SlideShare a Scribd company logo
1 of 1
Download to read offline
KPC-2 Amino Acid Sequence and KPC-3 Substitution
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDT
GSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALV
PWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMR
SIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQR
QQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVW
PTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ(GSEN)
Abstract Results
References
Summary
1. Centers for Disease Control and Prevention, Antibiotic
resistance threats in the United States, 2013.
2. Hayden M and Lin MY and Lolans K. et al. “Prevention of
Colonization and Infection by Klebsiella pneumoniae
Carbapenemase–Producing Enterobacteriaceae in Long-
term Acute-Care Hospitals.” Clinical Infectious Diseases
2015 Apr 15;60(8):1153-61
3. Marchaim D and Chopra T and Bogan C, et al. “The
burden of multidrug resistant organisms on tertiary
hospitals posed by patients with recent stays in long-term
acute care facilities.” American Journal of Infection
Control 2012 Oct;40(8):760-5
4. Kashikar A and Zhang Y and Tulpule A and Dunn M and
Herman K and Denys G and Bush K. ICAAC, Abstract C-
1095. (2015)
5. Bush K and Jacoby GA. “Updated Functional Classification
of Β-Lactamases .” Antimicrobial Agents and
Chemotherapy 54.3 (2010): 969–976.
KPC is a β-lactamase family that was first discovered on a
plasmid in K. pneumoniae, but since has been shown that
other Enterobacteriaceae can produce it. KPCs are causing
problems for healthcare due to the high resistance to current
antibiotics that is seen in pathogens carrying these enzymes.
KPC-producing organisms are part of a much larger group of
bacteria known as Carbapenem Resistant Enterobacteriaceae
(CRE). CRE, according to the CDC in a 2013 report, represent an
“immediate public health threat that requires urgent and
aggressive action.”[1] KPC-producing organisms are among the
most common CRE worldwide.[2] Carbapenemases are
organized into two groups: serine carbapenemases that have a
serine residue at the active site and metallo-β-lactamases
(MBLs) that have at least one zinc ion at its active site.[5]
Recommendations to reduce the occurrence of resistance
included patient screening and increased infection control.
Health centers and hospitals are at high risk spreading KPC
producing organisms. [3]
Indiana University Health began screening for CRE in 2009 with
former students of the biotech program creating susceptibility
profiles and screening for β-lactamases.[4] This study
compares the incidence of KPC from 2009-2013 [4] and 2014.
Materials and Methods
Acknowledgments
We thank previous Biotechnology students for their
contributions to this project, especially Yunliang
Zhang, Ankita Kashikar and Thomas Amick. We also
thank Dr. Rasheda Sultana for her advice and Dr.
Gerald Denys for providing the isolates.
• This study looked at isolates from a 2014 surveillance collection of
CRE in patient isolates that were located in two large hospitals
and fourteen care centers within the Indiana Health system.
• This study looked at 56 organism including K. pneumoniae (38), E.
cloacae (10), E. coli (4), E. aerogenes (2), C. freundii (1) and K.
oxytoca (1).
• At IUB, isolates were grown on using LB agar and LB medium
containing ampicillin
• Plasmid DNA isolated from CRE strains using a plasmid miniprep
kit. The purified plasmids were screened for the presence of the
gene blaKPC, using PCR and gel electrophoresis. The following
primers were used:
• Full gene sequencing of blaKPC was performed using Big Dye 3.1
kit. Alignments of gene sequences were analyzed using ExPASy,
BLAST and Clustal W.
Presented at 2016 Research Symposium & Poster Fair April 2, 2016 Bloomington, IN
Introduction
KPC
Forward 5’ ATGTCACTGTATCGCCGTCT 3’
Reverse 5’ TTTTCAGAGCCTTACTGCCC 3’
In this study, two types of KPCs were observed, KPC-2 and KPC-3.
For Central Indiana, KPC-2 and KPC-3 are the only KPC variants that
have been observed.
Below is the amino acid sequence for KPC-2. Brackets are added to
denote the position of the primers used and the highlighted amino
acid indicates the position and substitution of KPC-3.
Forward
Primer
Reverse
Primer
KPC-3 Y
1.5kpb
1.0kpb
0.5kpb
184182179177176173 185+Con 186 SM8
ECL
19 EA3 -Con 175 187
ECL
20 183
Image of PCR product gels. Three-digits number refer to Klebsiella
pneumoniae isolates and ECL is Enterobacter cloacae. The KPC
gene is 893 base pairs long.
When a positive band was observed the PCR product was then
sequenced.
KPC genetic screening results from 2014 isolates. In total
there were 41 KPC producing organisms observed.
Antibiotic resistance is on the rise and poses a grave threat to
the public. A common resistance mechanism is through the
production of enzymes called β-lactamases that render β-
lactam antibiotics inert and unable to kill the bacteria. The goal
of my lab is to study the bacteria that produce these enzymes
in the Carbapenem-Resistant Enterobacteriaceae or CRE
Project. The purpose of my specific project is to identify various
β-lactamases in clinical isolates from Indianapolis area hospitals
and healthcare centers. β-Lactamase genes I screened for
include those that code for TEM, CTX-M and Klebsiella
pneumoniae carbapenemase (KPC), enzymes frequently
identified in historical CRE from Indiana. This poster will only
focus on KPC findings.
The screening process for these isolates included growing the
cells in a LB broth containing ampicillin. The cells then
underwent Qiagen plasmid miniprep to isolate the plasmids.
PCR was performed on the plasmids to identify a known β-
lactamase gene blaKPC. If a positive signal was observed on a
Southern blot, the sample was submitted for sequencing for
confirmation of the presence of the gene.
Isolates collected from 2014 (n=56) have been screened for
genes producing KPC β-lactamases. Among these isolates, at
least 41 carry KPC genes. Of the 45 KPC-producing isolates, 3
produce KPC-2 and 28 produce KPC-3 enzymes. Additional
isolates from 2015 are being screened for comparative
purposes.
The majority of CRE from Indianapolis produce KPC
carbapenemases, with a predominance of KPC-3 to KPC-2
enzymes. Additional monitoring will be necessary to determine
whether other mechanisms of resistance may be operative and
identify more β-lactamases.
The number of CRE Isolates decreased from 2012 to 2013
then plateaued. Data from 2009-2013 from Kashikar et al.
[4]
Screening Indianapolis Antibiotic-Resistant Clinical
• The predominant carbapenemase in
Indiana CRE was KPC-3 compared to
KPC-2.
• KPC-2-like and KPC-3-like enzymes
differed by one or two amino acid
substitutions from themselves, and
from their parent enzymes.
• The majority of the isolates that
produced KPC carbapenemases were K.
pneumoniae.
• Out of the 56 isolates screened, only 41
isolates produced KPC variants.
• For 2014, the number of CRE isolates
has decreased compared to the upward
trend seen from 2009-2013.
• At this time it is unclear why the
prevalence of KPC producing organisms
is decreasing, but it may be due to
improved infection control or changes
in antibiotic usage patterns.
Future Directions
Isolates from 2014 will continue to be screened for
other β-lactamases including TEM, SHV, CTX-M,
SME, NDM and VIM.
Isolates from 2015 have been received and will be
monitored for KPCs and other β-lactamases.
0 5 10 15 20 25 30
KPC-3-like
KPC-2-like
KPC3
KPC2
Number Isolates
KPCVariants
Number of KPC variations in 2014 Isolates
P
E
R
C
E
N
T
A
G
E
C
R
E
Decreased Identification of CRE in Central
Indiana
from 2009 - 2014
1.1
2.3
3.0
1.7 1.6
0
1
2
3
4
Isolates for KPC β-Lactamases from 2014
Kevin Knight and Karen Bush | Indiana University, Bloomington, IN

More Related Content

What's hot

Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...
Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...
Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...Clinical Surgery Research Communications
 
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...Clinical Surgery Research Communications
 
pMINERVA Cloning System
pMINERVA Cloning SystempMINERVA Cloning System
pMINERVA Cloning SystemMichael Weiner
 
kurt cyto 2015_Ks final
kurt cyto 2015_Ks finalkurt cyto 2015_Ks final
kurt cyto 2015_Ks finalDr Kurt Sales
 
Use of Methylation Markers for Age Estimation of an unknown Individual based ...
Use of Methylation Markers for Age Estimation of an unknown Individual based ...Use of Methylation Markers for Age Estimation of an unknown Individual based ...
Use of Methylation Markers for Age Estimation of an unknown Individual based ...QIAGEN
 
Muthamilselvan et al-2015-plant_biotechnology_journal
Muthamilselvan et al-2015-plant_biotechnology_journalMuthamilselvan et al-2015-plant_biotechnology_journal
Muthamilselvan et al-2015-plant_biotechnology_journalDrMuni Neurophysiologist
 
Paracrine TGF_IL2 paper
Paracrine TGF_IL2 paperParacrine TGF_IL2 paper
Paracrine TGF_IL2 paperMichael McHugh
 
A computational framework for large-scale analysis of TCRβ immune repertoire ...
A computational framework for large-scale analysis of TCRβ immune repertoire ...A computational framework for large-scale analysis of TCRβ immune repertoire ...
A computational framework for large-scale analysis of TCRβ immune repertoire ...Thermo Fisher Scientific
 
Creating custom gene panels for next-generation sequencing: optimization of 5...
Creating custom gene panels for next-generation sequencing: optimization of 5...Creating custom gene panels for next-generation sequencing: optimization of 5...
Creating custom gene panels for next-generation sequencing: optimization of 5...Thermo Fisher Scientific
 
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011Chittampalli (Yasha) N. Yashaswini
 
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...Thermo Fisher Scientific
 
Lentiviral mediated CRISPR/Cas9
Lentiviral mediated CRISPR/Cas9 Lentiviral mediated CRISPR/Cas9
Lentiviral mediated CRISPR/Cas9 XinLu52
 
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-Bhaswati Sarcar
 

What's hot (19)

Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...
Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...
Casc15 promotes lens epithelial cell apoptosis in age related cataracts by re...
 
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...
Lnc rna meg3 promotes glaucomatous retinal ganglion cell apoptosis via upregu...
 
Mekuria's poster
Mekuria's posterMekuria's poster
Mekuria's poster
 
pMINERVA Cloning System
pMINERVA Cloning SystempMINERVA Cloning System
pMINERVA Cloning System
 
kurt cyto 2015_Ks final
kurt cyto 2015_Ks finalkurt cyto 2015_Ks final
kurt cyto 2015_Ks final
 
IPK abstract
IPK abstractIPK abstract
IPK abstract
 
Nagabhushana_poster
Nagabhushana_posterNagabhushana_poster
Nagabhushana_poster
 
Use of Methylation Markers for Age Estimation of an unknown Individual based ...
Use of Methylation Markers for Age Estimation of an unknown Individual based ...Use of Methylation Markers for Age Estimation of an unknown Individual based ...
Use of Methylation Markers for Age Estimation of an unknown Individual based ...
 
Muthamilselvan et al-2015-plant_biotechnology_journal
Muthamilselvan et al-2015-plant_biotechnology_journalMuthamilselvan et al-2015-plant_biotechnology_journal
Muthamilselvan et al-2015-plant_biotechnology_journal
 
Paracrine TGF_IL2 paper
Paracrine TGF_IL2 paperParacrine TGF_IL2 paper
Paracrine TGF_IL2 paper
 
A computational framework for large-scale analysis of TCRβ immune repertoire ...
A computational framework for large-scale analysis of TCRβ immune repertoire ...A computational framework for large-scale analysis of TCRβ immune repertoire ...
A computational framework for large-scale analysis of TCRβ immune repertoire ...
 
Petrova_Poster_12 09 2014_mod
Petrova_Poster_12 09 2014_modPetrova_Poster_12 09 2014_mod
Petrova_Poster_12 09 2014_mod
 
Creating custom gene panels for next-generation sequencing: optimization of 5...
Creating custom gene panels for next-generation sequencing: optimization of 5...Creating custom gene panels for next-generation sequencing: optimization of 5...
Creating custom gene panels for next-generation sequencing: optimization of 5...
 
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011
Ubiquitination of Activation-Induced Cytidine Deaminase by RNF126 2011
 
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...
Custom AmpliSeq™ Panels for Inherited Disease Research from Optimized, Invent...
 
Lentiviral mediated CRISPR/Cas9
Lentiviral mediated CRISPR/Cas9 Lentiviral mediated CRISPR/Cas9
Lentiviral mediated CRISPR/Cas9
 
Effects of Ginsenoside Rh2 on STAT3 Signaling Pathway in Human Gastric Cancer...
Effects of Ginsenoside Rh2 on STAT3 Signaling Pathway in Human Gastric Cancer...Effects of Ginsenoside Rh2 on STAT3 Signaling Pathway in Human Gastric Cancer...
Effects of Ginsenoside Rh2 on STAT3 Signaling Pathway in Human Gastric Cancer...
 
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-
Sarcar B et al.,-Mol Cancer Ther-2011-Sarcar-
 
1584-09
1584-091584-09
1584-09
 

Viewers also liked

Rapid Catch Indicators Lunch Roundtable_10.12.12
Rapid Catch Indicators Lunch Roundtable_10.12.12Rapid Catch Indicators Lunch Roundtable_10.12.12
Rapid Catch Indicators Lunch Roundtable_10.12.12CORE Group
 
KPC (Klebsiella pneumoniae carbapenamases)
KPC (Klebsiella pneumoniae carbapenamases)KPC (Klebsiella pneumoniae carbapenamases)
KPC (Klebsiella pneumoniae carbapenamases)Malithi Weerakkody
 
Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC
 Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC
Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPCAIIMS, New Delhi, India
 
Hospital sector 39
Hospital sector 39Hospital sector 39
Hospital sector 39Shyam Singh
 
Shouldice Hospital
Shouldice HospitalShouldice Hospital
Shouldice Hospitaltarunkdl
 
Apollo Hospital case study
Apollo Hospital case studyApollo Hospital case study
Apollo Hospital case studyPulkit Yadav
 
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...vweterings
 

Viewers also liked (13)

You and kpc
You and kpcYou and kpc
You and kpc
 
Rapid Catch Indicators Lunch Roundtable_10.12.12
Rapid Catch Indicators Lunch Roundtable_10.12.12Rapid Catch Indicators Lunch Roundtable_10.12.12
Rapid Catch Indicators Lunch Roundtable_10.12.12
 
KPC (Klebsiella pneumoniae carbapenamases)
KPC (Klebsiella pneumoniae carbapenamases)KPC (Klebsiella pneumoniae carbapenamases)
KPC (Klebsiella pneumoniae carbapenamases)
 
Carbapenemase 2011
Carbapenemase 2011 Carbapenemase 2011
Carbapenemase 2011
 
Kpc hr presentation 2011
Kpc hr presentation 2011Kpc hr presentation 2011
Kpc hr presentation 2011
 
Hospital
HospitalHospital
Hospital
 
Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC
 Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC
Specific Multi-drug Resistance MRSA-VRSA-ESBL-KPC
 
Hospital sector 39
Hospital sector 39Hospital sector 39
Hospital sector 39
 
hospital case study
hospital case studyhospital case study
hospital case study
 
Case study
Case studyCase study
Case study
 
Shouldice Hospital
Shouldice HospitalShouldice Hospital
Shouldice Hospital
 
Apollo Hospital case study
Apollo Hospital case studyApollo Hospital case study
Apollo Hospital case study
 
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...
ECCMID 2014: Outbreak of colistin-resistant Klebsiella pneumonia Carbapenemas...
 

Similar to Poster Presentation-FINAL

NIH Summer 2015 Poster_GabrielleDotson
NIH Summer 2015 Poster_GabrielleDotsonNIH Summer 2015 Poster_GabrielleDotson
NIH Summer 2015 Poster_GabrielleDotsonGabrielle Dotson
 
Ceftazidime-Avibactam Is Superior to Other Treatment Regimens against Carbape...
Ceftazidime-Avibactam Is Superior toOther Treatment Regimens againstCarbape...Ceftazidime-Avibactam Is Superior toOther Treatment Regimens againstCarbape...
Ceftazidime-Avibactam Is Superior to Other Treatment Regimens against Carbape...Abdullatif Al-Rashed
 
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...Development and Validation of a Two-Site Immunoradiometric assay for Glypican...
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...Premier Publishers
 
The expression of ITPK in normal colon and colorectal cancer cells - Poster
The expression of ITPK in normal colon and colorectal cancer cells - PosterThe expression of ITPK in normal colon and colorectal cancer cells - Poster
The expression of ITPK in normal colon and colorectal cancer cells - Postermaldjuan
 
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...QIAGEN
 
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...Clinical Surgery Research Communications
 
Univ bacteriav PCR Primer
Univ bacteriav PCR PrimerUniv bacteriav PCR Primer
Univ bacteriav PCR PrimerZulkifli As
 
Nucl_Acids_Res-2015-Yang-NAR_gkv060
Nucl_Acids_Res-2015-Yang-NAR_gkv060Nucl_Acids_Res-2015-Yang-NAR_gkv060
Nucl_Acids_Res-2015-Yang-NAR_gkv060Bing Yang
 
Summer Research Poster 2014 V.3.0
Summer Research Poster 2014 V.3.0Summer Research Poster 2014 V.3.0
Summer Research Poster 2014 V.3.0Ben Peterson
 
The expression of ITPK in normal colon and colorectal cancer cells - Paper
The expression of ITPK in normal colon and colorectal cancer cells - PaperThe expression of ITPK in normal colon and colorectal cancer cells - Paper
The expression of ITPK in normal colon and colorectal cancer cells - Papermaldjuan
 
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...Eastern Pennsylvania Branch ASM
 
Identifying novel and druggable targets in a triple negative breast cancer ce...
Identifying novel and druggable targets in a triple negative breast cancer ce...Identifying novel and druggable targets in a triple negative breast cancer ce...
Identifying novel and druggable targets in a triple negative breast cancer ce...Thermo Fisher Scientific
 
Jianying Xiao CV 2016
Jianying Xiao CV 2016  Jianying Xiao CV 2016
Jianying Xiao CV 2016 Xiao Jianying
 

Similar to Poster Presentation-FINAL (20)

NIH Summer 2015 Poster_GabrielleDotson
NIH Summer 2015 Poster_GabrielleDotsonNIH Summer 2015 Poster_GabrielleDotson
NIH Summer 2015 Poster_GabrielleDotson
 
Ceftazidime-Avibactam Is Superior to Other Treatment Regimens against Carbape...
Ceftazidime-Avibactam Is Superior toOther Treatment Regimens againstCarbape...Ceftazidime-Avibactam Is Superior toOther Treatment Regimens againstCarbape...
Ceftazidime-Avibactam Is Superior to Other Treatment Regimens against Carbape...
 
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...Development and Validation of a Two-Site Immunoradiometric assay for Glypican...
Development and Validation of a Two-Site Immunoradiometric assay for Glypican...
 
The expression of ITPK in normal colon and colorectal cancer cells - Poster
The expression of ITPK in normal colon and colorectal cancer cells - PosterThe expression of ITPK in normal colon and colorectal cancer cells - Poster
The expression of ITPK in normal colon and colorectal cancer cells - Poster
 
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...
Identification of antibiotic resistance genes in Klebsiella pneumoniae isolat...
 
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...
Circ ldlrad3 regulates cell proliferation, migration and invasion of pancreat...
 
2014 molecular mechanisms involved in the cytotoxicity induced
2014 molecular mechanisms involved in the cytotoxicity induced2014 molecular mechanisms involved in the cytotoxicity induced
2014 molecular mechanisms involved in the cytotoxicity induced
 
Univ bacteriav PCR Primer
Univ bacteriav PCR PrimerUniv bacteriav PCR Primer
Univ bacteriav PCR Primer
 
ICAAC 2013: Resumen
ICAAC 2013: ResumenICAAC 2013: Resumen
ICAAC 2013: Resumen
 
Nucl_Acids_Res-2015-Yang-NAR_gkv060
Nucl_Acids_Res-2015-Yang-NAR_gkv060Nucl_Acids_Res-2015-Yang-NAR_gkv060
Nucl_Acids_Res-2015-Yang-NAR_gkv060
 
Summer Research Poster 2014 V.3.0
Summer Research Poster 2014 V.3.0Summer Research Poster 2014 V.3.0
Summer Research Poster 2014 V.3.0
 
Poster presentation Final
Poster presentation FinalPoster presentation Final
Poster presentation Final
 
Suppress lung cancer progression via up regulation of linc rna-p21
Suppress lung cancer progression via up regulation of linc rna-p21Suppress lung cancer progression via up regulation of linc rna-p21
Suppress lung cancer progression via up regulation of linc rna-p21
 
Yeliva biotechnology clinical research study
Yeliva  biotechnology clinical research studyYeliva  biotechnology clinical research study
Yeliva biotechnology clinical research study
 
The expression of ITPK in normal colon and colorectal cancer cells - Paper
The expression of ITPK in normal colon and colorectal cancer cells - PaperThe expression of ITPK in normal colon and colorectal cancer cells - Paper
The expression of ITPK in normal colon and colorectal cancer cells - Paper
 
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...
Recent Changes in Gram negative Resistance - Dr Steve Jenkins - November 2010...
 
Identifying novel and druggable targets in a triple negative breast cancer ce...
Identifying novel and druggable targets in a triple negative breast cancer ce...Identifying novel and druggable targets in a triple negative breast cancer ce...
Identifying novel and druggable targets in a triple negative breast cancer ce...
 
Indole 3-Carbinol
Indole 3-CarbinolIndole 3-Carbinol
Indole 3-Carbinol
 
Published-PageOne
Published-PageOnePublished-PageOne
Published-PageOne
 
Jianying Xiao CV 2016
Jianying Xiao CV 2016  Jianying Xiao CV 2016
Jianying Xiao CV 2016
 

Poster Presentation-FINAL

  • 1. KPC-2 Amino Acid Sequence and KPC-3 Substitution MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDT GSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALV PWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMR SIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQR QQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVW PTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ(GSEN) Abstract Results References Summary 1. Centers for Disease Control and Prevention, Antibiotic resistance threats in the United States, 2013. 2. Hayden M and Lin MY and Lolans K. et al. “Prevention of Colonization and Infection by Klebsiella pneumoniae Carbapenemase–Producing Enterobacteriaceae in Long- term Acute-Care Hospitals.” Clinical Infectious Diseases 2015 Apr 15;60(8):1153-61 3. Marchaim D and Chopra T and Bogan C, et al. “The burden of multidrug resistant organisms on tertiary hospitals posed by patients with recent stays in long-term acute care facilities.” American Journal of Infection Control 2012 Oct;40(8):760-5 4. Kashikar A and Zhang Y and Tulpule A and Dunn M and Herman K and Denys G and Bush K. ICAAC, Abstract C- 1095. (2015) 5. Bush K and Jacoby GA. “Updated Functional Classification of Β-Lactamases .” Antimicrobial Agents and Chemotherapy 54.3 (2010): 969–976. KPC is a β-lactamase family that was first discovered on a plasmid in K. pneumoniae, but since has been shown that other Enterobacteriaceae can produce it. KPCs are causing problems for healthcare due to the high resistance to current antibiotics that is seen in pathogens carrying these enzymes. KPC-producing organisms are part of a much larger group of bacteria known as Carbapenem Resistant Enterobacteriaceae (CRE). CRE, according to the CDC in a 2013 report, represent an “immediate public health threat that requires urgent and aggressive action.”[1] KPC-producing organisms are among the most common CRE worldwide.[2] Carbapenemases are organized into two groups: serine carbapenemases that have a serine residue at the active site and metallo-β-lactamases (MBLs) that have at least one zinc ion at its active site.[5] Recommendations to reduce the occurrence of resistance included patient screening and increased infection control. Health centers and hospitals are at high risk spreading KPC producing organisms. [3] Indiana University Health began screening for CRE in 2009 with former students of the biotech program creating susceptibility profiles and screening for β-lactamases.[4] This study compares the incidence of KPC from 2009-2013 [4] and 2014. Materials and Methods Acknowledgments We thank previous Biotechnology students for their contributions to this project, especially Yunliang Zhang, Ankita Kashikar and Thomas Amick. We also thank Dr. Rasheda Sultana for her advice and Dr. Gerald Denys for providing the isolates. • This study looked at isolates from a 2014 surveillance collection of CRE in patient isolates that were located in two large hospitals and fourteen care centers within the Indiana Health system. • This study looked at 56 organism including K. pneumoniae (38), E. cloacae (10), E. coli (4), E. aerogenes (2), C. freundii (1) and K. oxytoca (1). • At IUB, isolates were grown on using LB agar and LB medium containing ampicillin • Plasmid DNA isolated from CRE strains using a plasmid miniprep kit. The purified plasmids were screened for the presence of the gene blaKPC, using PCR and gel electrophoresis. The following primers were used: • Full gene sequencing of blaKPC was performed using Big Dye 3.1 kit. Alignments of gene sequences were analyzed using ExPASy, BLAST and Clustal W. Presented at 2016 Research Symposium & Poster Fair April 2, 2016 Bloomington, IN Introduction KPC Forward 5’ ATGTCACTGTATCGCCGTCT 3’ Reverse 5’ TTTTCAGAGCCTTACTGCCC 3’ In this study, two types of KPCs were observed, KPC-2 and KPC-3. For Central Indiana, KPC-2 and KPC-3 are the only KPC variants that have been observed. Below is the amino acid sequence for KPC-2. Brackets are added to denote the position of the primers used and the highlighted amino acid indicates the position and substitution of KPC-3. Forward Primer Reverse Primer KPC-3 Y 1.5kpb 1.0kpb 0.5kpb 184182179177176173 185+Con 186 SM8 ECL 19 EA3 -Con 175 187 ECL 20 183 Image of PCR product gels. Three-digits number refer to Klebsiella pneumoniae isolates and ECL is Enterobacter cloacae. The KPC gene is 893 base pairs long. When a positive band was observed the PCR product was then sequenced. KPC genetic screening results from 2014 isolates. In total there were 41 KPC producing organisms observed. Antibiotic resistance is on the rise and poses a grave threat to the public. A common resistance mechanism is through the production of enzymes called β-lactamases that render β- lactam antibiotics inert and unable to kill the bacteria. The goal of my lab is to study the bacteria that produce these enzymes in the Carbapenem-Resistant Enterobacteriaceae or CRE Project. The purpose of my specific project is to identify various β-lactamases in clinical isolates from Indianapolis area hospitals and healthcare centers. β-Lactamase genes I screened for include those that code for TEM, CTX-M and Klebsiella pneumoniae carbapenemase (KPC), enzymes frequently identified in historical CRE from Indiana. This poster will only focus on KPC findings. The screening process for these isolates included growing the cells in a LB broth containing ampicillin. The cells then underwent Qiagen plasmid miniprep to isolate the plasmids. PCR was performed on the plasmids to identify a known β- lactamase gene blaKPC. If a positive signal was observed on a Southern blot, the sample was submitted for sequencing for confirmation of the presence of the gene. Isolates collected from 2014 (n=56) have been screened for genes producing KPC β-lactamases. Among these isolates, at least 41 carry KPC genes. Of the 45 KPC-producing isolates, 3 produce KPC-2 and 28 produce KPC-3 enzymes. Additional isolates from 2015 are being screened for comparative purposes. The majority of CRE from Indianapolis produce KPC carbapenemases, with a predominance of KPC-3 to KPC-2 enzymes. Additional monitoring will be necessary to determine whether other mechanisms of resistance may be operative and identify more β-lactamases. The number of CRE Isolates decreased from 2012 to 2013 then plateaued. Data from 2009-2013 from Kashikar et al. [4] Screening Indianapolis Antibiotic-Resistant Clinical • The predominant carbapenemase in Indiana CRE was KPC-3 compared to KPC-2. • KPC-2-like and KPC-3-like enzymes differed by one or two amino acid substitutions from themselves, and from their parent enzymes. • The majority of the isolates that produced KPC carbapenemases were K. pneumoniae. • Out of the 56 isolates screened, only 41 isolates produced KPC variants. • For 2014, the number of CRE isolates has decreased compared to the upward trend seen from 2009-2013. • At this time it is unclear why the prevalence of KPC producing organisms is decreasing, but it may be due to improved infection control or changes in antibiotic usage patterns. Future Directions Isolates from 2014 will continue to be screened for other β-lactamases including TEM, SHV, CTX-M, SME, NDM and VIM. Isolates from 2015 have been received and will be monitored for KPCs and other β-lactamases. 0 5 10 15 20 25 30 KPC-3-like KPC-2-like KPC3 KPC2 Number Isolates KPCVariants Number of KPC variations in 2014 Isolates P E R C E N T A G E C R E Decreased Identification of CRE in Central Indiana from 2009 - 2014 1.1 2.3 3.0 1.7 1.6 0 1 2 3 4 Isolates for KPC β-Lactamases from 2014 Kevin Knight and Karen Bush | Indiana University, Bloomington, IN