasilan yang telah tahan dan ini telah teruji pada diri ribuan umat Islam dan ma- halal antara Pemkab, Muspida, dicapai. Dia berjanji pada hari- periode 2009-2010. syarakat Kab.Simalungun. Tam- ormas Islam, OKP dan masya- hari mendatang akan lebih “ HT Zulkarnain Damanik pil sebagai mubaligh Ustadz Jefri kat yang digelar, Senin (28/9), bekerja keras bersama seluruh memiliki kompetensi kepemim- Al Bukhori dari Jakarta. di Stadion Radjamin Purba Jalan staf agar seluruh program yang pinan, memiliki jiwa kepemim- Ustadz Jefri dalam tausyiah- Sang Naualuh Damanik, Kec. telah direncanakan dapat ter- pinan yang dapat dijadikan suri nya menyampaikan agar umat Siantar. wujudsebagaimanadiharap-kan. tauladan bagi segenap ma- Islam di Kab. Simalungun dapat Dikatakan, kesiapannya Dukungan syarakat Kabupaten Simalu- mengaplikasikan kegiatan dan untuk maju kembali menjadi Sebelumnya, sejumlah pe- ngun,” tegas Ki Dardjat Purba amalan selama bulan Rama- Bupati Simalungun untuk kedua ngurus Organisasi Kemasyara- saat membacakan isi pernya- dhan dalam kehidupan sehari- kalinya sebagai menyahuti katan (Ormas) Islam Kab. Sima- taan dukungan. hari. Dia juga mengharapkan harapan dan keinginan masya- lungun dipandu Drs Ki Dardjat Selain itu, lanjutnya lagi, HT agar umat tetap bersatu, men- rakat. “ Berkat semangat dan Purba, Sanusi Damanik, H Rivai Zulkarnain Damanik juga dinilai jaga hati agar terhindar dari hawa dan dukungan umat, saya ber- Damanik, Hj Siti Aminah, Wah- telah berhasil mewujudkan nafsu yang tidak terkontrol. janji untuk bekerja sekuat tena- yudi Hardianto dan Syirwan masyarakat Kab. Simalungun Sebelumnya, ketua panitia ga. Insya Allah saya akan maju Hazli Nasution mendekla- yang berpengetahuan dan ber- H Evra Sassky Damanik, S.Sos, untuk melanjutkan pemba- rasikan dukungan kepada HT pendidikan di samping keber- melaporkan kegiatan halal bi ngunan di ‘tanoh habonaron Zulkarnain Damanik untuk di- hasilan dalam meningkatkan halal diikuti warga dari 31 keca- do bona’ bersama-sama ma- calonkan kembali menjadi bu- produksi dan kualitas pertanian matan se-Kab Simalungun. Ha- syarakat,” tegas Zulkarnain pati Simalungun periode 2010- di daeranya. Kemudian, keber- lal bi halal diselenggarakan ma- syarakat, pemerintah, ormas Penyerahan Sertifikat Warnai dan OKP bertujuan menjalin silaturahmi dan sekaligus seba- gai merayakan Idul Fitri 1430 Peringatan HAN Di BPN Simalungun H. (a15) PEMATANGSIANTAR Zulkarnaen Damanik, MM di- lima warga Nagori Naga Jaya (Waspada): Penyerahan serti- wakili Asisten I Drs Oberlin Hu- I dan lima warga Nagori Sidotani, fikat Program Nasional (Prona) tagaol, mewakili Kakan Depag, Kecamatan Dolok Batunanggar. dan Wakaf tahun 2009 kepada Notaris/PPAT Esterdina Sinaga, Sedang sertifikat Wakaf, lanjut para pemohon dari beberapa SH dan Irvo Melika Lum-banto- Damanik, diserahkan sebanyak desa mewarnai peringatan Hari bing, SH, para penerima sertifi- 19 sertifikat dan tersebar di be- Agraria Nasional (HAN) ke-49 kat, para Kasi, Kasubsi dan pe- berapa nagori/kelurahan. yang berlangsung secara se- gawai BPN serta ibu-ibu Dhar- Menjawab pertanyaan, Ka- derhana di Kantor BPN Kabu- ma Wanita. kan BPN yang baru dua bulan paten Simalungun, Senin (28/9). Peringatan diisi dengan pindah dari Kantor BPN Ban- “Sertifikat tanah masyarakat pembacaan Pancasila dilaku- dung ke Simalungun itu menye- tidak hanya sekedar sertifikat, kan Kakan BPN, pembacaan butkan kuota sertifikat Prona tapi diharapkan bisa sebagai Pembukaan UUD 1945 dan Pan- tahun 2009 di Simalungun me- modal guna meningkatkan pen- ca Prasetya Korpri dilakukan ngalami peningkatan kuota dari dapatan dan kesejahteraan ma- dua pegawai, pembacaan sam- 560 bidang tahun 2008 menjadi syarakat,” sebut Kakan BPN Si- butan Kepala BPN RI Joyo Wi- 1.000 bidang dan sudah terea- malungun Henri P Sibarani noto, PhD dilakukan Kakan lisasi atau diterbitkan sertifikat- didampingi Kasi Hak Tanah dan BPN, penyerahan sertifikat se- nya sebanyak 143 sertifikat serta Pendaftaran Tanah Paulus Da- cara simbolis dan ditutup de- sebagian besar lagi sudah masuk manik dan Kasi Pengendalian ngan doa. Peringatan turut diisi permohonannya dan masih Yandi Kusuma di ruang kerja Ka- ramah tamah dan makan bersa- dalam proses penserti-fika- kan BPN usai peringatan HAN ma keluarga besar BPN Sima- tannya. “Pada Desember 2009 di halaman Kantor BPN se- lungun dan penerima sertifikat. seluruhnya akan diterbitkan.” tempat, Senin (28/9). Paulus Damanik menye- Sedang kuota sertifikat Bertindak sebagai Pembina butkan sertifikat Prona yang di- Program Pembaharuan Agraria Upacara Kakan BPN dan Ko- serahkan sebanyak 15 sertifikat Nasional (PPAN), lanjut Kakan mandan Upacara Dj. Situmo- masing-masing kepada lima BPN, mengalami penyesuaian rang saat peringatan yang diha- orang warga dari Nagori Perda- dari 6.100 bidang tahun 2008 diri Bupati Simalungun Drs HT gangan II, Kecamatan Bandar, menjadi 4.500 bidang tahun 2009 serta sampai saat ini seluruhnya masih dalam proses dan akan BSMS Santuni Anak Yatim Piatu dituntaskan sebelum akhir tahun 2009. “Sertifikat PPAN itu SERBELAWAN (Waspada): Sekelompok orang muda yang khususnya bagi tanah pertanian bergabung dalam Badan Sosial Masyarakat Serbelawan (BSMS) dan diharapkan para petani Kelurahan Serbelawan, Kecamatan Dolok Batunanggar, Kabupaten kelak dapat memanfaatkan Simalungun berbagi kebahagiaan dengan yatim piatu. Pelaksanaan sertifikat itu menambah mo- acara santunan itu diberikan usai shalat Idul Fitri 1430 H, Minggu dal dan meningkatkan kesejah- (20/9) pagi. teraan mereka.” Sekretaris BSMS, Maharuddin Saragih kepada Waspada Mengenai permohonan menyatakan, kegiatan telah terprogram sejak berdiri tahun 1973. sertifikat rutin yang diterbitkan Pengurus BSMS selalu didatangi para donatur yang untuk Kantor BPN itu, menurut Paulus berinfak. Lebaran itu saja terkumpul 90 orang putra-putri yang Damanik, rata-rata 500 bidang diberikan santunan kepada mereka paket amplop berisi uang setiap tahunnya, sedang tanah tunai sekitar Rp 40.000 per orang. (c03) bersertifikat di Simalungun sesuai data yang ada masih mencapai 40 persen. “Inilah Pengunjung Kawasan Wisata Padat yang dikejar agar status tanah bisa menjadi akses permo- SIMALUNGUN (Waspada): Perayaan Idul Fitri 1430 H tahun dalan.” ini, kawasan wisata Hutan Taman Monyet Bahlonggur dan kolam Kakan BPN menyebutkan renang Bahapal Nagori Nagajaya Kecamatan Bandar Huluan, salah satu cara yang ditempuh Kabupaten Simalungun, ramai dikunjungi. BPN saat ini secara nasional me- Pantauan Waspada, Senin (21/9) walaupun Hutan Taman ningkatkan pelayanan kepada Monyet Bahlonggur yang terletak di komplek mesin pompa air masyarakat itu dengan sistem PTPN 4 unit Kebun Laras Nagori Nagajaya I, jalannya penuh jemput bola melalui Larasita lubang, namun para pengunjung tak mempedulikannya. (Kantor BPN bergerak). “Para Menurut Salimin, 30, pengunjung asal Desa Gondang Rejo, petugas BPN akan turun ke kehadiran di sana khusus melihat anak-anaknya bermain dengan desa-desa melakukan sosialisasi monyet Bahlonggur (HTMB). (c03) dan melaksanakan proses pen- sertifikatan hingga sertifikat di- terbitkan serta diserahkan lang- Kamtibmas Polsek Serbelawan Terkendali sung kepada masyarakat tanpa harus datang ke Kantor BPN.” SERBELAWAN ( Waspada): Keamanan dan ketertiban Desa/kelurahan sasaran Masyarakat (Kamtibamas) di jajaran Kepolisian Sektor Serbalawan Larasita tahun 2009, lanjut Ka- Kecamatan Dolok Batu Nanggar aman terkendali hingga Rabu kan BPN, terdiri Nagori Silau (23/9). Malela, Nagori Silulu, Nagori Kapolres Simalungun AKBP Rudi Hartono melalui Kapolsek Dolok Malela dan Bandar Male- Serbelawan AKP Edison Siagian yang dikonfirmasi mengakui la, Kecamatan Gunung Mali- suasana lebaran aman terkendali. (c03) gas.(a14)
  • 20 Sumatera Utara WASPADA Selasa 29 September 2009 Bupati Madina: Curah Hujan Dan Kemiringan Wilayah Penyebab Utama Banjir MEDAN (Waspada): Banjir silaturahmi dengan pejabat di logging itu tidak mungkin, cuma terulang,’’ tegasnya. Bupati Madina itu menyebutkan Kalau tempat sudah kita dapat- nakan,’’ demikian Amru Daulay. bandang dan longsor yang ter- lingkungan Pemprovsu, Jumat dari kelongsoran itu, ini akan Terkait waktu rekonstruksi, mungkin makan waktu 6 bulan.’’ kan, maka akan segera dilaksa- (m10) jadi Kecamatan Muara Batang- (25/9) di rumah dinas Gubernur, gadis pada 5 September lalu Jalan Sudirman, Medan. disebabkan curah hujan dan Untuk menyelidiki hal itu kemiringan yang berada di wila- kata Gubsu, pihaknya sudah yah itu. berkoordinasi dengan Kepoli- Demikian diungkapkan Bu- sian Daerah Sumutera Utara pati Mandailing Natal, H Amru dan meminta Pemkab Madina Daulay kepada Waspada di Me- melakukan koordinasi kepada dan kemarin. ‘’Jadi sebenarnya Pemprovsu. yang terjadi di banjir bandang “Kita sama-sama tahu, bajir 5 September yang lalu itu adanya bandang yang terjadi beberapa curah hujan yang tinggi yang waktu lalu di Madina membawa terjadi tiga hari tiga malam di banyak balok-balok kayu. Balok- daerah Taman Nasional Batang- dan lainnya itu itu ketinggiannya balok tersebut kemungkinan gadis dan berbatasan dengan hanya 40 meter dari permukaan adalah hasil pembalakan liar kawasan eks lahan HPH PT Aek laut. Jadi karena hujan yang terus yang belum terangkut,” ujar Gadis Timber. Aek Gadis Timber menerus membuat pohon-po- Gubsu kala itu. iniadalahHPHyangsudahdicabut hon yang berada di kemiringan Menurut Amru Daulay lagi, pemerintah kira-kira 12 tahun,’’ tercabut dan kemudian terbawa Menteri Kehutanan MS Kaban ungkap Amru Daulay (foto). di aliran sungai sudah mengitari kawasan banjir Berdasarkan pemantauan ‘’Tingkat kemiringan sekira bandang dan menyatakan tidak dari udara dapat disaksikan pe- 80 sampai 90 derajat. Ada po- ada illegal logging di sana. Bah- nyebab banjir ini akibat tim- hon tapi sudah tidak kuat lagi, kan menteri memuji sikap yang bunan-timbunan potongan ka- akarnya sudah lemah, jadi kalau diambil Pemkab Madina terkait yu gelondongan di hulu sungai curah hujan tinggi terus hal ini keberadaan Taman Hutan Na- perbatasanTapanuli Selatan dan akan terjadi lagi. Jadi sekarang sional Muara Batanggadis. Mandailing Natal yang me- penduduk yang kita ungsikan ‘’Jadi pohon yang disitu (hu- rupakan peninggalan HPH PT yang ada 2000 KK lebih itu harus tan) tidak ada yang ada ikut de- Aek Gadis Timber dengan luas kita pindah ke daerah yang ting- ngan akarnya kalaupun ada lebih kurang 90.000 ha. Sebagian gi. Saya sudah minta kepada di- satu, dua yang berasal dari Aek lokasinya berada di Tapanuli Se- nas PU untuk mengukur berapa Simber itu yang sudah puluhan latandansebagianlainnyaberada ketinggian dari sungai karena tahun yang masuk kepada 3 su- di Kabupaten Mandailing Natal. semalam itu sungai meluap ngai di bawah yaitu Sungai Ba- Selain itu juga, Amru menye- sampai 4 meter jadi harus dicari tang Gadis, sungai Gapak dan butkan kondisi struktur tanah yang lebih tinggi,’’ urainya. Sugai Palampungan, jadi ketiga yang ada diTaman Nasional ada Sebelumnya Gubsu Syam- sungai ini masuk ke Desa Rantau bagian konstruksi tanah yang sul Arifin, SE yakin, banjir ban- Panjang dan lainnya dengan cu- rapuh. Akibat dari konstruksi dang yang terjadi di Labupaten rah hujan yang tinggi sampai tanah yang kemiringannya sa- Madina akibat adanya illegal banjir bandang. Jadi setelah ini ngat curam dan ditambah logging (pembalakan liar) dan terjadi kala kita lihat yang long- dengan ketinggian 1.300 meter pengalihfungsian hutan menjadi sor itu bukan satu titik tapi ratu- di atas permukaan laut padahal perkebunan. san titik bahkan ribuan titik itu desa yang di bawah ini 4 desa Hal itu dikatakan Gubsu ke- memang kondisi alam jadi kalau lainya itu seperti Rantau Panjang pada wartawan usai melakukan yang di bilang di sana ada illegal Waspada/Sukri Falah Harahap KONDISI DESA: Ribuan batang kayu yang hanyut dibawa banjir bandang dari Sungai Lubuk Siapar berserakan di Desa Lubuk Siapar pasca banjir. Foto direkam, Rabu (23/9).
  • WASPADA Selasa 29 September 2009 Sumatera Utara 21 Pimpinan SKPD Dan PNS Diingatkan cam itu juga sangat tidak mem- punyai etika. “Kita tentu tak boleh menu- duh. Tapi ini pasti bisa dirasa- kan. Makanya kita ingin suasa- nanya tenang dulu. Politik pijak kaki tentu harus ditinggalkan,” kata Aulia lagi. (m10) Netral Hadapi Pilkada MEDAN (Waspada): Lem- Madina. Tidak zamannya lagi Ketika ditanya SKPD mana disi politik di Madina kini sema- baga Independen Pemantau giring-menggiring. PNS harus saja yang sudah dilaporkan me- kin menghangat jelang pilkada. Pilkada Kabupaten Mandailing netral menghadapi Pilkada Ma- lakukan penggalangan untuk Dikatakan Aulia, semua pihak Natal (Madina) meminta para dina,” kata Ketua FKP Madina, mendukung kandidat bupati disana harus tetap tenang hingga pimpinan SKPD dan pegawai Yusuf Hasibuan kepada war- Madina, Yusuf enggan menye- pencalonan bakal calon bupati negeri sipil (PNS) di kabupaten tawan di Medan, Senin (28/9). butkannya. Menurutnya, la- Madina dilaksanakan KPU. itu bersikap netral menghadapi Yusuf yang merupakan poran dari masyarakat Madina “Kita pahami bahwa kon- pilkada yang akan digelar tahun putra Madina menjelaskan, yang dikirim ke kantor FKP Ma- disinya memanas. Ini memang 2010 mendatang. sesuai PP No 30 tahun 1980 bah- dina di Medan sudah ditelusuri menarik, jika dibanding dengan Pasalnya, Lembaga peman- wa PNS diwajibkan untuk bersi- kebenarannya. kabupaten atau kota yang juga tau Pilkada Madina yang diben- kap netral. Dia juga mengatakan “Kitasudahmengirimkantim akan menggelar pilkada, Ma- tuk Forum Kajian Pembangu- jika ada PNS di Madina yang ke Madina untuk mengecek dina sangat unik. Kondisi politik nan (FKP) Madina mendapat- ikut-ikutan menjadi pendukung kebenaran hal itu. Makanya kita disana sangat dinamis. Ini patut kan banyak informasi, adanya salah satu kandidat bupati Ma- memberikan semacam warning diapresiasi,” kata Aulia. upaya dari pimpinan SKPD di dina, hal itu sudah merendah- bagimereka.Kitainginmerekatak Lebih lanjut Aulia mengha- Madina menggiring PNS untuk kan harkat dan martabat PNS. meneruskannya,”tukasYusuflagi. rapkan “politik birokrat” dengan mendukung salah satu kandidat “Inibukansajamelanggaratur- Sementara itu pengamat cara-cara menggiring duku- bupati Madina. antapijugamelecehkannetralitas ko-munikasi politik dari Uni- ngan dari PNS harus segera di- “Ini tentu sangat buruk bagi PNS. Kita memperingatkan ini versitas Negeri Medan (Unimed) tinggalkan. Menurutnya selain perkembangan demokrasi di dengan serius,” kataYusuf lagi. Aulia Andri menambahkan kon- melanggar aturan, politik ma-
  • Aceh 22 B. Aceh, Sigli, Bireuen, Lhokseumawe WASPADA Selasa 29 September 2009 Pembawa Kabur Aceh Utara Harus Contoh L 300 Diringkus Idi Dan Bener Meriah BIREUEN (Waspada): Setelah sempat buron ACEH UTARA (Waspada): Seba- Marga. Terkait dana rehap gedung, selama 12 hari pasca melarikan satu unit mobil je- gai daerah pemekaran, Kabupaten Pemkab harus mengupayakan dan nis pick up L300 milik A Hadi H M Saleh, 32, warga Aceh Utara harus mencontoh Idi, tidak boleh beralasan tidak punya Kota Bireuen, Minggu (13/9) lalu saat diparkir di Ibukota Aceh Timur dan Bener Me- uang. Makin cepat, makin baik. Ka- depan Toko Besi Mulia Sari, di jalan Ramai Kota riah, yang telah lebih dulu mengak- rena untuk mensejahterakan mas- Bireuen. Af, 24, pemuda mengantongi KTP Batu- tifkan dan menjalankan roda pe- yarakat, pemerintah harus dekat phat, Lhokseumawe, berhasil ditangkap berkat merintahan di tempatnya yang ba- dengan rakyatnya,” ucap H. Syahril kerjasama Polres Bireuen dan Polres Pidie, Jumat ru. Sementara Aceh Utara, hingga menambahkan, sudah saatnya (25/9) siang di Kabupaten Pidie, saat tersangka kini pusat administrasinya masih Bupati Aceh Utara menepati janji- hendak menjual kendaraan hasil jarahan itu. dijalankan di Kota Lhokseumawe, janjinya kepada masyarakat. Demikian Kapolres Bireuen AKBP T Saladin SH padahal proses pemekaran lebih Kepada anggota DPRK Aceh melalui Kapolsek Jeumpa, Iptu Shaiful Anam ke- dulu dilakukan Aceh Ut ara diban- Utara periode 2009-2014 yang baru pada wartawan, Minggu (27/9). Pelaku pencurian ding dua kabupaten itu. dilantik, diminta untuk bersung- mobil itu berjumlah tiga orang, dua lainnya ber- H. Syahril Basyah, Wakil Ketua guh-sungguh memindahkan pusat hasil kabur ketika ditangkap, sedangkan tersangka Forum Ranuep Bate, ketika ditanya administrasi Aceh Utara ke Lhok- Af berhasil diringkus. “Tersangka diamankan di Waspada, Minggu (27/9) menye- sukon, karena ini merupakan dam- Polsek Jeumpa untuk pengusutan lebih lanjut,” je- butkan, harusnya Pemkab Aceh baan masyarakat Aceh Utara. las Iptu Shaiful Anam, STP. Utara merasa malu dengan Pemkab Zulfikar Mulieng, Ketua Badan Sebagaimana dikabarkan sebelumnya, Mobil Aceh Timur dan Bener Meriah, ka- Eksekutif Mahasiswa (BEM) Uni- L300 Pikup Minggu (13/9) usai shalat subuh, satu rena sekarang mereka berhasil versitas Malikussaleh Aceh Utara unit pick up L-300 Mitsubishi BK 8661 BR milik A menjalankan roda pemerintahan kepada Waspada, Minggu (27/9) Hadi H M Saleh, 32, warga Kota Bireuen, diparkir di tempat baru. “Mereka tidak per- mengatakan, masih aktifnya pusat di depan toko bahan bangunan Mulia Sari di- nah beralasan, tidak punya dana ADM Pemda Aceh Utara di Lhok- gondol maling. Mobil dengan nomor rangka untuk kembali ke daerahnya yang seumawe menimbulkan kerugian MHML 300 DP5R329814, dengan nomor mesin baru. Kita tidak usah membanding- besar bagi rakyat. karena jika pusat 4D56C-A46466 diketahui hilang ketika pemilik bandingkan Aceh Utara dengan ADM dipindah ke Lhoksukon, kon- toko bangunan itu pada pagi harinya. Korban Bireuen, karena Bireuen telah maju. tribusi masyarakat akan terlihat, mengalami kerugian senilai Rp70 juta. Untuk itu kami sarankan Pemkab pemberdayaan ekonomi akan ter- Waspada/Muhammad Riza Berdasarkan hasil pemeriksaan, dari penga- Aceh Utara harus mencontoh tiga bangun, dan tentunya lapangan kuan sementara, saat melakukan pencurian mobil RAZIA: Akhir-akhir ini Jajaran Satuan Polisi Pamong Praja (Satpol PP) dan Wilayatul Hisbah (WH) Kab. Pidie, daerah tersebut,” kata Syahril. pekerjaan akan terbuka lebar. “Se- menjelang shalat subuh itu, pelaku berjumlah tiga makin memperketat melakukan razia busana muslim dan pasangan non muhrim di objek wisata lokal daerah Disebutkan, Aceh Utara telah makin lama di Lhokseumawe, Aceh orang. Setelah mendapat laporan dari pemilik itu. Tampak salah seorang petugas WH sedang memberi bimbingan kepada wanita muda yang terjaring razia di dimekarkan sejak awal tahun dua Utara akan semakin merugi. Pemkab kendaraan, Polsek Jeumpa melakukan pengem- jalan-jalan, Senin (28/9). ribuan. Karena itu sudah sepantas- Aceh Utara harus segera mengaktif- bangan termasuk kerjasama dengan Polres lain. nya, segala macam kegiatan peme- kan Ibukota Lhoksukon.” “Tersangka berhasil ditangkap sekitar 12 hari pasca kejadian, di wilayah hukum Polres Pidie,” terang Kapolsek Jeumpa. (b03) PLN Wilayah NAD Segera 95% Pasangan Khalwat rintah dilaksanakan di Lhoksukon. Terkait tempat, ExxonMobil berse- dia menyerahkan asetnya berupa Bachelorcamp untuk Pemkab, guna dijadikan pusat administrasi. Me- Menanggapi persoalan di atas Ridwan M. Yunus, Ketua DPRK Aceh Utara Sementara kepada Waspada mengatakan, demi men- jalankan amanah rakyat, pihaknya Putuskan Jaringan Penunggak LHOKSEUMAWE (WAaspada): Tunggakan lis- trik di seluruh ranting dan Rayon PLN di Nanggroe Mengaku Berzina mang Bachelorcamp tidak mampu menampung semua dinas, namun itu dapat dilakukan bertahap. “Menurut hemat kami, Bache- lorcamp mampu menampung tu- bertekat segera mengembalikan pusat pemerintah Aceh Utara ke Lhoksukon. Begitu pun, untuk me- laksanakan keinginan tersebut ada beberapa kendala yang harus sege- Aceh Darussalam (NAD) senilai Rp152,9 miliar, SIGLI (Waspada): Selama tahun yarakat nanti yang mengambil tin- ini peran masyarakat dalam mendu- juh hingga delapan dinas. Dan se- ra dicarikan solusinya, yakni ketia- memaksa perusahaan milik pemerintah ini me- dakan secara adat. Apa mereka dini- kung kerja WH dan Satpol PP sangat karang, Pemkab baru menempat- daan gedung untuk dinas-di- 2009 terjadi 104 kasus khalwat di kan satu dinas yaitu Dinas Bina nas.(cmun) nurunkan tim untuk memutuskan jaringan pe- kahkan atau diusir dari kampong. besar dan berlu ditingkatkan lagi. langgan yang bermasalah. Pidie. Sebanyak 95 persen Karena saat ini kita masih dalam “Kita mengharapkan dukungan Koordinator Forum Komunikasi Manajemen diantaranya, pasangan non tahap sosialisasi. Ke depan kita tidak masyarakat dalam membantu tugas- Kecelakaan Di Indrapuri Ranting (FKMR) PLN NAD, Ali Basyah Ibrahim ke- muhrim itu kepada petugas tahu langkah apa yang akan diambil tugas Wilayatul Hisbah dan Satpol pada Waspada, Senin (28/9) menjelaskan, jaringan yang akan diputukan pada pelanggan yang menunggak sampai 12 bulan. “Pemutusan akan mengaku telah melakukan hubungan badan (berzina-red). karena siapa tahu mungkin hukum jinayah akan berlaku,” ujarnya. Disebutkan, pihaknya tidak da- PP Kini masih ada masyarakat saat . petugas melakukan sweeping di ja- lan-jalan tidak mau berhenti, mereka Satu Tewas Dan Empat dilakukan serentak di seluruh Aceh mulai 1 Ok- tober 2009,” tegasnya seraya menambahkan, tin- pat mengambil tindakan tegas kare- na tidak ada wewenang WH mence- malah tancap gas sepeda motornya malah hampir tabrak petugas. Ini Mahasiswa Kritis dakan ini untuk menekan tunggakan rekening lis- “Selama tahun 2009 saja kita sudah raikan atau mengawinkan orang. Se- amat memprihatinkan,” keluh berhasil menjaring 104 pasangan non KOTA JANTHO (Waspada): Ke- itu, Eka Agustina, 21, mengendarai trik di Wilayah Aceh yang hingga Agustus 2009 se- hingga setiap pelaku khalwat yang Sabar. muhrim yang ketangkap tangan mela- celakaan beruntun yang terjadi di Suzuki Smash BL 6664 LN dan ber- nilai Rp152,9 miliar. berhasil ditangkap, petugas hanya Diungkapkannya, selama ini se- kukan khalwat. 95 diantaranya saat kita menyebabkan tabrakan beruntun boncengan dengan Putri, 20, serta Ali Basyah yang juga Manajer PLN Rayon Kota berwewenang memberi bimbingan lain kasus mesum, yang paling me- periksa mereka mengaku sudah mela- di kawasan Indrapuri, Aceh Besar, Taufik, 22, berboncengan dengan Lokseumawe menjelaskan, tungkanan listrik di saja. “Kita tidak bisa menahan mere- ningkat terjadi adalah kasus pakaian kukan hubungan badan,” kata Kasat Minggu (27/9), menyebabkan se- Nurkhalis, 22, mengendarai sepeda Kantor Cabang Banda Aceh Rp69,5 miliar, Lhok- ka lebih lama di sini, sebab kita tidak ketat. Banyak muda- mudi hingga Pol PP dan WH Kab. Pidie Sabaruddin, orang pengendara sepeda motor motor Suzuki Shogun BL 5510 NI. seumawe Rp20,4 miliar, Langsa Rp28,5 miliar, punya tempat. Biasanya setelah kita orang dewasa masing dominan SH, kepada Waspada, di ruang kerja- tewas di tempat kejadiaan dan em- Pantauan Waspada di Instalasi Meulaboh Rp18,4 miliar, Cabang Subussalam panggil tokoh masyarakat sipelaku, menggunakan pakaian ketat saat be- nya, Senin (28/9). pat lainnya berstatus mahasiswa Gawat Darurat RSUZA Banda Aceh Rp4,4 miliar, Cabang Sigli Rp10,5 miliar, dan Kan- lalau kita serahkan kepada keluarga. pergian, sehingga saat terjaring me- Menurut dia, semua pelaku tidak IAIN Ar-Raniry Banda Aceh kritis, Minggu malam, Taufik asal Aceh tor Wilayah 902,9 miliar. Merekalah yang mengambil tinda- reka kerap berdebat atau melawan dirajam cambuk, tetapi mereka umum- sehingga harus menjalani perawa- utara menderita patah kaki. Se- Untuk menagih tunggakan yang dapat menu- kan,” ujarnya lagi. petugas. nya dinikahkan dan sebagian dilepas- tan intensif di Rumah Sakit Umum dangkan temannya, Nurkhalis, runkan pelayanan perusahaan ini, 4 manejer rayon Kepada Waspada, Sabar meng- “Padahal kita sudah sosialisi, te- kan. Karena diantara mereka ada yang dr Zainoel Abidin Banda Aceh. warga Banda Aceh dan Eka Agusti- bersama 30 manajer ranting dan 4 kepala PLTD yang ungkapkan keberadaan petugas WH tapi masih saja ada yang melanggar. masih berstatus istri dan suami orang Informasi yang Waspada him- na, warga Asrama PHB Lampriet tergabung dalam FKMR PLN-NAD sepakat dan Satpol PP di tengah-tengah mas- Padahal kita hanya membina saja lain (pasangan selingkuh-red). pun dari berbagai sumber menye- serta Putri warga Lambaro kritis. menurunkan tim pemutusan secara serentak. yarakat dalam menegakan hukum tidak mengambil tindakan apa-apa, ”Pasangan seperti itu biasanya kita butkan, tabrakan mobil Ford Esca- Jenazah Zulfahmi korban te- Ketua FKMR bersama wakilnya, Yusbainur Syariat Islam di Pidie tidak perlu dita- karena masih dalam tahap sosiali- kembalikan ke masyarakat, dan mas- pe BL 873 JC disopiri Ramadani was dalam kejadian itu, dievakuasi menjelaskan pelanggan yang menunggak dua kuti, bahkan harus dibantu. Selama sasi,” tegasnya.(b20) Ismy, 38, warga Lueng Bata, Banda petugas PMI ke desa tempat ting- hingga tiga bulan akan dilakukan pemutusan se- mentara. Sedangkan yang menunggak empat bu- lan keatas akan dibongkar KWH meter. “Tim juga akan memutuskan terhadap seluruh pemakai arus Usai Tarik Seluruh Dana Aceh yang datang dari arah Medan dengan sepeda motor Honda Vario BL 4789 LV dikendarai Zulfahmi, galnya untuk diserahkan kepada pihak keluarga. Selain menyebabkan mobil secara liar. Ini untuk menekan losis atau lehi- langan arus yang saat ini mencapai 15 persen,” tambahnya.(b17) Rekanan Telantarkan Proyek 34, warga Desa Lamlhom, Kecama- tan Lhoknga, Aceh Besar, yang da- tang dari arah berlawanan, terjadi dan dua sepeda motor yang diken- darai korban rusak berat, kecela- kaan itu juga sempat menimbul- BIREUEN (Waspada): Proyek pem- pedagang dari Dinas Perindustrian propinsi serta PPTK Bireuen yakni sekira pukul 15.40 WIB di Kilometer kan kemacetan hingga satu kilo- bangunan 42 pintu kios pedagang di Perdagangan Koperasi dan UKM Bi- dirinya serta konsultan. 25 Jalan Banda Aceh-Medan. meter lebih baru berhasil di atasi Jalan Arongan Rusak Parah Desa Linggong, Kecamatan Peusangan reuen, Suhaimi yang dikonfirmasi “Karena mereka (rekanan) telah “Saat itu lalulintas di kawasan itu sedang padat-padatnya karena setelah aparat Polantas Aceh Besar turum ke lapangan. dan sejumlah kecamatan lainnya, Ka- Kamis pekan lalu membenarkan so- kabur, maka kami yang menyetujui BIREUEN (Waspada): Akibat tidak ada pera- bupaten Bireuen telah ditelantarkan sok rekanan pembangunan telah ka- penarikan dana akan bertanggung bertepatan dengan arus balik leba- Kapolres Aceh Besar AKBP Te- watan dan setiap tahunnya digenangi luapan ban- rekanan yang diduga kabur setelah me- bur dan pembangunan telah terlantar. jawab untuk menyelesaikan pem- ran yang hari ini (kemarin-red) guh Susilo Raharjo yang Waspada jir bandang, kondisi jalan kabupaten sepanjang narik seluruh dana hingga terindikasi Menurutnya, rekanan pelaksana bangunan kios pedagang hingga mencapai puncaknya,” kata Ham- konfirmasi melalui hendphone 5,7 kilometer mulai dari simpang lapangan bola merugikan keuangan negara. pembangunan itu adalah CV APS rampung dengan dana pribadi yang dani, seorang warga setempat. membenarkan kejadian itu. Ia me- kaki Desa Sangso dan Meulik Kecamatan Sama- Pembangunan kios untuk peda- milik Su yang dikuasakan kepada ditanggung bersama,” ujar Suhaimi. Selain Zulfahmi yang tewas di nyebutkan, sejak Bulan Ramadhan langa, hingga ke Meunasah Mesjid, Kecamatan gang di sejumlah kecamatan senilai Muk serta dilaksanakan Fa, kon- Suhaimi menjelaskan, sebelum- tempat kejadian, empat lainnya kri- hingga Hari Ketujuh Lebaran Idul Simpang Mamplam, kondisinya sejak beberapa Rp770 juta itu bersumber dari dana traktor asal Jeunieb. Rekanan itu pula nya rekanan telah membuat perjan- tis setelah sepeda motor yang me- Fitri tahun ini, terjadi tujuh kasus tahun terakhir sudah rusak parah. otonomi khusus (otsus) 2009, kini telah yang melaksanakan pembangunan jian secara tertulis tetap akan melan- reka tumpangi menabrak mobil kecelakaan lalulintas di wilayah itu Informasi yang Waspada Minggu (27/9), me- terhenti beberapa bulan. “Pembangu- kios pedagang sebanyak delapan jutkan pembangunan hingga ram- yang dikendarai Ramadani Ismy. yang menyebabkan empat orang nyebutkan, selain menjadi salah satu jalur alter- nan telah terhenti beberapa bulan lalu, pintu di Teupin Mane, Kecamatan pung. Namun tidak menduga kemu- Keempat korban yang kini di rawat meninggal dunia dan tiga lainnya natif hubungan antar dua kecamatan. Setiap hari sepertinya rekanan menolak melanjut- Juli yang juga belum dirampungkan dian rekanan malah mangkir setelah di Rumah Sakit Umum Banda Aceh luka-luka. (b09) jalan itu menjadi salah satu jalur transportasi ber- kan pembangunan, kabar yang beredar sampai sekarang. berhasil menarik semua dana de- bagai geliat ekonomi masyarakat dan para santri dana pembangunan telah ditarik se- “Selain di dua lokasi itu, sisanya ngan persetujuan pejabat baik di di Dayah Arongan. muanya atas persetujuan pejabat ting- tersebar di sejumlah kecamatan di propinsi, kabupaten dan konsultan. Masyarakat berharap kepada Pemkab Bireuen kat dinas baik di tingkat propinsi mau- Bireuen hingga semuanya ada 42 Suhaimi menyebutkan, biaya melalui dinas terkait dapat segera memperbaiki pun kabupaten,” kata sebuah sumber. pintu kios. Konsultan proyek adalah pembangunan hingga rampung di- kembali kerusakan badan jalan yang menghu- bungkan sembilan desa di dua kecamatan wilayah Menurut warga setempat, delapan CV SR dan CV MP asal Lhokseuma- tanggung bersama, setelah tim ins- barat kota Bireuen tersebut. “Badan jalan rusak pintu kios yang dibangun di kawasan we dengan direktur Mis, sementara pektorat propinsi turun ke Bireuen parah karena nyaris setiap tahunnya sering dige- Desa Linggong, Peusangan dibangun pengawas lapangan bernama Jimy,” melakukan peninjauan dan mene- nangi luapan banjir, bahkan kondisi satu unit jem- di atas tanah wakaf aset milik Desa jelas Suhaimi. mukan proyek tersebut belum sele- batan di ruas jalan Desa Arongan juga telah Lampoh Rayeuk, belum diketahui me- Terkait soal keberhasilan reka- sai sementara dana telah ditarik selu- rusak,” ujar Camat Samalanga Darwansyah, ketika kanisme penggunaan lahan tersebut. nan pelaksana bisa menarik semua ruhnya. ditemui wartawan, Minggu (27/9) di Desa Setahu warga, rekanan pelaksana asal biaya sementara bangunan baru se- Dalam hal ini inspektorat me- Arongan. Kecamatan Jeunieb dan konsultan dari lesai 70 persen, Suhaimi mengata- nyarankan kepada pejabat yang ber- Menurutnya, usulan perbaikan ruas jalan Kota Lhokseumawe. kan, penarikan dana seratus persen tanggungjawab untuk dapat melan- menghubungkan dua kecamatan tersebut telah Pejabat Pelaksana Teknis Kegiatan atas persetujuan Kuasa Pengguna jutkan pembangunan dengan batas pernah diajukan ke kabupaten tetapi belum terea- (PPTK) proyek pembangunan 42 kios Anggaran (KPA) dan PPTK di dinas waktu akhir 2009. (b03) lisasi sampai sekarang.(b03) Ketua DPRK Minta Kasus Identitas Orangtua Bocah Yang Ditelantarkan Masih Kabur BIREUEN (Waspada): Malang be- nya diantar ke rumah ibu Ida karena nama Haji Dayat itu sudah titipkan Kas Aceh Utara Diselesaikan nar nasib dialami seorang bocah laki- dia sedang ribut dengan suaminya,” dengan keluarga Yunus, dan di ACEH UTARA (Waspada): Ridwan M. Yunus, laki berusia diperkirakan tiga tahun jelas Ipda Syamsul, SH. bawah pengawasan polisi. Ketua Dewan Perwakilan Rakyat Kabupaten belum diketahui identitas dan asalnya Kronologis kejadian berawal ke- Menurut Kapolsek, kondisi si (DPRK) Aceh Utara Sementara saat dihubungi satu ini, masih kecil dia sudah mera- tika pengendara ojek itu, sedang me- anak seperti masih trauma dia ha- Waspada, Minggu (27/9) via telepon menye- sakan penderitaan setelah ditelantar- nunggu penumpang di kawasan nya mau didekati laki-laki berpostur butkan, kasus bobolnya kas Pemda Aceh Utara kan ibu kandungnya. Simpang Matang. Setahu bagaima- tinggi dan hitam kemungkinan ciri- harus diselesaikan dengan baik, agar masyarakat Kini bocah itu dalam pengawasan na satu unit mobil penumpang L300 ciri ayah kandungnya. “Anak yang tidak dirugikan. aparat Polsek Samalanga setelah dian- berhenti dan si perempuan itu meni- menyebut namanya Haji Dayat itu, “Ya, kita minta pihak berwenang menyele- tar seorang penarik ojek (RBT-red) usai tipkan anaknya kepada Fakri dan kondisinya sehat tetapi tidak mau saikan kasus bobolnya deposito Aceh Utara dititip seorang penumpang L300 tujuan disuruh antar ke Desa Pulo, ke ru- sembarangan orang. Sepertinya dia sebagaimana baiknya,” ucap Ridwan M. Yunus. Medan, ke rumah pegawai kantor ca- mahnya ibu Ida pegawai kantor ca- juga rindu dengan ayahnya. Tadi Untuk masuk ke persoalan itu, sebut Ridwan, mat setempat, Jumat (25/9). mat setempat. Tanpa pikir panjang saat sedang tertidur dibangunkan pihaknya mengaku belum begitu mengerti, karena Kapolres Bireuen AKBP Teuku Sala- dan sama sekali idak menaruh curi- menolak, tetapi saat dikatakan ayah- jangankan tentang persoalan tersebut, jumlah din, SH melalui Kapolsek Samalanga ga lantas pengendara ojek langsung nya datang cepat-cepat dia bangun,” kamar yang ada di gedung DPRK saja belum dike- Ipda Syamsul, SH mengungkapkan, mengantarkan anak itu, tetapi su- sebutnya. tahuinya. “Kami masih baru, dan butuh waktu un- himgga kini pihaknya masih terus me- dah empat rumah didatangi tidak Ipda Syamsul berharap kepada tuk mendalami persoalan itu. Yang pasti, kasus nyelidiki siapa ibu kandung anak itu. ada yang mengenal anak itu. anggota keluarga maupun masyara- tersebut harus diselesaikan dengan baik, dan kami “Dari pengakuan Fakri, 45, warga Desa “Rumah terakhir didatanggi kat yang menegenali anak itu dapat sebagai anggota dewan berpihak kepada rakyat, Matang Kecamatan Samalanga selaku adalah rumahnya ibu Ida istrinya segera melapor ke Polsek Samalanga bukan kepada yang lainnya.” pengendara ojek (RBT-red), perempuan Yunus pegawai kantor camat setem- atau pos polisi terdekat. “Bagi masya- Disebutkan, hingga kini pihaknya di DPRK yang menitip anak itu pada malam tiga pat, tetapi karena keluarga itu sama rakat yang mengenal anak ini, sege- Waspada/Bustami Aceh Utara baru berhasil membentuk fraksi-fraksi, lebaran dan diantar ke Polsek sekira sekali tidak mengenal anak itu selan- ralah melaporkan ke Polsek Sama- Kapolsek Samalanga Ipda Syamsul,SH, Minggu (27/9), mengendong bocah belum berhasil membentuk komisi. Begitu pun pukul 23.30 WIB. Ibu si anak itu me- jutnya Fakri membawa anak diper- langa ke nomor telepon 0644 31275, beumur tiga tahun belum yang belum diketahui identitas dan alamatnya dalam waktu dekat semua itu akan terwujud numpang mopen L300 dari Banda kirakan berusia 3 tahun itu ke Polsek karena dia masih membutuhkan ortunya yang menumpang sebuah mopen L300 kepada seorang pengedara sesuai harapan.(cmun) Aceh, berpostur agak gemuk, warna ku- Samalanga,” terang Syamsul, dan bimbingan dan kasih sayang dari ke- ojek dikawasan simpang Matang, Kecamatan Samalanga, Bireuen, malam lit hitam, dan mengaku minta anak- sekarang anak yang sering menyebut dua orang tuanya,” pintanya. (b03) lebaran ketiga.
  • Langsa, Kualasimpang, Kutacane, Singkil 23 WASPADA Selasa 29 September 2009 Pemkab Harus Benahi Pariwisata Perempuan Kesasar SINGKIL (Waspada): Pemerintah Kabupaten (Pemkab) Aceh Singkil diminta membenahi sarana dan prasarana wisata Pantai Ternyata Korban KDRT Cemara Indah Gosong Telaga, sebagai salah satu pemasok Pen- dapatan Asli Daerah (PAD) potensial. KUALA SIMPANG (Waspada): Perem- Minggu (27/9) petang. Pengelola objek wisata Pantai Cemara, Rusdin Tanjung, puan yang diperkirakan mengalami gangguan “Orang tua Fatimah sangat terharu Sabtu (26/9) menyebutkan, selama liburan lebaran 1430 H diper- jiwa dan sejak tiga bulan lalu ditampung di begitu melihat Fatimah. Apalagi selama ini kirakan belasan ribu pengujung datang berwisata ke pantai rumah Ti Hajar, 30, di Desa Salah Aji Kecamatan mareka sudah berupaya mencarinya ke tersebut. Ia mengaku fasilitas air bersih, listrik dan sarana ber- Matang Jaya, Aceh Tamiang ternyata bernama sana – ke mari. Mareka datang dengan main anak merupakan sarana pendukung yang banyak diusul- Fatimah, 29, asal Desa Buket Rata, Kecamatan membawa KTP dan Ijazah asli Fatimah. kan sejumlah pengunjung lokal maupun dari luar kabupaten Kejuruan Muda, Aceh Tamiang. Jiwa Fatimah Awalnya Fatimah menolak ikut ke rumah agar dilengkapi. memang labil, diduga akibat tindak kekerasan orangtuanya, tapi setelah dibujuk akhirnya Sedangkan pondok wisata dan pondok untuk berjualan dalam rumah tangga (KDRT). ia bersedia pulang,” kata Ti Hajar. secara bertahap telah dibangun Pemkab. Rusdin mengaku pe- “Fatimah sudah berumah tangga serta Dikurung ningkatan kunjungan wisata ke Pantai Singkil Utara terus me- telah dikaruniai sepasang anak. Belakangan Masih menurut Ti Hajar, sebelum pergi ningkat dari tahun ke tahun. “Kita berharap pemerintah dapat rumah tangga Fatimah retak. Ia kerap dika- dari rumah ada sedikit kekeliruan penanga- mengalokasikan dana untuk membangun sarana dan prasana sari suaminya, hingga jiwanya terganggu. nan terhadap Fatimah. Orangtuanya me- di kawasan pantai ini,” pinta Rusdin. Kondisi jiwa Fatimah kian parah setelah sang ngurung wanita berkulit sawo matang itu Pemkab melalui pengelola menetapkan tarif karcis masuk suami pergi dari rumah bersama kedua buah di kamar karena khawatir terjadi hal-hal Rp2.000 untuk dewasa, Rp1.000 anak-anak dan Rp5.000 untuk hati mareka, sekitar setahun lalu,” ungkap tidak diinginkan. Suatu ketika, Fatimah bisa parkir kenderaan roda empat. Kawasan pantai tahun 2009 Ti Hajar via telefon mengutip keterangan keluar kamar secara diam-diam dan lang- ditargetkan memasukkan PAD Rp25 juta, sementara tahun Jamil, 60, ayah Fatimah saat menjemput pe- sung minggat. 2008 pengelola menyetor Rp20 juta, jelas Rusdin.(b30) rempuan malang itu, Minggu (27/9) petang. “Terkait masalah ini saya sudah menya- Menurut Ti Hajar, Jamil yang sehari-hari bekerja sebagai penjual sate mengetahui rankan orang tua Fatimah agar memperla- kukan Fatimah layaknya orang normal. Se- Membangun Abdya, PA keberadaan anaknya setelah membaca be- rita di Waspada, Sabtu (26/9) pagi. Yakin pe- bab kondisi Fatimah terlihat mulai pulih. Selama tinggal bersama kami ia tak pernah Waspada/Khairul Boangmanalu PERIKSA ABSEN: Wakil Walikota Subulussalam H. Affan Alfian Bintang, SE (pakai peci) didampingi Koalisi Dengan Parnas rempuan itu anaknya, Jamil bergegas menu- bersikap aneh, apalagi kasar. Ia juga bisa Kabag Kepegawaian Setdako Ibnu Hajar, S.Sos menyaksikan Kepala Dinas Perkebunan dan BANDA ACEH (Waspada): Proses Reintegrasi Aceh antara man- ju rumah Ti Hajar. Tapi karena saat itu Fati- melakukan pekerjaan rumah tangga dengan Kehutanan (Kadibunhut) Ir. Faisal memeriksa absen PNS, CPNS dan tenaga PTT atau honorer tan-mantan kombatan GAM dengan masyarakat terhitung berhasil mah ikut diajak lebaran ke kampung hala- baik,” ujar Ti Hajar seraya mengucapkan di lingkungan Disbunhut Kota Subulussalam pada inspeksi mendadak (Sidak) di lingkungan dan berjalan baik di Kabupaten Aceh Barat Daya, tidak hanya man Ti Hajar di Desa Seunebok Pidie Madat terimakasih kepada Waspada, karena mela- Pemko Subulussalam, Senin (28/9). dalam urusan kemasyarakatan namun juga dalam urusan politik. Aceh Timur, ayah dan anak yang sudah lui pemberitaan Fatimah bertemu kembali Bila dalam urusan kemasyarakatan banyak mantan komba- berbulan terpisah itu baru berhasil bertemu, dengan orangtuanya.(cmus) tan yang sukses memimpin desa dan menjadi ustaz, sementara Tujuh Kapolsek Di Aceh Timur Diganti PNS Mangkir di panggung politik para wakil Partai Aceh (PA) di DPR dipastikan berkoalisi dengan para wakil dari partai politik nasional. “PA membuka diri untuk perubahan, untuk membangun Abdya, kesadaran yang sama juga dimiliki rekan-rekan dari Parnas, makanya kita bergabung menjadi satu fraksi di dewan,” Sertijab Waka Polres Hari Ini PEUDAWA, Aceh Timur (Waspada): Tu- masyarakat. Karena apapun tidak akan Tunjangan Dipotong kata Ketua Partai Aceh Abdya, Muhammad Nazir yang di hu- bungi Waspada, kemarin. Bergabungnya sejumlah kader partai nasional ke fraksi PA diyakini sebagai suksesnya proses reintegrasi paska damai. Dari 25 anggota DPRK Abdya yang dilantik 9 September juh Kepala Kepolisian Sektor (Kapolsek) di berjalan lancar tanpa kedamaian,” ujar SUBULUSSALAM (Was- sejumlah staf yang mendapat sing. “Tiga hari PNS, CPNS dan 2009, 18 menyatakan berkoalisi dengan kesadaran perubahan jajaran Mapolres Aceh Timur, Senin (28/9) Ridwan Usman. pada): Wakil Walikota Subulus- pengawalan langsung sejum- PTT atau honorer berturut-tu- bersama dalam Fraksi PA. Artinya ada sembilan wakil rakyat diganti. Sementara itu, Kepala Satuan (Kasat) Usai upacara Sertijab, Kapolres menga- salam H. Affan Alfian Bintang, lah personil Satpol PP dan Plt. rut tidak hadir tanpa izin, akan dari Parnas menggabungkan diri dalam fraksi PA, selebihnya Intelkam juga dimutasi dari Kompol Junaidi takan, mutasi yang dilakukan ini tidak SE ancam memotong tunjang- Kakan Kesbang Linmas dan dipotong tunjangannya, diper- membangun fraksi gabungan.(b32) diganti mantan Kabag Ops Poltabes Kota terlepas dari penyegaran untuk mening- an Pegawai Negeri Sipil (PNS) Satpol PP Sahidin B, SH, juga lambat SK 100 persennya dan Banda Aceh, Kompol Didik S. katkan kualitas kinerja Polri dalam bertugas, jika mangkir tiga hari berturut- mengingatkan para Kepala Di- diberhentikan dari PTT atau Ke tujuh Kapolsek yang diganti, Kapolsek melaksanakan tanggungjawab selaku pela- turut tanpa izin atau alasan nas, Sekretaris dan Kabid agar honorer,” tegas Affan sekaligus Atraksi Gajah Hibur kuat. memberi contoh yang terbaik minta Kepala Inspektorat me- Banda Alam sebelumnya dijabat Ipda M. Hasyim Ibrahim, diganti Ipda Didik. Kapol- yan dan pengayom masyarakat. “Bukan tempat dimana kita bertugas Sementara para CPNS kepada bawahan, seperti tertib realisasi jika ditemukan pe- Masyarakat Bireuen sek Indra Makmur diganti Ipda M. Hasyim yang menjadi tolak ukur seorang personel yang melakukan kesalahan se- masuk, istirahat dan pulang langgaran itu. rupa diperlambat pengeluaran kantor tanpa pilih kasih. Affan juga berjanji mem- KUALA (Waspada): Delapan ekor gajah terlatih Sumatera Ibrahim. Kapolsek Darul Aman sebelumnya polisi, tapi bagaimana menciptakan Aceh dari BKSDA Saree Aceh Besar melakukan serangkaian atraksi Aipda Rusli diganti Ipda A. Widodo. Kapolsek ke depan yang lebih aman tanpa ada gang- SK PNS 100 persen dan bagi “Saya tegaskan kepada Ke- publikasi di media massa PNS, tenaga honorer atau PPT akan pala Dinas, Sekretaris dan para CPNS maupun PTT atau ho- menghibur masyarakat Bireuen di lapangan Desa Lancok Keca- Julok sebelumnya Iptu Samsuar diganti AKP guan apapun, sehingga rakyat marasa da- matan Kuala Bireuen, Minggu (27/9). Burhansyah, Kapolsek Peureulak Timur di- mai,” sebut Kapolres Ridwan Usman sem- diberhentikan. Kabid agar benar-benar men- norer yang terkena sanksi itu. Demikian penegasan Wa- jalankan tugas dan fungsi se- “Ini bukan sekedar gertak atau Dalam suasana lebaran Idul Fitri, masyarakat bersama ganti Iptu Samsuar, dan Kapolsek Ranto Peu- bari menandaskan pihaknya akan terus ber- keluarganya tumpah ruah menyaksikan 25 atraksi gajah yang reulak diganti Ipda Ildani Ilyas, serta Kapolsek upaya menjaga kedamaian selaku tugas Pol- kil Walikota, Affan dalam ins- bagai pimpinan dan PNS menakut-nakuti, tetapi kita se- peksi mendadak (Sidak) terha- mampu memberikan contoh rius dalam membangun Kota cukup menarik itu. Darul Ihsan diganti Aiptu Rusli. ri serta memelihara butir MoU Helsinki an- Atraksi pertandingan bola kaki yang ditampilkan 4 ekor Dalam upacara Serah Terima Jabatan tara RI-GAM pada 15 Agustus 2005. dap hampir seluruh dinas, terbaik kepada para staf,” tegas Subulussalam yang lebih kantor dan badan se Pemko Affan memasikan, pihaknya baik,” tegas Affan. gajah kesebelasan PSBL Lancok Vs 4 ekor gajah kesebelasan (Sertijab) kemarin, Kapolres Aceh Timur, Sementara Kasat Intekam Mapolres Aceh PSSB berlangsung seru. Kedua kesebelasan masing-masing AKBP Drs. Ridwan Usman mengharapkan, Timur, sebelumnya dijabat AKP Ade Adriyan- Subulussalam, Senin (28/9). akan menindak para PNS yang Pada sidak itu, Affan sem- Affan didampingi Drs. tidak disiplin dalam menjalan- pat terlihat emosi dan mene- ingin meraih kemenangan. Hingga pertandingan usai tim gajah ke depan setiap wilayah ataupun kecamatan syah Putra, SIK, diganti mantan KBO Reskrim PSBL Lancok berhasil mengalahkan tim gajah PSSB Bireuen. terus meningkatkan pelayanan terhadap Aceh Besar, Iptu Ananda Fauzi Harahap. Mahyuddin Latief, M.Hum staf kan tugas sebagai abdi negara. gur keras Kadis PU Ir. Irwan ahli bidang hukum dan politik, Di sisi lain Affan minta serta Kadisduk dan Capil Dra. Sementara di cabang olahraga bola basket, seekor gajah betina masyarakat dalam meningkatkan ketertiban Untuk Sertijab Waka Polres Aceh Timur diberi nama Fatimah, lebih unggul dalam meraih angka. dan keamanan. akan dilakukan besok (hari ini—red), di Teuku Abdul Hamid, SH Kepa- para staf, tenaga Pegawai Tidak Rahmiati yang terlambat la Inspektorat, Ibnu Hajar, S. Tetap (PTT) dan honorer me- masuk kantor. “Kalau kepala Atraksi lainnya yang tak kalah menarik, lomba lari ke delapan Selain itu, para Kapolsek yang bertugas mana Waka Polres yang baru dijabat Kompol ekor gajah bertubuh besar dalam berebut bola. Disusul disko di tempat baru terus memasyarakatkan po- Didik S. Sementara mantan Waka Polres Sos Kabag Kepegawaian, As- matuhi semua aturan yang saja tidak disiplin, bagiamana mardin, SH Kabag Hukum dan berlaku di kantor masing-ma- dengan staf,” tanya Affan.(b33) bersama menghibur penonton. lisi selaku mitra masyarakat dalam menegak- Aceh Timur, Kompol Junaidi akan menem- Menaikkan bendera dengan khidmat, berdiri di atas pang- kan hukum. “Tidak ada yang terpenting se- pati posisi Kasi Dirlantas Polda Aceh di gung, berhitung, mengalungkan bunga, melipat orang dengan lain kedamaian yang harus dijaga bersama Banda Aceh.(cmad/b22) Polisi Kantongi Identitas Pelaku belalai, melangkahi belasan orang tidur, memberi salam dan berbagai atraksi lainnya.(b16) Selama Lebaran Lokasi Pembunuh Pengusaha Sawit 360 Warga Gampong Wisata Padat Pengunjung IDI, Aceh Timur (Waspa- da): Terkait pembunuhan Sertijab sejumlah Kapolsek, Senin (28/9) pagi. mengatakan, kasus itu masih dalam penyelidikan. Namun Meutia Terima Zakat Fitrah Amiruddin alias Effendi alias Menurut Kapolres, kasus diduga kuat masih ada hubu- LANGSA (Waspada): 360 Warga tidak mampu dari fakir KUTACANE (Waspada): Selama lebaran Mamas atau Pante Goyang bersama keluar- Epi, 35, pengusaha kelapa sa- kematian pengusaha kelapa ngan. “Ya, tidak tertutup ke- miskin Desa Gampong Meutia Langsa menerima zakat fitrah Idul Fitri sejumlah lokasi wisata di Aceh Teng- ga, karena selain baru dibuka, tempat wisata wit asal Madat, Kab. Aceh Ti- sawit yang ditembak kawanan mungkinan ke arah itu, tapi dari panitia pengelola zakat fitrah desa setempat. gara semakin diminati dan jadi tujuan utama di pinggiran aliran sungai Lawe Mamas itu mur beberapa waktu lalu di bersenpi belum lama ini me- masih dalam lidik petugas.” Demikian Geusyik Gampong Meutia M. Noor Yahya yang warga dari berbagai wilayah di bumi Sepakat juga menyediakan tempat hiburan untuk pedalaman Kec. Pante Bidari, rupakan salah satu kasus besar Mengenai identitas pelaku, juga koordinator pelaksana zakat fitrah Masjid Al-Syuhada Segenep. anak-anak. polisi mengaku telah mengan- dalam kurun waktu setahun Kapolres mengatakan untuk kepada Waspada, Rabu (23/10). Beberapa lokasi wisata yang paling dimi- “Lokasi wisata Lawe Mamas penataan- tongi sejumlah nama pelaku. terakhir. Selain pelaku yang di- memudahkan penyelidikan Geusyik didampingi Imum Syik Drs. Abdullah Gade, MPd nati itu di antaranya lokasi wisata Lawe Ma- nya mampu menimbulkan daya tarik bagi “Kasus ini masih dalam pe- duga dua orang sebelumnya pihaknya untuk sementara tidak dan Sekdes HM. Yusuf Hamid menjelaskan, setiap fakir yang mas, Ketambe, Lawe Ski, Pante Timur, Pante warga di Agara maupun pengunjung dari nyelidikan, namun sejumlah berkeinginan menyandera memaparkan identitas pelaku. berjumlah 40 orang menerima 20,8 kg beras atau 13 bambu Barat, Lawe Gerger dan beberapa lainnya. luar daerah. Karena itu agar lokasi wisata nama yang kita duga sebagai korban. “Ketika korban mela- “Tidak usah disebutkan dulu dan uang Rp20.000. Sedangkan warga miskin menerima 11,2 Bahkan akibat besarnya minat warga lainnya juga jadi pilihan warga, sebaiknya pelaku telah kita kantongi. Bah- wan membela diri, justru pela- namanya, karena kita masih ha- kg beras atau 7 bambu dan uang Rp10.000, sementara jumlah berlibur, Minggu (27/9), arus lalu lintas me- penataan maupun fasilitasnya, walau tidak kan beberapa orang juga telah ku menembak korban hingga rus menyelidiki paling dalam warga miskin yang berhak menerima 320 orang. nuju Ketambe dan Pantai Lawe Mamas atau menyamai, paling tidak mendekati lokasi dimintai keterangan sekaitan tewas,” ujarnya. lagi. Tapi jika ada yang kita jadi- Menurut Geusyik, zakat fitrah warga yang terkumpul tahun yang kerap disebut Pante Goyang, sempat wisata Lawe Mamas,” ujar Madiansyah penembakan korban saat ber- Ketika disinggung apakah kan tersangka akan kita publika- 2009 berjumlah 5,6 ton beras atau 3,545 bambu dan uang macet dan menimbulkan antrian panjang. Beroeh. ada di kebun sawitnya,” demi- pelaku ada kaitannya dengan sikan nanti,” kata AKBP Ridwan Rp5.744.000. “Zakat fitrah ini telah disalurkan kepada mereka kian Kapolres Aceh Timur, AKBP penyanderaan Alex, paman Usman seraya menandaskan, yang berhak menerimanya,” kata Noor Yahya yang menam- Inggit Natasa, warga Kota Kutacane Malik Hamdani, SE, pengelola lokasi wi- Drs. Ridwan Usman, menjawab korban sebelumnya? Dengan pihaknya komit mengungkap bahkan, jumlah warga yang membayar zakat fitrah tahun ini mengatakan, meski jarak tempuh yang harus sata Lawe Mamas atau pante Goyang me- wartawan di ruang kerjanya usai tegas Kapolres Ridwan Usman kasus itu.(cmad) 487 orang.(b26/m43) dilalui terbilang jauh, namun bagi dia dan ngatakan, sebenarnya prospek pariwisata keluarganya lokasi wisata Ketambe masih di Agara dengan alam yang sangat mendu- jadi tempat paling menyenangkan. kung, mempunyai prospek menjanjikan. Selain hawanya masih sejuk karena rin- dangnya pepohonan serta melepaskan rasa Karena itu, pihaknya akan terus menata lokasi wisata Lawe Mamas yang semakin Dituduh Dukun Santet, Rumah Nenek Dirusak Massa penat maupun cuaca panas yang sedang hari semakin diminati warga Agara dan war- LHOKSUKON, Aceh Utara massa tidak mengusik anak, mulut RML. Uniknya, tak lama ding, otak dari permasalahan melalui Kapolsek Lhoksukon menyelimuti Kutacane, di lokasi wisata Ke- ga dari luar daerah. “Tahap awal memang (Waspada): Rumah semi per- menantu serta cucu RML yang berselang leher RML seperti ini salah satu oknum pejabat Iptu Yusuf Hariadi kepada war- tambe juga masih ditemukan sejumlah baru ada kolam renang, hiburan anak-anak manen milik RML, 65, di Desa saat kejadian berada di rumah. bengkak dan ia langsung men- desa berinisial AWG yang ru- tawan menjelaskan, kasus san- fauna yang turun ke badan jalan nasional. dan hiburan bagi orang dewasa, namun bila Kumbang, Km 7, Kecamatan Mareka diminta ke luar secara cret. Sejak itu, warga sepakat mahnya berdekatan dengan tet di Desa Kumbang sebenar- Berbeda dengan pengakuan Sahrul, modal memungkinkan, penataan akan Lhoksukon, Aceh Utara diru- baik-baik sebelum rumah di- meminta RML hengkang dari rumah RML. Menurut MHD, nya telah dilaporkan sekitar dipilihnya liburan ke lokasi wisata Lawe dibenahi,” jelas Malik Hamdani.(b27) sak massa, Sabtu (26/9) sekitar rubuhkan. Sementara RML Desa Kumbang dengan limit pejabat desa itu kurang senang sebulan lalu dan masih dalam pukul 21:00. Massa menuduh sendiri tidak berada di tempat waktu terakhir habis lebaran. dengan mertuanya RML ter- penyelidikan. perempuan renta itu terlibat saat aksi massa itu dilan- Namun sampai limit ini ter- kait sengketa tanah, lalu mem- “Terlepas dari ada tidaknya Objek Wisata praktek dukun santet dan telah menyantet belasan warga setempat. carkan. “Sebelum dihancurkan, massa terlebih dulu berdoa lampaui, RML belum juga pin- dah, sehingga massa yang ter- lanjur emosi merubuhkan ru- provokasi warga supaya me- musuhi serta mengusir keluar- ga RML dari Desa Kumbang. benang merah antara dugaan santet dan pengrusakan ru- mah, yang pasti perbuatan Di Abdya Masih Alami Informasi dihimpun, aksi pengrusakan rumah RML di- bersama di depan rumah RML. Tujuannya agar tidak mahnya.” Bukan Dukun Santet Terkait tudingan MHD, sa- lah seorang anggota keluarga merusak rumah orang tetap masuk kategori melanggar hu- picu karena ratusan warga ke- ada orang dari pihak massa Sementara MHD, 44, me- AWG membantah ada persoa- kum. Itu sebabnya kita akan SEJUMLAH sungai alam dari Beberapa warga sekitar wisata alam sal atas sikap RML yang dinilai terkena efek magic RML. Tapi nantu RML membantah mer- lan pribadi di balik aksi massa bertindak tegas terhadap para perbukitan yang selama ini menjadi yang ditanyai menyebut selama ini tidak menghormati keputusan saat doa bersama berlangsung, tuanya melakukan praktek du- merusak rumah RML. “Aksi itu pelaku. Lagipula ini termasuk objek wisata alam di Kabupaten Aceh pemerintah daerah tidak berupaya rapat desa. Sebelumnya dalam dua warga sempat pingsan se- kun santet di Desa Desa Kum- murni kehendak warga lanta- main hakim sendiri,” tegas Ka- Barat Daya (Abdya) terlihat masih alami membangun fasilitas jalan yang baik rapat darurat di Meunasah (su- telah sebelumnya seperti ke- bang, Km 7, Kecamatan Lhok- ran resah dengan kelakuan polsek Iptu Yusuf Hariadi. dan belum tersentuh pengaruh untuk memudahkan pengunjung ke rau desa-red) sudah ada kepu- masukan roh halus,” ujar sukon, sebagaimana tuduhan RML. Warga berkali-kali meng- Untuk menghindari terja- modernisasi. wilayah wisata alam itu, “Harusnya tusan bersama, RML yang se- sumber. warga hingga berujung peng- ingatkan RML segera pindah dinya hal-hal yang tidak di- Kondisi alam objek wisata itu belum pemerintah mambangunnya, agar lama ini tinggal bersama anak, Secara terpisah, T. Sam- rusakan rumahnya. kampung sebelum massa ber- inginkan, kata Kapolsek, pihak- berubah dan pengelolaan pun masih orang yang ingin bersatai bisa mudah menantu dan empat cucunya, suddin, Ketua Tuha Peut Desa “Ibu mertua saya bukan buat nekat. Tapi peringatan itu nya telah mengamankan ke- seadanya, dimana pemuda desa hanya masuk dan tidak mengunakan jalan harus meninggalkan Desa Kumbang menjelaskan, kasus dukun. Apalagi sampai meng- tidak digubris,” katanya sembari luarga RML. Untuk sementara mengelola parkir kenderaan bermotor licin yang membahayakan, “ kata Ihsan Kumbang, paling lambat hari ini mulai mencuat Agustus guna-gunai belasan warga. minta namanya tidak ditulis. mareka disarankan pindah ke dan menjaga keamanan sekitar objek warga Alue Sungai Pinang, Kecamatan ke 10 bulan Ramadhan 1430 2009. Ketika itu sedikitnya Saya juga menilai alat bukti Sementara Kapolres Aceh rumah sanak famili mareka di wisata itu. Hampir setiap wilayah Jeumpa Minggu. H. Namun RML tidak mengin- sembilan warga mengalami yang diserahkan warga ke po- Utara AKBP Yosi Muhamartha Km 11, Lhoksukon.(cmus) kecamatan terdapat sungai alam dari Berbeda di Kawasan Jeumpa, dan Ke- dahkan keputusan itu. kesurupan dalam waktu ham- lisi terbilang berlebihan. Ma- bukit yang di jadikan warga sekitar camatan Kuala Batee, wilayah menuju “Kami memiliki bukti pir bersamaan. Warga yang sak pisau dapur yang biasa di- sebagai tempat bersantai yang wisata alam yang telah dibangun adalah tentang dugaan RML sebagai kesurupan mengaku dirasuki gunakan mencincang bawang kemudian ramai di kunjungi warga lain Kawasan Krung Beukah dan kawasan dukun santet. Antara lain, dua setan kiriman RML. Mereka dianggap alat untuk menyan- dari wilayah berbeda. Krueng Baru, serta Krueng Babahrot na- helai kain kafan ukuran kecil, menjerit histeris dengan kon- tet,” kata MHD saat ditemui Objek Pemandian Ie di Kila, mun pembangunannya bukan bertujuan tulang dua pisau silet, pisau disi tidak menentu. wartawan di Mapolsek Lhok- Kecamatan Blangpidie yang dikenal untuk wisata melainkan penanggulangan dapur dan tiga botol obat war- Kasus kesurupan itu, sam- sukon, Senin (27/9) siang. dengan Pemandian Krueng Beukah, banjir dan irigasi pertanian. na-warni. Semua bukti itu te- bung T. Samsuddin, terus Dikatakan MHD, sejak Pemandian Pucok Krueng yang terkenal Lain Abdya lain pula Aceh Selatan, lah kami serahkan ke pihak mencuat sampai akhirnya menjadi menantu RML ia be- berwajib. Berdasarkan bukti aparat desa bersama warga lum pernah melihat ibu mer- dengan legenda Rakyat putro Bungsu beberapa kawasan pemandian sudah ini pula warga sepakat memin- mengadakan rapat dadakan tuanya itu melakukan ritual dan Malem Diwa yang berada di ada yang dipoles dengan membangun ta RML meninggalkan desa,” di meunasah. Turut diundang sebagaimana biasa dilakukan Kecamatan Jeumpa, serta Krueng Panto kolam pemandian di sekitar aliran ungkap seorang warga. RML yang kala itu datang de- dukun. Karenanya ia mengaku yang berada di Kecamatan Kualabatee sungai alam itu, seperti di kaki bukit Menurutnya, selain mero- ngan berpakaian serba hitam. heran mangapa massa sampai merupakan kawasan wisata alam yang putri naga Lhok Bengkuang, kawasan bohkan bangunan rumah, Dalam rapat, RML selalu me- tega merusak rumah RML. paling ramai di kunjungi warga pada Panjupian, serta Terbangan. massa juga membakar sejum- nyangkal dirinya dukun santet Bahkan aksi tersebut mem- liburan idulfitri lalu. Pembangunan itu kebanyakan lah benda di dalamnya, terma- meski sejumlah warga menga- buat MHD bersama istri dan Hal yang sama juga terlihat di mulai efektif dan banyak di kunjungi suk benda – benda aneh yang ku memiliki bukti akurat. ke empat anaknya yang sela- Waspada/Musyawir Krueng Baru di Batas Wilayah Aceh warga tiga tahun terakhir, pengelola dianggap mengandung unsur “Tak heran rapat sedikit ri- ma ini tinggal bersama RML, DIRUSAK MASSA: Seorang warga melintas dekat puing rumah Selatan - Aceh Barat Daya, Krueng sudah mulai memberlakukan tiket magic. Malah kasur yang cuh. Sejumlah warga yang terpaksa mengungsi ke rumah RML yang dirusak massa di Desa Kumbang, Km 7, Kecamatan Babahrot, serta wilayah Tangan-Tangan. masuk dan biaya parkir.(b32) diyakini tempat tidur RML ikut emosi lalu meminumkan air tetangga. Lhoksukon, Aceh Utara. Massa menuding RML terlibat praktek dibakar. Kendati demikian, putih yang sudah didoakan ke MHD justru balik menu- dukun santet. Foto direkam Minggu (27/9).
  • 24 Otomotif WASPADA Selasa 29 September 2009 Perlunya Mobil Hybrid Bersuara Mobil hybrid dan mobil listrik lembaga swadaya masyarakat yang digunakan di film Blade Runner, buah asosiasi otomototif Jepang (Japan mengumpulkan laporan pembuatan ternyata tak lepas dari masalah. membela tunanetra, menuntut agar karya Ridley Scott. Automobile Manufacturers Associa- suara pada Nissan leaf tanggal 3 Senyapnya suara dari kendaraan produsen mobil hijau menggunakan Film yang meraih beberapa tion) dan sejumlah produsen mobil September lalu. ramahlingkunganini,menjadikendala bunyi musik untuk memudahkan penghargaan ini, memang menceri- Jepang tentang keberadaan mobil Pihak regulator di Jepang dan AS bagi kaum tunanetra. Alhasil, Nissan tunanetra ketika menyebrang jalan. takantentangkejadiandimasadepan, hybrid dan mobil listrik yang memba- belum mengeluarkan peraturan atau pun merancang bebunyian agar Terhadap permintaan musik yaitu tahun 2019. Adapun salah satu hayakan tunanetra. Kementrian perundang-undangan resmi tentang produknya bisa dikenali di jalan raya. tersebut,Tabata sontak bereaksi keras. pemainnya adalah Harrison Ford. Transportasi Jepang pun telah meng- penggunaan suara pada mobil hy- “Kamimenginginkansesuatuyang Menurutnya, bila mobil hybrid-nya Tabata menjelaskan, sistem suara gelar diskusi panel di bulan Juli dan brid.Namun,tampaknyahalinitinggal benar-benar berbeda. Kami dituntut bersuara, sudah seharusnya Nissan Leaf secara otomatis terdengar Agustus lalu dan akan mempresen- menunggu waktu saja. menginginkan suara yang mendekati diciptakan bebunyian yang indah. ketika mobil dinyalakan (stater) dan tasikannya 31 Desember mendatang. Di sisi lain, isu mobil hybrid tak suara indah yang memiliki seni,” ujar “Kami memutuskan untuk tidak secara otomatis tidak mengeluarkan Sementara itu, Komisi Keselama- bersuara ini dijadikan ladang bisnis Toshiyuki Tabata, seorang pegawai menggunakan suara musik. Jika kami suarasaatmobilmulaiberjalanhingga tanTransportasi Amerika Serikat (AS), baru. Perusahaan audio mobil yang sudah puluhan tahun bekerja harus membuat mobil ini bersuara, mencapai kecepatan 20 km per jam U.S. National Highway Traffic Safety menjual peralatannya agar dapat di divisi sound-suppression Nissan. maka kami akan membuatnya secara (12mph).Ketikakecepatanmeningkat, Administration (NHTSA) tengah dipasang di mobil dan mengeluarkan Menurut Tabata, ‘suara indah’ indah dan futuristik,” tegas Tabata. maka suara ban dan turbulensi angin menganalisa data-data kecelakaan suara tertentu. dapat mendongkrak penjualan Ungkapan Tabata pun tak main- mulai terdengar, sehingga bisa diketa- yang menyangkut tunanetra dan Perusahaan elektronik yang Nissan Leaf. “Kami tidak ingin main. Saat ini, pihaknya tengah huiolehtunanetra.“Namunjugatidak mobilhybrid.Laporanfinalakandirilis berbasis di Tokyo, Datasystem Co., menghancurkan merek mobil listrik. bekerjasama dengan beberapa menggangu pengguna jalan raya lain pada Januari 2010 mendatang. misalnya. Mereka saat ini sudah Kamihanyainginmempunyaisesuatu komposer musik dan efek suara yang non-tunanetra,” paparnya. NHTSA saat ini bekerja dengan menjual alat yang dapat mengeluar- yang dapat meningkatkan image Hollywood untuk menciptakan suara Sebagai informasi, awal tahun ini sejumlah lembaga advokasi termasuk kan16jenissuaraberbedauntukmobil merek mobil tersebut,” ujarnya. pada Nissan Leaf. Menemui tahap asosiasi tunanetra Jepang (Japanese National Federation of the Blind, yang hybrid, seperti suara kucing, suara Mobil listrik ramah lingkungan akhir, Ia bersama timnya sedang Federation for the Blind/JFB) menuntut produsen mobil hybrid kartun, bahkan suara manusia yang Nissan Leaf, baru saja diperkenalkan mencoba menggunakan suara mobil mengajukan protes terhadap membuat produknya bersuara. Dan mengucapkan kata Excuse me ‘Suara indah’ dapat mendongkrak penjualan Nissan Leaf. ke depan publik. Namun, beberapa terbang (flying cars) yang pernah Kementerian Transportasi Jepang, hingga kini, baru Nissan yang (Permisi). (inc/h09] Mini Coupe, Si Kecil Yang Tidak Bisa Dianggap Remeh MiniCoupeConcept.Nyawabaru begitu menyatu,membuat MINI menegaskan atmosfer tenang, agar bagi Mini Cooper. Dengan teknologi Coupe Concept terlihat men- pengemudi dapat lebih berkon- yang serba modern, keunikan nilai- colok,dinamis,dan modern. sentrasi. nilai tradisi masa lalu tetap diperta- Dibekali mesin 1.6 liter twin-scroll Ruangkakipengemudilebihlebar, hankan. turbocharged MINI ini mampu dengan pedal gas yang panjang Mobil two-seater tersebut me- melontarkan tenaga maksimum 155 mengerucut. Sementara tuas kemudi ngambil elemen kekuatan dasar Mini, kW/211dk;sangatbesaruntukukuran palang tiga sudah dilengkapi kontrol membenamkannya teknologi mo- mobil sekecil ini. Sebab, tenaga itu multimedia. dern, serta konsep desain bodi yang bisa memompa mobil ini menuju Urusan kenyamanan pengemudi inovatif. kecepatan 250 km/jam. EPS (Electronic Power Steering) sidah MiniCoupeConceptdipamerkan Bagaimana dengan interiornya? dibekaliuntukmembantupengemudi pertama kali pada Frankfurt Motor Begitu masuk, terasa sekali ambiens saat menyetir ataupun bermanuver. Show 2009, yangbaru saja berakhir. kental sport car dengan pilihan warna Ia akan menyesuaikan karakter Sumber inspirasinya berasal dari dan materialnya.Silakan menikmati berbelok pengemudi dalam berbagai karakteristik fundamental di setiap sentuhan kokpit yang serbaoval. kondisi jalan. Yang unik adalah, Lexus LF-Ch (kiri), dan BMW Vision EfficientDynamics. Mini: kenikmatan berkendara. Interior memang jadi penunjang bagaimana pengemudi merasakan Konstruksi dua pintu (coupe) mengikuti filosofi untuk memangkas berat mobil secara ekstrem. filosofikenikmatanmengemudi.Pintu yang lebar membuat pengemudi masuk dengan mudah.Warna hitam sensasi menyetir gokart, karena MINI Coupe Concept terasa sangat ringan dan stabil. (h09/okz) 3 Mobil Konsep Terbaik Di Frankfurt Dimensi yang kompak membu- Keseriusan pabrikan mobil yang BMW Vision EfficientDynamics dijalankan menggunakan 3 silinder coupe styling ini telah melahirkan atnya lincah dan tangkas. Panjang sedang bergulat dengan isu-isu Teknologi pencampuran bahan turbodiesel 1,5 liter. kendaraan desain tinggi. mobil ini hanya 3,7 meter, lebar 1,6 lingkungan dapat dilihat mobil-mobil bakar hibrida dengan bahan bakar Mobil ini mampu menghasilkan meter,dantinggi1,3meter.Daridepan, konsep dipajang di Internationale turbodiesel irit, membuat BMW 356 daya kuda dan torsi 590 lb ft. Mini Coupe cerminan desain Mini klasik tidak Automobil-Ausstellung (IAA) di Vision EfficientDynamics menjadi Kecepatan 100 kilometer per jam 50 tahun yang lalu, ikon Mini hilang. Frankfurt Motor Show, 15 - 27 Sep- mobil idaman masa datang. hanya ditempuh dalam 4,8 detik dari diluncurkan. Untuk mengenang Yang menonjol adalah bentuknya tember 2009. Memadukan konsep styling avant- keadaan berhenti. peristiwa itu, Inggris meluncurkan yang makin galak, berotot, dan sporty. Penerapan konsep mobil masa garde dan kinerja tinggi dalam paket mobil konsep Mini Coupe. Mobil Kontur bonnet-nya terlihat sangat depantakhanyasekadarkemewahan. hemat bahan bakar mampu Lexus LF-Ch yang populer ini memiliki 2 kursi smooth. Stripping yang mengalir dari Namunkinitelahberalihpadaefisiensi mengangkut empat penumpang. Meniru kampanye milik VW, dengan varian hatchback. Atap yang buritan, atap, bonnet,menuju grill bahan bakar kendaraan. Belakangan, Ruang mobil yang menggunakan “Think Small”, Jepang menciptakan jauh lebih rendah diimbangi dengan radiator depan serupa milik Mini pabrikan mengubah dari bahan bakar frame chassis aluminium dan dilapisi mobil mewah irit bahan bakar, Lexus membuang bangku belakang, dan Cooper S, memberikan sentuhan minyakmenjadibahanbakaralternatif dengan panel polikarbonat LF-Ch. Toyota kembali mencari meningkatkan bagasi kendaraan sporty dan dinamis. yang lebih ramah lingkungan. membentuk mobil yang aerodinamis. keberuntungan dengan menjual menjadi 5,7-8,8 kaki kubik. Mulaiheadlight,grillradiatoryang Karena itu, Road &Track memilih Konsep ini didukung oleh dua coupe 5 pintu di Eropa setelah pasar Konsep wahana Coupe memiliki berbentuk heksagon,air intakedi mobilkonsepterbaikdaripertunjukan motor listrik, satu motor pada setiap Amerika tak memiliki harapan. wheelbase dan lebar yang sama bawah,hinggakacadepan.Posisihead otomotif bergengsi di Frankfurt bar poros. Motor maju diaktifkan oleh Mobil konsep ini menggunakan sebagai standar Mini. Namun, mobil light, fog lamp, dan bemper depan saja berlalu. baterai, sedangkan bagian belakang mesin hibrida yang menggabungkan konsep ini sedikit lebih panjang dan mesin 4-silinder dengan baterai. LF- 2incilebihpendekdaripendahulunya. Ducati Luncurkan Hypermotard 796 Ch yang tidak hanya menawarkan bahan bakar yang irit, tetapi kendaraan yang diilhami Dengan mesin empat silinder 1,6 liter turbocharged bisa menghasilkan 208 tenaga kuda. (vvn/h09) Seakan tidak ingin kehilangan 2 katup per silinder sebagaimana yang ini, salah satunya rancangan baru konsumennya, Ducati Amerika berencana menyegarkan tampilan biasa tersemat pada engine Ducati. Namun, untuk urusan bobot, bobot tersentuh pada garpu atas hingga ke bawah yang mewujudkan refleksifitas Ford Figo Penantang Tata Nano kuda besi keluarga hypermotard hypermotard 796 lebih ringan. varian Hypermotard 796 ketika diajak Segmen city car yang dihuni Tata Nano di India ternyata juga diminati dengan varian terbaru. Untuk chassis, pengembangan bermanuver. Ford. Pabrikan Amerika ini berniat menghadirkan Ford Figo di negara tersebut. Seperti dikutip autoblog pada terus dilakukan pada varian terbaru Dan untuk teknis pengamanan, Keputusan untuk menghadirkan Figo di India ini dikemukakan Presiden akhir pekan, perencanaan pihak produsen ternyata dan CEO Ford, Alan Mulally dalam keterangan persnya. matang itu akan dibuktikan tidak asal-asalan. Nyatanya Hadirnya Ford Figo sebagai pemain baru di pasar India, menurut Mulally pada 2010 mendatang de- dengan tersemat rem stan- menunjukkan bahwa Ford tetap optimis untuk bersaing di pasaran small ngan mencoba meluncur- dar brembo pada pelek car Industri otomotif India yang besar. “New Ford Figo yang kami luncurkan kan varian Hypermotard depan dan belakang, menunjukkan bahwa kami serius ingin memasuki pasar India,” ucap dia. 796. Hypermotard 796 dinilai Nama Ford Figo terinspirasi dari bahasa Italia yang terkenal dengan Meskimempunyaiben- cukup aman. desain. Figo dalam bahasa Italia berarti “keren”. Ford Figo memiliki elemen tuk bodi yang sama dengan Sedangkan dari segi desain kinetik yang menyerupai Ford Focus, Ford Mondeo, dan Ford Fiesta kakaknya yakni Hypermo- fitur, Ducati hypermotard yang masing-masing sudah terkenal secara global. tard 1100, namun sang adik 796 akan banyak meng- Desain headlamps yang modern, bentuk grill dan bonnet dengan tampilan Ducati Hypermotard 796 gabungkan banyak fitur yang berbeda, spoiler yang terintegrasi serta bentuk jendela di tepi bagian mempunyai spesifikasi terutama pada warna, dan belakang, Ford Figo dilengkapi dengan sentuhan desain kinetik. mesin yang lebih kecil dari posisi tempat duduk yang Desain bentuk jendela samping yang lebar di Ford Figo menunjukkan pada varian Hypermotard lebih tinggi dari sang kakak. desain kinetis Ford yang membuat rasa nyaman dan luas bagi penumpang Land Rover LRX Segera Hadir 1100 series. Rencananya Ducati hy- Di Amerika, warga sana baru bisa mendapatkan di kursi pengemudi maupun penumpang. Jendela samping dibuat dengan pillar berbentuk B, yang mendapat sentuhan desain elegan yang menyatukan Setelah lama hanya menjadi mobil konsep, produsen mobil mewah Land permotard 796 akan me- varian tersebut di show- kedua jendela menjadi satu bentuk secara visual. Rover mengonfirmasi dimulainya produksi mobil Land Rover LRX. ngemban mesin yang room resmi Ducati pada “Kami yakin bahwa new Ford Figo akan menarik perhatian para pecinta Mobil ini akan menjalani debut pertamanya pada tahun depan dan memiliki power sebesar 80 Desember 2009. Pilihan otomotif di India,” kata Presiden dan Managing Director Ford India Michael melengkapi line up Range Rover model 2011. HP dan torsi sebesar 56 lb/ warna tersedia merah, Boneham. (h09/okz) Didesain di fasilitas canggih Land Rover di Gaydon, new Range Rover ft,disertaipendingindengan akan menjadi mobil paling kecil, ringan, dan paling efisien dibandingkan hitam, dan putih . (dto/h09) dengan line up Range Rover lainnya. S Nyaman Ketika Balik Seperti dikutip dari justauto, pada akhir pekan LRX baru berbasis crossover tersebut rencananya akan dibangun di pabrik Halewood di Merseyside. Mahindra, Raksasa Lain Dari India TIP “Ini adalah rencana dan berita baik dari produksi Range Rover kecil untuk Hingga akhir pekan, jalan raya diperkirakan masih dipadati para karyawan, dealer dan konsumen. Dan ini adalah komitmen kami dalam Di tengah gencarnya ekspansi raksasa otomotif dunia telah melakukan investasi AS$ 60 juta-AS$ 70 juta untuk pemudik yang hendak kembali ke kota setelah mudik ke kampung halaman berinvestasi untuk masa depan, untuk terus memberikan kendaraan yang ke India, produsen otomotif lokal, Mahindra & Mahindra memperbaiki penampilan SUV Scorpio sebagai pick- menyambut lebaran. relevan kepada pelanggan kami,” kata Managing director Land Rover, Phil Ltd, justru ‘nekat’ merambah pasar luar negeri. Tidak up plus dan mendirikan 336 jaringan dealer di AS. Nah, selama bepergian tersebut, terutama yang mengendarai mobil tanggung-tanggung, mereka pun membunyikan Namun, merk Mahindra saat ini masih memiliki ada baiknya memperhatikan beberapa tips berikut, agar perjalanan mudik Popham. (dto/h09) menjadi lebih menyenangkan sekaligus aman. genderang perang di pasar otomotif dunia. kendala karena tidak dikenal sama sekali oleh konsumen Setelah terimbas resesi ekonomi dunia, sektor industri AS. Para analis memperkirakan, produsen mobil ini akan Pertama yang harus diperhatikan adalah kondisi tubuh kita. Pastikan otomotif AS saat ini sedang memasuki masa pemulihan, menghadapi masalah seperti yang pernah dialami oleh kesiapannya untuk menempuh perjalanan dengan jarak yang jauh, karena terutama dari kondisi terburuknya sejak tiga dekade Hyundai, Toyota, dan Honda dulu. dipastikan akan membutuhkan konsentrasi dan ketahanan tubuh. terakhir. Situasi ini dinilai sebagai peluang bisnis bagi Di sisi lain, produsen senegaranya, Tata Motors mulai Untuk memastikan kondisi tubuh fit, tidak ada salahnya memeriksakan Mahindra. “Memang tidak populer. Tapi, ada celah,” menujukkan tajinya sebagai produsen otomotif India diri terlebih dahulu sebelum berangkat, terutama bagi anggota keluarga yang bertugas sebagai pengemudi, selain tentunya juga siapkan obat- ujar Presiden Bisnis Otomotif Mahindra Pawan Goenka yang patut diperhitungkan setelah berhasil mengakuisisi obatan yang sifatnya umum, seperti obat sakit kepala, flu dan mabuk. baru-baru ini. Jaguar Land Rover dan menciptakan mobil termurah Sekarang,tinggalmemeriksakankondisikendaraan.Selaincekkondisinya Senada dengan analis industri Car Lab Eric Noble di dunia, Tata Nano. secara rutin, ada baiknya juga untuk melakukan pengecekan terakhir menilai, kondisi otomotif AS yang sedang merosot, dapat Upaya Mahindra berekspansi tidak main-main. Dalam ke beengkel-bengkel resmi yang biasanya sudah menyiapkan program- dimanfaatkan oleh produsen mobil asal Mumbai, India rangka menggenjot volume penjualannya, Mahindra program tertentu menyambut lebaran ini. ini.”Melemahnya ekonomi dan makin murahnya harga mulai gencar berpromosi lewat jaringan televisi Aus- Oli mesin, tekanan ban, minyak rem, air radiator, wiper fluid, dan diesel bisa membantu produsen mobil India sukses tralia dengan mengibarkan slogan ‘Made for the hardest lampu, menjadi kewajiban standar untuk dicek, agar kondisinya nor- merebut konsumen mobil AS,” ujarnya places on Earth (Dibuat untuk tempat-tempat tersulit mal, sehingga dapat meminimalisir insiden yang tidak diinginkan. Mahindra berencana memasarkan mobil bak terbuka di bumi)’. Iklan TV produk pick-up Mahindra ini digarap Selainitu,kelengkapansurat-suratkendaraanpuntidakkalahpentingnya dan truk kabin ganda awal tahun depan. Produk pertama oleh sebuah agensi iklan Synchromesh Marketing yang untu dipersiapkan, selain untuk mengantisipasi pemeriksaan di tengah yang ditawarkan Mahindra untuk konsumen AS adalah berbasis di Sydney. jalan, juga untuk memastikan bahwa kendaraan yang kita gunakan resmi SUV Scorpio dan Bolero. Harga SUV akan ditawarkan “Hingga saat ini kami terfokus pada perpaduan iklan bila terjadi hal yang tidak diinginkan. Mahindra di kisaran AS$ 20.000 dan AS$ 30.000. Mahindra di lini bawah seperti media cetak, radio, web dan sponsor Setelah semua itu beres, tinggal memikirkan bagaimana mengatur Debut VW Polo 3 Pintu Terbaru kegiatan untuk dapat berkomunikasi barang bawaan. Namanya juga pulang mudik, biasanya barang bawaan pun tidak sedikit, karenanya ada beberapa hal yang bisa membantu untuk Volkswagen (VW) Polo 3 pintu akan memulai debutnya. Hatchback Jerman langsung dengan target konsumen mengaturnya. Tapi ingat, susunan barang tersebut, sebisa mungkin jangan ini pun memiliki rentang pilihan yang cukup beragam. Mulai dari yang powerfull kami para petani dan pedagang,” ujar sampai menghalangi jangkauan pandang pengemudi ke belakang. hingga ramah lingkungan. Chief Executive Officer Mahindra Au- Kalau bisa, akan lebih baik bila membagi barang bawaan menjadi Seperti diberitakan Paultan,VW Polo 3 pintu ini akan masuk dalam segmen tomotive Australia, Claire Tynan. beberapa tas kecil, ndaripada koper besar yang lebih memakan tempat. B hatchback. “VW Polo 3 pintu ini terlihat lebih maskulin dibanding yang Menurutnya, Mahindra Scorpio Kemudian susun barang bawaan tersebut, agar posisinya ‘terkunci’ satu 5 pintu,” tulis situs tersebut. Pick-Up berhasil menempati posisi sama lain, serta menyimpan barang yang sering dipakai pada tempat Urusan desain eksterior dan interiornya tidak jauh berbeda dengan generasi ketiga di Reli Brazil dos Sertoes, ajang yang mudah terjangkau. sebelumnya. Hanya saja untuk tipe ini VW menyediakan 6 pilihan mesin. reli terberat kedua setelah reli Dakar. Giliran di perjalanan, tentunya sudah tidak melupakan sabuk pengaman, Yang paling efisien adalah yang bertenaga 75 PS turbo diesel dengan Hal ini membuktukan ketangguhan serta mematuhi peraturan lalu lintas, serta menghormati para pengguna konsumsi bahan bakar 3,3 liter per 100 km. Sedangkan yang paling bertenaga dan daya tahan produk Mahindra . jalan lain. menyandang mesin 1.2 L TSI yang mampu menghasilkan daya 105 PS. “Setelahmembangunbrandlebih Selain itu, panel-panel indikator pada mobil jangan sampai lepas dari Secara rinci, ada tiga pilihan mesin diesel dan tiga mesin bensin, Yang dari dua tahun, kami ingin mencakup pantauan. tipe bensin memiliki tenaga 44 kW (60 PS), 51 kW (70 PS), dan 63 kW (85 PS). lebih luas secara efektif dengan Bila ternyata ditengah jalan terjadi insiden seperti mogok atau ban Untuk yang diesel pilihan tenaga yang dihasilkan yakni 55 kW (75 PS), 66 tambahan promosi lewat jaringan kempis, sebaiknya sebelum turun dari mobil, wajib untuk mempelajari televisi, dan kami yakin promosi ini dulu keadaan sekitar, pastikan tempat tersebut aman. Kemudian hidupkan kW (90 PS), dan 77 kW (105 PS). lampu hazard, dan pasang segitiga pengaman beberapa meter dibelakang Di Jerman, rencananya mobil ini kan dilepas mulai 12.150 Euro atau mampu meningkatkan penjualan kendaraan di lokasi-lokasi terpencil,” mobil,jangan terlalu dekat juga jangan terlalu jauh. sekira Rp175.8 juta. Tertarik? Silahkan simak gambarnya sebelum mobil ini (h09/bbg sumber) tiba di Indonesia. (okz/h09) ujarnya. (inc/h09)