SlideShare a Scribd company logo
1 of 8
Download to read offline
8/22/2023
1
1
Chapter 1: Introduction to
Software Engineering
Chapter 1 in Software Engineering Book
2
Overview
 Learning Objectives.
What is software engineering?
 Why is software engineering important?
3
By the end of this chapter, you will...
Understand what software engineering is.
 Understand why software engineering is important.
 Know answers to key questions related to the software
engineering discipline.
4
Activity
Think about all the devices and systems
that you encounter in your everyday life
which have software controlling them…
List as many as you can
Virtually all countries
depend on complex
computer-based
systems.
8/22/2023
2
5
Why is Software Engineering important?
Complex systems need a disciplined approach for designing,
developing and managing them.
6
Software Development Crises
Projects were:
• Late.
• Over budget.
• Unreliable.
• Difficult to maintain.
• Performed poorly.
7
Software errors….the cost
Errors in computer software can have
devastating effects.
8
Software Crisis
Example 1: 2009,Computer glitch delays flights
Saturday 3rd October 2009-London, England (CNN)
• Dozens of flights from the UK were delayed Saturday after
a glitch in an air traffic control system in Scotland, but the
problem was fixed a few hours later.
• The agency said it reverted to backup equipment as
engineering worked on the system.
• The problem did not create a safety issue but could cause
delays in flights.
• Read more at:
http://edition.cnn.com/2009/WORLD/europe/10/03/uk.fl
ights.delayed
8/22/2023
3
9
Software Crisis
Example 2: Ariane 5 Explosion
• European Space Agency spent 10 years and $7
billion to produce Ariane 5.
• Crash after 36.7 seconds.
• Caused by an overflow error. Trying to store a 64-bit
number into a 16-bit space.
• Watch the video:
http://www.youtube.com/watch?v=z-r9cYp3tTE
10
Software Crisis
Example 3: 1992, London Ambulance Service
• Considered the largest ambulance service in the
world.
• Overloaded problem.
• It was unable to keep track of the ambulances
and their statuses. Sending multiple units to some
locations and no units to other locations.
• Generates many exceptions messages.
• 46 deaths.
11
Therefore…
A well-disciplined approach to software
development and management is
necessary. This is called engineering.
12
Software Engineering
 The term software engineering first appeared in the 1968 NATO
Software Engineering Conference and was meant to provoke
thought regarding what was then called the “software crisis”..
 “.. An engineering discipline that is concerned with all aspects of
software production from the early stages of system specification
to maintaining the system after it has gone into use.” Sommerville,
pg.7
8/22/2023
4
Software
Software
Programs
Programs
Documentation
Documentation
Data
Data
13
What is Software?
System
Documentation
User
Documentation
14
Types of Software
• Generic products.
• Stand-alone systems that are marketed and sold to any customer who wishes to buy
them.
• Examples – PC software such as graphics programs, project management tools;
CAD software; software for specific markets such as appointments systems for
dentists.
• The specification of what the software should do is owned by the software developer
and decisions on software change are made by the developer.
• Customized or bespoke products.
• Software that is commissioned by a specific customer to meet their own needs.
• Examples – embedded control systems, air traffic control software, traffic monitoring
systems.
• The specification of what the software should do is owned by the customer for the
software and they make decisions on software changes that are required.
15
Software Engineering vs. Computer Science
“Computer science is no more about computers than
astronomy is about telescopes.” Edsger Dijkstra
Computer Science
• Theory.
• Fundamentals.
Software Engineering
• Practicalities of software
design, development and
delivery.
16
Software Engineering vs. Systems Engineering
Systems Engineering:
 Interdisciplinary engineering field (computer, software, and process eng.).
 Focuses on how complex engineering projects should be designed and managed.
Systems Engineering
• All aspects of computer-
based systems
development: HW + SW +
Process.
• Older than SWE.
Software Engineering
• Deals with the design,
development and delivery
of SW.
• Is part of Systems
Engineering.
8/22/2023
5
17
Question Answer
What is software? Computer programs and associated documentation. Software
products may be developed for a particular customer or may
be developed for a general market.
What are the attributes of good software? Good software should deliver the required functionality and
performance to the user and should be maintainable,
dependable and usable.
What is software engineering? Software engineering is an engineering discipline that is
concerned with all aspects of software production.
What are the fundamental software
engineering activities?
Software specification, software development, software
validation and software evolution.
What is the difference between software
engineering and computer science?
Computer science focuses on theory and fundamentals;
software engineering is concerned with the practicalities of
developing and delivering useful software.
What is the difference between software
engineering and system engineering?
System engineering is concerned with all aspects of
computer-based systems development including hardware,
software and process engineering. Software engineering is
part of this more general process.
Frequently asked questions about software
engineering
18
Frequently asked questions about software
engineering
Question Answer
What are the key challenges facing software
engineering?
Coping with increasing diversity, demands for reduced delivery
times and developing trustworthy software.
What are the costs of software engineering? Roughly 60% of software costs are development costs, 40% are
testing costs. For custom software, evolution costs often
exceed development costs.
What are the best software engineering
techniques and methods?
While all software projects have to be professionally managed
and developed, different techniques are appropriate for
different types of system. For example, games should always be
developed using a series of prototypes whereas safety critical
control systems require a complete and analyzable
specification to be developed. You can’t, therefore, say that
one method is better than another.
What differences has the web made to
software engineering?
The web has led to the availability of software services and the
possibility of developing highly distributed service-based
systems. Web-based systems development has led to
important advances in programming languages and software
reuse.
19
What is a Software Process?
 Activities and results that produce a software product:
SW Process Activity What is going on there?
Specification
What does the customer need?
What are the constraints?
Development Design & programming.
Validation Checking whether it meets requirements.
Evolution Modifications (e.g. customer/market).
20
What is a Software Process Model?
 Description of the software process that represents one view, such
as the activities, data or roles of people involved.
Examples of views Focus on…
Workflow
Activities = human actions.
What is input, output, and dependencies.
Dataflow
Activities = transformations of information.
How the input is transformed into output.
Role/Action
What is the role of people involved in each step of
the process?
8/22/2023
6
21
Software Process Models
Waterfall approach Iterative development
Component-Based
Software Engineering CBSE
assembled form existing
components
22
The Cost of Software Engineering
 Depends on:
 The process used, and
 The type of software being developed.
 Each generic approach has a different profile of cost distribution.
 Roughly 60% of costs are development costs, 40% are testing costs.
 For custom software, evolution costs often exceed development
costs.
23
Cost distribution
Custom software development (Bespoke)
Software Model
Cost units
Cost distribution
Software development activity
Waterfall Model
0 25 50 75 100
Specification Design Development Integration and testing
Iterative Development
0 25 50 75 100
Specification Iterative Development System testing
Component-basedSoftware Engineering
0 25 50 75 100
Specification Development Integration and testing
Developmentand evolutioncosts for long-lifetime systems
0 100 200 300 400
System development System evolution
24
Cost distribution
Generic software development
Product development costs
0 25 50 75 100
Specification Development System testing
8/22/2023
7
25
What is CASE?
 Computer Aided Software Engineering.
 Programs that support:
 Requirements analysis.
 System modeling.
 Debugging.
 Testing.
26
Attributes of good software
 Functional attributes (performance; what the system does).
 Non-functional attributes (quality; how the system does it).
Product Characteristic Description
Maintainability Evolution qualities such as Testability, extensibility.
Dependability Reliability, security, safety.
Efficiency Response time, processing time, memory utilization.
Usability Easy to learn how to use the system by target users.
Efficient to use the system by users to accomplish a task.
Satisfying to use by intended users.
27
Activity
 What are the key attributes for..
Interactive game Banking system
Cardiac monitor in an ICU
unit
Players, score, scenes,
theme.
Client accounts, stocks
bonds, money transfers.
heart rate, temperature,
blood pressure.
28
Challenges facing software engineering
Challenge Why? Software needs to ..
Heterogeneity
Different computers, different
platforms, different support systems.
Cope with this variability.
Delivery
Businesses are more responsive
 supporting software needs to
evolve as rapidly.
Be delivered in shorter time
without compromising quality.
Trust
Software is a part of many aspects of
our lives (work, study, leisure).
Demonstrate that it can be
trusted by users.
8/22/2023
8
29
References
 PRESS&SUN-BULLETIN, The Binghamton Press Co., Binghamton, NY, October 1,1999.
 “Software Hell: Is there a way out?”, BUSINESS WEEK, December 6, 1999.
 IEEE Standards Collection: Software Engineering, IEEE standard 610.12-1990, IEEE 1993.
 Sommerville, Ian “Software Engineering”, 9th edition, Addison-Wesley.

More Related Content

Similar to lecture 1.pdf

Week_01-Intro to Software Engineering-1.ppt
Week_01-Intro to Software Engineering-1.pptWeek_01-Intro to Software Engineering-1.ppt
Week_01-Intro to Software Engineering-1.ppt23017156038
 
Ian Sommerville, Software Engineering, 9th Edition Ch1
Ian Sommerville,  Software Engineering, 9th Edition Ch1Ian Sommerville,  Software Engineering, 9th Edition Ch1
Ian Sommerville, Software Engineering, 9th Edition Ch1Mohammed Romi
 
Software Engineering PPT Unit I.pptx
Software Engineering PPT Unit I.pptxSoftware Engineering PPT Unit I.pptx
Software Engineering PPT Unit I.pptxomgadekar25
 
Software Engineering
Software EngineeringSoftware Engineering
Software EngineeringMohamed Essam
 
Chapter 01
Chapter 01Chapter 01
Chapter 01ryan aja
 
SE chp1 update and learning management .pptx
SE chp1 update and learning management .pptxSE chp1 update and learning management .pptx
SE chp1 update and learning management .pptxssuserdee5bb1
 
Unit 1 importance ofsoftengg_b.tech iii year
Unit 1  importance ofsoftengg_b.tech iii yearUnit 1  importance ofsoftengg_b.tech iii year
Unit 1 importance ofsoftengg_b.tech iii yearPreeti Mishra
 
Unit 1 introduction tosoftengg_mba tech ii year
Unit 1  introduction tosoftengg_mba tech ii yearUnit 1  introduction tosoftengg_mba tech ii year
Unit 1 introduction tosoftengg_mba tech ii yearPreeti Mishra
 
Lecture-1,2-Introduction to SE.pptx
Lecture-1,2-Introduction to SE.pptxLecture-1,2-Introduction to SE.pptx
Lecture-1,2-Introduction to SE.pptxYaseenNazir3
 
SWE-610-Lec-1-Software-Intro duction(1).pptx
SWE-610-Lec-1-Software-Intro duction(1).pptxSWE-610-Lec-1-Software-Intro duction(1).pptx
SWE-610-Lec-1-Software-Intro duction(1).pptxnohaaalrajhi
 
What is software engineering
What is software engineeringWhat is software engineering
What is software engineeringJennifer Polack
 

Similar to lecture 1.pdf (20)

SE
SESE
SE
 
Intro
IntroIntro
Intro
 
Introduction to Software Engineering
Introduction to Software EngineeringIntroduction to Software Engineering
Introduction to Software Engineering
 
Week_01-Intro to Software Engineering-1.ppt
Week_01-Intro to Software Engineering-1.pptWeek_01-Intro to Software Engineering-1.ppt
Week_01-Intro to Software Engineering-1.ppt
 
Software Engineering1-1.pptx
Software Engineering1-1.pptxSoftware Engineering1-1.pptx
Software Engineering1-1.pptx
 
SE Lecture 1.ppt
SE Lecture 1.pptSE Lecture 1.ppt
SE Lecture 1.ppt
 
SE Lecture 1.ppt
SE Lecture 1.pptSE Lecture 1.ppt
SE Lecture 1.ppt
 
Software Engineering and Introduction, Activities and ProcessModels
Software Engineering and Introduction, Activities and ProcessModels Software Engineering and Introduction, Activities and ProcessModels
Software Engineering and Introduction, Activities and ProcessModels
 
Ian Sommerville, Software Engineering, 9th Edition Ch1
Ian Sommerville,  Software Engineering, 9th Edition Ch1Ian Sommerville,  Software Engineering, 9th Edition Ch1
Ian Sommerville, Software Engineering, 9th Edition Ch1
 
Software Engineering PPT Unit I.pptx
Software Engineering PPT Unit I.pptxSoftware Engineering PPT Unit I.pptx
Software Engineering PPT Unit I.pptx
 
Software Engineering
Software EngineeringSoftware Engineering
Software Engineering
 
Chapter 01
Chapter 01Chapter 01
Chapter 01
 
SE chp1 update and learning management .pptx
SE chp1 update and learning management .pptxSE chp1 update and learning management .pptx
SE chp1 update and learning management .pptx
 
Chapter 01
Chapter 01Chapter 01
Chapter 01
 
Unit 1 importance ofsoftengg_b.tech iii year
Unit 1  importance ofsoftengg_b.tech iii yearUnit 1  importance ofsoftengg_b.tech iii year
Unit 1 importance ofsoftengg_b.tech iii year
 
Unit 1 introduction tosoftengg_mba tech ii year
Unit 1  introduction tosoftengg_mba tech ii yearUnit 1  introduction tosoftengg_mba tech ii year
Unit 1 introduction tosoftengg_mba tech ii year
 
Lecture-1,2-Introduction to SE.pptx
Lecture-1,2-Introduction to SE.pptxLecture-1,2-Introduction to SE.pptx
Lecture-1,2-Introduction to SE.pptx
 
SWE-610-Lec-1-Software-Intro duction(1).pptx
SWE-610-Lec-1-Software-Intro duction(1).pptxSWE-610-Lec-1-Software-Intro duction(1).pptx
SWE-610-Lec-1-Software-Intro duction(1).pptx
 
Chapter 01
Chapter 01Chapter 01
Chapter 01
 
What is software engineering
What is software engineeringWhat is software engineering
What is software engineering
 

More from ssuser2d043c

sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptssuser2d043c
 
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytgh
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytghch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytgh
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytghssuser2d043c
 
cocomo-220726173706-141e0dsdsd8f0 (1).pdf
cocomo-220726173706-141e0dsdsd8f0 (1).pdfcocomo-220726173706-141e0dsdsd8f0 (1).pdf
cocomo-220726173706-141e0dsdsd8f0 (1).pdfssuser2d043c
 
pointer in c through addressing modes esntial in c
pointer in c through addressing modes esntial in cpointer in c through addressing modes esntial in c
pointer in c through addressing modes esntial in cssuser2d043c
 
System engineering is related to software engineering
System engineering is related to software engineeringSystem engineering is related to software engineering
System engineering is related to software engineeringssuser2d043c
 
Session 01 (Introduction).pdf
Session 01 (Introduction).pdfSession 01 (Introduction).pdf
Session 01 (Introduction).pdfssuser2d043c
 
STATE DIAGRAM.pptx
STATE DIAGRAM.pptxSTATE DIAGRAM.pptx
STATE DIAGRAM.pptxssuser2d043c
 

More from ssuser2d043c (12)

sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
 
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytgh
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytghch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytgh
ch11lect1.pptghjgjhjkkljkkkjkjkjljkjhytytgh
 
cocomo-220726173706-141e0dsdsd8f0 (1).pdf
cocomo-220726173706-141e0dsdsd8f0 (1).pdfcocomo-220726173706-141e0dsdsd8f0 (1).pdf
cocomo-220726173706-141e0dsdsd8f0 (1).pdf
 
pointer in c through addressing modes esntial in c
pointer in c through addressing modes esntial in cpointer in c through addressing modes esntial in c
pointer in c through addressing modes esntial in c
 
System engineering is related to software engineering
System engineering is related to software engineeringSystem engineering is related to software engineering
System engineering is related to software engineering
 
1_Overview.pdf
1_Overview.pdf1_Overview.pdf
1_Overview.pdf
 
software
softwaresoftware
software
 
pig intro.pdf
pig intro.pdfpig intro.pdf
pig intro.pdf
 
Session 01 (Introduction).pdf
Session 01 (Introduction).pdfSession 01 (Introduction).pdf
Session 01 (Introduction).pdf
 
data 1.ppt
data 1.pptdata 1.ppt
data 1.ppt
 
IntroToOOP.ppt
IntroToOOP.pptIntroToOOP.ppt
IntroToOOP.ppt
 
STATE DIAGRAM.pptx
STATE DIAGRAM.pptxSTATE DIAGRAM.pptx
STATE DIAGRAM.pptx
 

Recently uploaded

complete construction, environmental and economics information of biomass com...
complete construction, environmental and economics information of biomass com...complete construction, environmental and economics information of biomass com...
complete construction, environmental and economics information of biomass com...asadnawaz62
 
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)dollysharma2066
 
IVE Industry Focused Event - Defence Sector 2024
IVE Industry Focused Event - Defence Sector 2024IVE Industry Focused Event - Defence Sector 2024
IVE Industry Focused Event - Defence Sector 2024Mark Billinghurst
 
What are the advantages and disadvantages of membrane structures.pptx
What are the advantages and disadvantages of membrane structures.pptxWhat are the advantages and disadvantages of membrane structures.pptx
What are the advantages and disadvantages of membrane structures.pptxwendy cai
 
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdf
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdfCCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdf
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdfAsst.prof M.Gokilavani
 
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)Dr SOUNDIRARAJ N
 
EduAI - E learning Platform integrated with AI
EduAI - E learning Platform integrated with AIEduAI - E learning Platform integrated with AI
EduAI - E learning Platform integrated with AIkoyaldeepu123
 
Application of Residue Theorem to evaluate real integrations.pptx
Application of Residue Theorem to evaluate real integrations.pptxApplication of Residue Theorem to evaluate real integrations.pptx
Application of Residue Theorem to evaluate real integrations.pptx959SahilShah
 
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort service
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort serviceGurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort service
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort servicejennyeacort
 
main PPT.pptx of girls hostel security using rfid
main PPT.pptx of girls hostel security using rfidmain PPT.pptx of girls hostel security using rfid
main PPT.pptx of girls hostel security using rfidNikhilNagaraju
 
Oxy acetylene welding presentation note.
Oxy acetylene welding presentation note.Oxy acetylene welding presentation note.
Oxy acetylene welding presentation note.eptoze12
 
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdf
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdfCCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdf
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdfAsst.prof M.Gokilavani
 
DATA ANALYTICS PPT definition usage example
DATA ANALYTICS PPT definition usage exampleDATA ANALYTICS PPT definition usage example
DATA ANALYTICS PPT definition usage examplePragyanshuParadkar1
 
pipeline in computer architecture design
pipeline in computer architecture  designpipeline in computer architecture  design
pipeline in computer architecture designssuser87fa0c1
 
Introduction to Machine Learning Unit-3 for II MECH
Introduction to Machine Learning Unit-3 for II MECHIntroduction to Machine Learning Unit-3 for II MECH
Introduction to Machine Learning Unit-3 for II MECHC Sai Kiran
 
Arduino_CSE ece ppt for working and principal of arduino.ppt
Arduino_CSE ece ppt for working and principal of arduino.pptArduino_CSE ece ppt for working and principal of arduino.ppt
Arduino_CSE ece ppt for working and principal of arduino.pptSAURABHKUMAR892774
 

Recently uploaded (20)

Design and analysis of solar grass cutter.pdf
Design and analysis of solar grass cutter.pdfDesign and analysis of solar grass cutter.pdf
Design and analysis of solar grass cutter.pdf
 
complete construction, environmental and economics information of biomass com...
complete construction, environmental and economics information of biomass com...complete construction, environmental and economics information of biomass com...
complete construction, environmental and economics information of biomass com...
 
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)
Call Us ≽ 8377877756 ≼ Call Girls In Shastri Nagar (Delhi)
 
IVE Industry Focused Event - Defence Sector 2024
IVE Industry Focused Event - Defence Sector 2024IVE Industry Focused Event - Defence Sector 2024
IVE Industry Focused Event - Defence Sector 2024
 
What are the advantages and disadvantages of membrane structures.pptx
What are the advantages and disadvantages of membrane structures.pptxWhat are the advantages and disadvantages of membrane structures.pptx
What are the advantages and disadvantages of membrane structures.pptx
 
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdf
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdfCCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdf
CCS355 Neural Network & Deep Learning Unit II Notes with Question bank .pdf
 
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)
UNIT III ANALOG ELECTRONICS (BASIC ELECTRONICS)
 
EduAI - E learning Platform integrated with AI
EduAI - E learning Platform integrated with AIEduAI - E learning Platform integrated with AI
EduAI - E learning Platform integrated with AI
 
Application of Residue Theorem to evaluate real integrations.pptx
Application of Residue Theorem to evaluate real integrations.pptxApplication of Residue Theorem to evaluate real integrations.pptx
Application of Residue Theorem to evaluate real integrations.pptx
 
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort service
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort serviceGurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort service
Gurgaon ✡️9711147426✨Call In girls Gurgaon Sector 51 escort service
 
main PPT.pptx of girls hostel security using rfid
main PPT.pptx of girls hostel security using rfidmain PPT.pptx of girls hostel security using rfid
main PPT.pptx of girls hostel security using rfid
 
Oxy acetylene welding presentation note.
Oxy acetylene welding presentation note.Oxy acetylene welding presentation note.
Oxy acetylene welding presentation note.
 
young call girls in Rajiv Chowk🔝 9953056974 🔝 Delhi escort Service
young call girls in Rajiv Chowk🔝 9953056974 🔝 Delhi escort Serviceyoung call girls in Rajiv Chowk🔝 9953056974 🔝 Delhi escort Service
young call girls in Rajiv Chowk🔝 9953056974 🔝 Delhi escort Service
 
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdf
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdfCCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdf
CCS355 Neural Networks & Deep Learning Unit 1 PDF notes with Question bank .pdf
 
DATA ANALYTICS PPT definition usage example
DATA ANALYTICS PPT definition usage exampleDATA ANALYTICS PPT definition usage example
DATA ANALYTICS PPT definition usage example
 
Call Us -/9953056974- Call Girls In Vikaspuri-/- Delhi NCR
Call Us -/9953056974- Call Girls In Vikaspuri-/- Delhi NCRCall Us -/9953056974- Call Girls In Vikaspuri-/- Delhi NCR
Call Us -/9953056974- Call Girls In Vikaspuri-/- Delhi NCR
 
pipeline in computer architecture design
pipeline in computer architecture  designpipeline in computer architecture  design
pipeline in computer architecture design
 
Introduction to Machine Learning Unit-3 for II MECH
Introduction to Machine Learning Unit-3 for II MECHIntroduction to Machine Learning Unit-3 for II MECH
Introduction to Machine Learning Unit-3 for II MECH
 
POWER SYSTEMS-1 Complete notes examples
POWER SYSTEMS-1 Complete notes  examplesPOWER SYSTEMS-1 Complete notes  examples
POWER SYSTEMS-1 Complete notes examples
 
Arduino_CSE ece ppt for working and principal of arduino.ppt
Arduino_CSE ece ppt for working and principal of arduino.pptArduino_CSE ece ppt for working and principal of arduino.ppt
Arduino_CSE ece ppt for working and principal of arduino.ppt
 

lecture 1.pdf

  • 1. 8/22/2023 1 1 Chapter 1: Introduction to Software Engineering Chapter 1 in Software Engineering Book 2 Overview  Learning Objectives. What is software engineering?  Why is software engineering important? 3 By the end of this chapter, you will... Understand what software engineering is.  Understand why software engineering is important.  Know answers to key questions related to the software engineering discipline. 4 Activity Think about all the devices and systems that you encounter in your everyday life which have software controlling them… List as many as you can Virtually all countries depend on complex computer-based systems.
  • 2. 8/22/2023 2 5 Why is Software Engineering important? Complex systems need a disciplined approach for designing, developing and managing them. 6 Software Development Crises Projects were: • Late. • Over budget. • Unreliable. • Difficult to maintain. • Performed poorly. 7 Software errors….the cost Errors in computer software can have devastating effects. 8 Software Crisis Example 1: 2009,Computer glitch delays flights Saturday 3rd October 2009-London, England (CNN) • Dozens of flights from the UK were delayed Saturday after a glitch in an air traffic control system in Scotland, but the problem was fixed a few hours later. • The agency said it reverted to backup equipment as engineering worked on the system. • The problem did not create a safety issue but could cause delays in flights. • Read more at: http://edition.cnn.com/2009/WORLD/europe/10/03/uk.fl ights.delayed
  • 3. 8/22/2023 3 9 Software Crisis Example 2: Ariane 5 Explosion • European Space Agency spent 10 years and $7 billion to produce Ariane 5. • Crash after 36.7 seconds. • Caused by an overflow error. Trying to store a 64-bit number into a 16-bit space. • Watch the video: http://www.youtube.com/watch?v=z-r9cYp3tTE 10 Software Crisis Example 3: 1992, London Ambulance Service • Considered the largest ambulance service in the world. • Overloaded problem. • It was unable to keep track of the ambulances and their statuses. Sending multiple units to some locations and no units to other locations. • Generates many exceptions messages. • 46 deaths. 11 Therefore… A well-disciplined approach to software development and management is necessary. This is called engineering. 12 Software Engineering  The term software engineering first appeared in the 1968 NATO Software Engineering Conference and was meant to provoke thought regarding what was then called the “software crisis”..  “.. An engineering discipline that is concerned with all aspects of software production from the early stages of system specification to maintaining the system after it has gone into use.” Sommerville, pg.7
  • 4. 8/22/2023 4 Software Software Programs Programs Documentation Documentation Data Data 13 What is Software? System Documentation User Documentation 14 Types of Software • Generic products. • Stand-alone systems that are marketed and sold to any customer who wishes to buy them. • Examples – PC software such as graphics programs, project management tools; CAD software; software for specific markets such as appointments systems for dentists. • The specification of what the software should do is owned by the software developer and decisions on software change are made by the developer. • Customized or bespoke products. • Software that is commissioned by a specific customer to meet their own needs. • Examples – embedded control systems, air traffic control software, traffic monitoring systems. • The specification of what the software should do is owned by the customer for the software and they make decisions on software changes that are required. 15 Software Engineering vs. Computer Science “Computer science is no more about computers than astronomy is about telescopes.” Edsger Dijkstra Computer Science • Theory. • Fundamentals. Software Engineering • Practicalities of software design, development and delivery. 16 Software Engineering vs. Systems Engineering Systems Engineering:  Interdisciplinary engineering field (computer, software, and process eng.).  Focuses on how complex engineering projects should be designed and managed. Systems Engineering • All aspects of computer- based systems development: HW + SW + Process. • Older than SWE. Software Engineering • Deals with the design, development and delivery of SW. • Is part of Systems Engineering.
  • 5. 8/22/2023 5 17 Question Answer What is software? Computer programs and associated documentation. Software products may be developed for a particular customer or may be developed for a general market. What are the attributes of good software? Good software should deliver the required functionality and performance to the user and should be maintainable, dependable and usable. What is software engineering? Software engineering is an engineering discipline that is concerned with all aspects of software production. What are the fundamental software engineering activities? Software specification, software development, software validation and software evolution. What is the difference between software engineering and computer science? Computer science focuses on theory and fundamentals; software engineering is concerned with the practicalities of developing and delivering useful software. What is the difference between software engineering and system engineering? System engineering is concerned with all aspects of computer-based systems development including hardware, software and process engineering. Software engineering is part of this more general process. Frequently asked questions about software engineering 18 Frequently asked questions about software engineering Question Answer What are the key challenges facing software engineering? Coping with increasing diversity, demands for reduced delivery times and developing trustworthy software. What are the costs of software engineering? Roughly 60% of software costs are development costs, 40% are testing costs. For custom software, evolution costs often exceed development costs. What are the best software engineering techniques and methods? While all software projects have to be professionally managed and developed, different techniques are appropriate for different types of system. For example, games should always be developed using a series of prototypes whereas safety critical control systems require a complete and analyzable specification to be developed. You can’t, therefore, say that one method is better than another. What differences has the web made to software engineering? The web has led to the availability of software services and the possibility of developing highly distributed service-based systems. Web-based systems development has led to important advances in programming languages and software reuse. 19 What is a Software Process?  Activities and results that produce a software product: SW Process Activity What is going on there? Specification What does the customer need? What are the constraints? Development Design & programming. Validation Checking whether it meets requirements. Evolution Modifications (e.g. customer/market). 20 What is a Software Process Model?  Description of the software process that represents one view, such as the activities, data or roles of people involved. Examples of views Focus on… Workflow Activities = human actions. What is input, output, and dependencies. Dataflow Activities = transformations of information. How the input is transformed into output. Role/Action What is the role of people involved in each step of the process?
  • 6. 8/22/2023 6 21 Software Process Models Waterfall approach Iterative development Component-Based Software Engineering CBSE assembled form existing components 22 The Cost of Software Engineering  Depends on:  The process used, and  The type of software being developed.  Each generic approach has a different profile of cost distribution.  Roughly 60% of costs are development costs, 40% are testing costs.  For custom software, evolution costs often exceed development costs. 23 Cost distribution Custom software development (Bespoke) Software Model Cost units Cost distribution Software development activity Waterfall Model 0 25 50 75 100 Specification Design Development Integration and testing Iterative Development 0 25 50 75 100 Specification Iterative Development System testing Component-basedSoftware Engineering 0 25 50 75 100 Specification Development Integration and testing Developmentand evolutioncosts for long-lifetime systems 0 100 200 300 400 System development System evolution 24 Cost distribution Generic software development Product development costs 0 25 50 75 100 Specification Development System testing
  • 7. 8/22/2023 7 25 What is CASE?  Computer Aided Software Engineering.  Programs that support:  Requirements analysis.  System modeling.  Debugging.  Testing. 26 Attributes of good software  Functional attributes (performance; what the system does).  Non-functional attributes (quality; how the system does it). Product Characteristic Description Maintainability Evolution qualities such as Testability, extensibility. Dependability Reliability, security, safety. Efficiency Response time, processing time, memory utilization. Usability Easy to learn how to use the system by target users. Efficient to use the system by users to accomplish a task. Satisfying to use by intended users. 27 Activity  What are the key attributes for.. Interactive game Banking system Cardiac monitor in an ICU unit Players, score, scenes, theme. Client accounts, stocks bonds, money transfers. heart rate, temperature, blood pressure. 28 Challenges facing software engineering Challenge Why? Software needs to .. Heterogeneity Different computers, different platforms, different support systems. Cope with this variability. Delivery Businesses are more responsive  supporting software needs to evolve as rapidly. Be delivered in shorter time without compromising quality. Trust Software is a part of many aspects of our lives (work, study, leisure). Demonstrate that it can be trusted by users.
  • 8. 8/22/2023 8 29 References  PRESS&SUN-BULLETIN, The Binghamton Press Co., Binghamton, NY, October 1,1999.  “Software Hell: Is there a way out?”, BUSINESS WEEK, December 6, 1999.  IEEE Standards Collection: Software Engineering, IEEE standard 610.12-1990, IEEE 1993.  Sommerville, Ian “Software Engineering”, 9th edition, Addison-Wesley.