This document discusses Michel Foucault's concept of "episteme" and its origins in the works of Carolus Linnaeus and Gottfried Leibniz. It provides context on Linnaeus' establishment of biological taxonomy and nomenclature. Foucault analyzed the transition between epistemes, such as the shift from one based on resemblances to one based on differences between things. The document also examines Foucault's book The Order of Things and its analysis of epistemes throughout history.
This document is a user's guide for the Agilent PD4-AT/Win software. It provides an introduction to using a graphical user interface (GUI), including how to use buttons, menus, text fields and directories. It also covers keyboard shortcuts and learning the GUI. The document contains several legal notices and copyright statements for the software components used in PD4-AT.
Cooperative Localization Based on Received Signal Strength in Wireless Sensor...?? ?
This thesis examines using received signal strength (RSS) for localization in wireless sensor networks. It first shows that non-metric multidimensional scaling (MDS) is a suitable method for cooperative localization using RSS. It then presents and discusses several issues in applying non-metric MDS, including determining full connections to avoid flip ambiguities, leveraging proper initial estimation to avoid local minima, and imposing structural information. Experimental results using different scenarios show that non-metric MDS can only combat small-scale randomness in shadowing effects. To address large-scale effects, macro-diversity approaches are presented, such as rotating antennas or collecting RSS from multiple motes, which simulation and testing show can greatly reduce shadowing effects.
This document outlines the syllabus for the Teaching of Science B.Ed. course at Bharathidasan University. The syllabus covers 7 units: 1) Nature, aims and objectives of teaching science, 2) Unit planning and lesson planning, 3) Microteaching, 4) Methods of teaching, 5) Science curriculum, 6) The science teacher and science laboratory, 7) Technology and science teaching. The syllabus provides learning objectives, key concepts, and practicum activities for each unit to help students understand how to effectively teach science.
This document provides an overview of electrophysiology, anatomy, vectors, and ventricular activation related to ECG interpretation. It discusses the phases of the action potential, the subepicardial and subendocardial zones, the specialized conduction system including the sinus node, atrioventricular node, His bundle, and Purkinje fibers. It describes how the cardiac cycle can be represented by successive vectors for atrial activation, septal activation, ventricular activation, and ventricular repolarization. It also notes the initial simultaneous activation of both ventricles followed by left ventricular free wall activation after the right ventricle has depolarized.
This document provides an overview of electrophysiology, anatomy, vectors, and ventricular activation related to ECG interpretation. It discusses the phases of the action potential, the subepicardial and subendocardial zones, the specialized conduction system including the sinus node, atrioventricular node, His bundle and Purkinje fibers, and representation of the cardiac cycle using vectors. It also outlines the sequence of ventricular activation from septum to left ventricle to basal and posterior regions.
Ernest Douglas S. Williams was an American cornet and trumpet player born in 1881 who founded the Ernest Williams School of Music in Brooklyn, New York in 1931. The school emphasized artistic talent, technique, orchestral and choral training to prepare students for successful careers as musicians. Williams demanded high standards from his students and many went on to prominent careers as performers. The school and its associated music camp trained and developed talented musicians while maintaining a rigorous standard of training.
This document discusses the concept of flexibility for wind instrument players. It defines flexibility as the ability of performers to produce sound across a determined range within the total range of their instrument, based on their own physical characteristics. It argues that flexibility involves more than just the lips, and is a phenomenon shared across the whole human body. The document aims to provide a clear definition of flexibility and discuss how it applies to wind instrument performance.
This document is a user's guide for the Agilent PD4-AT/Win software. It provides an introduction to using a graphical user interface (GUI), including how to use buttons, menus, text fields and directories. It also covers keyboard shortcuts and learning the GUI. The document contains several legal notices and copyright statements for the software components used in PD4-AT.
Cooperative Localization Based on Received Signal Strength in Wireless Sensor...?? ?
This thesis examines using received signal strength (RSS) for localization in wireless sensor networks. It first shows that non-metric multidimensional scaling (MDS) is a suitable method for cooperative localization using RSS. It then presents and discusses several issues in applying non-metric MDS, including determining full connections to avoid flip ambiguities, leveraging proper initial estimation to avoid local minima, and imposing structural information. Experimental results using different scenarios show that non-metric MDS can only combat small-scale randomness in shadowing effects. To address large-scale effects, macro-diversity approaches are presented, such as rotating antennas or collecting RSS from multiple motes, which simulation and testing show can greatly reduce shadowing effects.
This document outlines the syllabus for the Teaching of Science B.Ed. course at Bharathidasan University. The syllabus covers 7 units: 1) Nature, aims and objectives of teaching science, 2) Unit planning and lesson planning, 3) Microteaching, 4) Methods of teaching, 5) Science curriculum, 6) The science teacher and science laboratory, 7) Technology and science teaching. The syllabus provides learning objectives, key concepts, and practicum activities for each unit to help students understand how to effectively teach science.
This document provides an overview of electrophysiology, anatomy, vectors, and ventricular activation related to ECG interpretation. It discusses the phases of the action potential, the subepicardial and subendocardial zones, the specialized conduction system including the sinus node, atrioventricular node, His bundle, and Purkinje fibers. It describes how the cardiac cycle can be represented by successive vectors for atrial activation, septal activation, ventricular activation, and ventricular repolarization. It also notes the initial simultaneous activation of both ventricles followed by left ventricular free wall activation after the right ventricle has depolarized.
This document provides an overview of electrophysiology, anatomy, vectors, and ventricular activation related to ECG interpretation. It discusses the phases of the action potential, the subepicardial and subendocardial zones, the specialized conduction system including the sinus node, atrioventricular node, His bundle and Purkinje fibers, and representation of the cardiac cycle using vectors. It also outlines the sequence of ventricular activation from septum to left ventricle to basal and posterior regions.
Ernest Douglas S. Williams was an American cornet and trumpet player born in 1881 who founded the Ernest Williams School of Music in Brooklyn, New York in 1931. The school emphasized artistic talent, technique, orchestral and choral training to prepare students for successful careers as musicians. Williams demanded high standards from his students and many went on to prominent careers as performers. The school and its associated music camp trained and developed talented musicians while maintaining a rigorous standard of training.
This document discusses the concept of flexibility for wind instrument players. It defines flexibility as the ability of performers to produce sound across a determined range within the total range of their instrument, based on their own physical characteristics. It argues that flexibility involves more than just the lips, and is a phenomenon shared across the whole human body. The document aims to provide a clear definition of flexibility and discuss how it applies to wind instrument performance.
Pavimento Sportivo Hevea - Dalla Riva Parquet Sportivi
SOLID jump system
Parquet HEVEA:
- deriva dall’albero della gomma ed è tra i più ecologici:
- colore di tonalità chiarissime
- 22 mm spessore legno massello, molto stabile trattato ed evaporato
- elevate prestazioni tecniche
- straordinaria elasticità
per maggiori info:
http://www.pavimentipersport.it/
http://www.parquetsportivi.com/
The document summarizes an investment analysis of WD-40 Company. Key points include:
- Implied share price valuations range from $73.37 to $99.91 based on DCF, relative multiples and Gordon Growth methods.
- A weighted average of the DCF, EV/Sales and EV/EBITDA approaches yields an implied share price of $89.88.
- The recommendation is to HOLD the stock given concerns over margins being temporarily boosted by low raw material costs and decreased sales in some regions.
Campaña las cavenes es donde, tú decides cuandopanade
La Asociación Panade ha lanzado una nueva campaña para adecuar los horarios del Centro de Interpretación de la Minería Romana del Oro a las necesidades de los visitantes. Mantendrá el horario en festivos y puentes cuando hay más público, e introducirá programas "Tú decides cuándo" y "En familia" para visitas a demanda los fines de semana con guía.
Este documento narra la historia de Montenero, un oficial del ejército mexicano que recibe una nota misteriosa durante una fiesta en el Castillo de Chapultepec. Lo llevan a una cueva secreta debajo del castillo donde encuentra una sociedad secreta conocida como los "Rosa-Cruz". Montenero es llevado a través de varias puertas hasta llegar a un santuario donde se encuentra con el "Lucifer Nahuas".
El documento discute la importancia de la movilidad y el teletrabajo para las empresas. Señala que estas prácticas pueden ayudar a retener talento, mejorar la calidad de vida de los empleados y aumentar la productividad. Sin embargo, la mayoría de las empresas mexicanas aún no las han adoptado. El teletrabajo requiere medición de resultados en lugar de horas trabajadas y tecnologías que permitan la colaboración remota. La "oficina accesible", que combina infraestructura de red y acceso remoto seguro
El documento habla sobre estrategias de email marketing que no molesten al cliente. Explica que el email se ha convertido en una importante herramienta de comunicación para las empresas debido a su bajo coste y rapidez. También define términos clave del email marketing como lista de correo, tasa de clics, índice de conversión y cómo medir el éxito de las campañas.
The document is a proposal for the Savoy Centre Green Zone Project in Mogadishu, Somalia. It describes the Savoy Centre building, which was found to be in relatively good condition despite the fighting in the city. The building is historically and culturally significant. The proposal suggests establishing a secure "Green Zone" around the Savoy Centre and neighboring areas to enable redevelopment and revitalization of this historically and culturally important district in the center of Mogadishu.
El alcalde da la bienvenida a los vecinos y visitantes a las fiestas de San Roque y espera que disfruten del programa de actividades. Agradece la colaboración de las asociaciones y voluntarios que hacen posible las celebraciones. Pide a todos que olviden los problemas y disfruten unidos de las fiestas.
Finmeccanica: La Polonia seleziona l'addestratore M-346 di Alenia AermacchiLeonardo
Il Ministero della Difesa della Polonia ha selezionato il velivolo da addestramento M-346 di Alenia Aermacchi, società di Finmeccanica, e il suo sistema di addestramento per la formazione dei piloti dell’Aeronautica polacca.
La gara - che ha un valore complessivo di circa 280 milioni di euro, comprensivo di addestramento e di supporto tecnico e logistico - è relativa all’acquisizione di 8 M-346 più 4 in opzione oltre a simulatori e ausili addestrativi.
IOIT (internet of Important Things) & IIOT (Industrial Internet of Things) possono avere metodologie, tecniche e strategie di protezione differenti dalla cyber-security tradizionale.
Ne abbiamo parlato con Endian al TIS di Bolzano il 14.9.2015
The document lists the top 10 search terms on Yahoo.com for 2011, with Lindsay Lohan ranked as the most searched term, followed by Kim Kardashian and Jennifer Lopez at numbers 1, 2, and 3 respectively. Other top search terms included Jennifer Aniston at number 4, mail at number 5, and Britney Spears at number 6.
Grupo Net es un grupo de empresas de servicios fundado en 1995 que ofrece servicios de limpieza y mantenimiento. Ha obtenido certificaciones ISO en gestión de calidad, medio ambiente y seguridad. Cuenta con más de 4,100 empleados y ofrece servicios en todo España a través de oficinas territoriales.
Aproximación del Convento Franciscano de San Francisco Casa Grande, hoy Capitanía General de Granada, su historia e infortunios del inmueble, así como de sus obras artísticas muebles tras las sucesivas desamortizaciones decimonónicas, así como una visión histórica del mismo solar, centrándonos en su Iglesia destruida.
The U.S. Peace Corps Vanuatu annual report summarizes the organization's activities in 2013. Through trained volunteers living and working in communities across Vanuatu, the Peace Corps aims to build local capacity, foster cultural understanding, and promote peace and friendship. In 2013, volunteers worked on education, health, and community development projects. They received extensive training to prepare for life in remote areas with limited amenities and to respect local cultures. The report highlights the Peace Corps' contributions that year and its goals of capacity building and disaster preparedness.
Vivir y trabajar en alemania mercado laboral alemánPortal Alemania
Guía con toda la información necesaria para los hispanohablantes que quieren ir a vivir o trabajar a Alemania, con todo lo que necesitan saber sobre el mercado laboral y los requisitos fundamentales.
Investigacion en Salud y Envejecimiento - Volumen IIasunivep
Este documento es un libro titulado "Investigación en Salud y Envejecimiento. Volumen II" que contiene 54 capítulos escritos por varios autores sobre temas relacionados con la salud y el envejecimiento. El libro incluye capítulos sobre profesiones sanitarias, sexualidad y envejecimiento, y salud y envejecimiento.
Este documento describe la escuela básica social de avanzada "Dr. Andrés Eloy Blanco" en Maracaibo, Venezuela. La escuela tiene una misión de lograr una educación integral y de calidad para formar individuos que puedan funcionar en la sociedad. Cuenta con 16 salones de clase, un consultorio odontológico, comedor y baños. Funciona en dos turnos de mañana y tarde de primero a sexto grado con dos secciones por grado. También describe la infraestructura comunitaria, oportunidades y debilidades, así como
Curso de escaparatismo especializado en Farmacia. En él se explican la planificación de los escaparates, los materiales, la composición, la medición de resultados, etc..
This document discusses the common philosophical roots between existentialism and postmodernism. Both reject the notion of an objective truth or meaning to existence, instead seeing humanity as confronting a world without inherent principles or purpose. This leaves individuals to find their own meaning and make responsible choices. The document also analyzes how existential and humanistic therapies address mental illness from this perspective, focusing on existential psychotherapy, logotherapy, and client-centered counseling.
Modern Mythology is a metafiction novel comprised for four parts: modern mythology, a sequel of sorts to Goethe's Faust in the form of poetic screenplay. Small Wood Volumes, a horror tinged bildungsroman set in a small town on the Oregon coast. The Earthman Chronicles, a science fiction jaunt through 1940s Pasadena by way of suburban sprawl, L. Ron Hubbard, Jack Parsons and many more. #, prose and poetry dealing with brain damaged souls, the death of education as an institution, artificial life, and creeping madness. The texts can stand alone or together as a whole.
Pavimento Sportivo Hevea - Dalla Riva Parquet Sportivi
SOLID jump system
Parquet HEVEA:
- deriva dall’albero della gomma ed è tra i più ecologici:
- colore di tonalità chiarissime
- 22 mm spessore legno massello, molto stabile trattato ed evaporato
- elevate prestazioni tecniche
- straordinaria elasticità
per maggiori info:
http://www.pavimentipersport.it/
http://www.parquetsportivi.com/
The document summarizes an investment analysis of WD-40 Company. Key points include:
- Implied share price valuations range from $73.37 to $99.91 based on DCF, relative multiples and Gordon Growth methods.
- A weighted average of the DCF, EV/Sales and EV/EBITDA approaches yields an implied share price of $89.88.
- The recommendation is to HOLD the stock given concerns over margins being temporarily boosted by low raw material costs and decreased sales in some regions.
Campaña las cavenes es donde, tú decides cuandopanade
La Asociación Panade ha lanzado una nueva campaña para adecuar los horarios del Centro de Interpretación de la Minería Romana del Oro a las necesidades de los visitantes. Mantendrá el horario en festivos y puentes cuando hay más público, e introducirá programas "Tú decides cuándo" y "En familia" para visitas a demanda los fines de semana con guía.
Este documento narra la historia de Montenero, un oficial del ejército mexicano que recibe una nota misteriosa durante una fiesta en el Castillo de Chapultepec. Lo llevan a una cueva secreta debajo del castillo donde encuentra una sociedad secreta conocida como los "Rosa-Cruz". Montenero es llevado a través de varias puertas hasta llegar a un santuario donde se encuentra con el "Lucifer Nahuas".
El documento discute la importancia de la movilidad y el teletrabajo para las empresas. Señala que estas prácticas pueden ayudar a retener talento, mejorar la calidad de vida de los empleados y aumentar la productividad. Sin embargo, la mayoría de las empresas mexicanas aún no las han adoptado. El teletrabajo requiere medición de resultados en lugar de horas trabajadas y tecnologías que permitan la colaboración remota. La "oficina accesible", que combina infraestructura de red y acceso remoto seguro
El documento habla sobre estrategias de email marketing que no molesten al cliente. Explica que el email se ha convertido en una importante herramienta de comunicación para las empresas debido a su bajo coste y rapidez. También define términos clave del email marketing como lista de correo, tasa de clics, índice de conversión y cómo medir el éxito de las campañas.
The document is a proposal for the Savoy Centre Green Zone Project in Mogadishu, Somalia. It describes the Savoy Centre building, which was found to be in relatively good condition despite the fighting in the city. The building is historically and culturally significant. The proposal suggests establishing a secure "Green Zone" around the Savoy Centre and neighboring areas to enable redevelopment and revitalization of this historically and culturally important district in the center of Mogadishu.
El alcalde da la bienvenida a los vecinos y visitantes a las fiestas de San Roque y espera que disfruten del programa de actividades. Agradece la colaboración de las asociaciones y voluntarios que hacen posible las celebraciones. Pide a todos que olviden los problemas y disfruten unidos de las fiestas.
Finmeccanica: La Polonia seleziona l'addestratore M-346 di Alenia AermacchiLeonardo
Il Ministero della Difesa della Polonia ha selezionato il velivolo da addestramento M-346 di Alenia Aermacchi, società di Finmeccanica, e il suo sistema di addestramento per la formazione dei piloti dell’Aeronautica polacca.
La gara - che ha un valore complessivo di circa 280 milioni di euro, comprensivo di addestramento e di supporto tecnico e logistico - è relativa all’acquisizione di 8 M-346 più 4 in opzione oltre a simulatori e ausili addestrativi.
IOIT (internet of Important Things) & IIOT (Industrial Internet of Things) possono avere metodologie, tecniche e strategie di protezione differenti dalla cyber-security tradizionale.
Ne abbiamo parlato con Endian al TIS di Bolzano il 14.9.2015
The document lists the top 10 search terms on Yahoo.com for 2011, with Lindsay Lohan ranked as the most searched term, followed by Kim Kardashian and Jennifer Lopez at numbers 1, 2, and 3 respectively. Other top search terms included Jennifer Aniston at number 4, mail at number 5, and Britney Spears at number 6.
Grupo Net es un grupo de empresas de servicios fundado en 1995 que ofrece servicios de limpieza y mantenimiento. Ha obtenido certificaciones ISO en gestión de calidad, medio ambiente y seguridad. Cuenta con más de 4,100 empleados y ofrece servicios en todo España a través de oficinas territoriales.
Aproximación del Convento Franciscano de San Francisco Casa Grande, hoy Capitanía General de Granada, su historia e infortunios del inmueble, así como de sus obras artísticas muebles tras las sucesivas desamortizaciones decimonónicas, así como una visión histórica del mismo solar, centrándonos en su Iglesia destruida.
The U.S. Peace Corps Vanuatu annual report summarizes the organization's activities in 2013. Through trained volunteers living and working in communities across Vanuatu, the Peace Corps aims to build local capacity, foster cultural understanding, and promote peace and friendship. In 2013, volunteers worked on education, health, and community development projects. They received extensive training to prepare for life in remote areas with limited amenities and to respect local cultures. The report highlights the Peace Corps' contributions that year and its goals of capacity building and disaster preparedness.
Vivir y trabajar en alemania mercado laboral alemánPortal Alemania
Guía con toda la información necesaria para los hispanohablantes que quieren ir a vivir o trabajar a Alemania, con todo lo que necesitan saber sobre el mercado laboral y los requisitos fundamentales.
Investigacion en Salud y Envejecimiento - Volumen IIasunivep
Este documento es un libro titulado "Investigación en Salud y Envejecimiento. Volumen II" que contiene 54 capítulos escritos por varios autores sobre temas relacionados con la salud y el envejecimiento. El libro incluye capítulos sobre profesiones sanitarias, sexualidad y envejecimiento, y salud y envejecimiento.
Este documento describe la escuela básica social de avanzada "Dr. Andrés Eloy Blanco" en Maracaibo, Venezuela. La escuela tiene una misión de lograr una educación integral y de calidad para formar individuos que puedan funcionar en la sociedad. Cuenta con 16 salones de clase, un consultorio odontológico, comedor y baños. Funciona en dos turnos de mañana y tarde de primero a sexto grado con dos secciones por grado. También describe la infraestructura comunitaria, oportunidades y debilidades, así como
Curso de escaparatismo especializado en Farmacia. En él se explican la planificación de los escaparates, los materiales, la composición, la medición de resultados, etc..
This document discusses the common philosophical roots between existentialism and postmodernism. Both reject the notion of an objective truth or meaning to existence, instead seeing humanity as confronting a world without inherent principles or purpose. This leaves individuals to find their own meaning and make responsible choices. The document also analyzes how existential and humanistic therapies address mental illness from this perspective, focusing on existential psychotherapy, logotherapy, and client-centered counseling.
Modern Mythology is a metafiction novel comprised for four parts: modern mythology, a sequel of sorts to Goethe's Faust in the form of poetic screenplay. Small Wood Volumes, a horror tinged bildungsroman set in a small town on the Oregon coast. The Earthman Chronicles, a science fiction jaunt through 1940s Pasadena by way of suburban sprawl, L. Ron Hubbard, Jack Parsons and many more. #, prose and poetry dealing with brain damaged souls, the death of education as an institution, artificial life, and creeping madness. The texts can stand alone or together as a whole.
This document provides an introduction to neural networks and their biological basis in the human brain. It explains that while computers excel at calculations, the human brain surpasses computers in tasks like pattern recognition, communication, and adaptation due to its parallel and adaptive neural network structure. Billions of interconnected neurons in the brain work simultaneously to process information. The intelligence arises from the connections between neurons rather than the neurons themselves. This distributed processing allows the brain to gracefully degrade over time. The document introduces the basic biological structure of neurons and how they communicate via electrical signals. It contrasts this with the traditional serial processing of computers.
SAK:n julkaisusarja
Talous- ja yhteiskuntapolitiikassa on hyvä pyrkiä linjauksiin, jotka tuottavat talouteen vakautta ja ennustettavuutta sekä yhteiskuntaan sosiaalista eheyttä.
1. This is an application form for inclusion of an overseas elector's name in the electoral roll. It requests inclusion in the constituency where the applicant's place of ordinary residence in India is located.
2. It provides details of the applicant such as name, date of birth, passport details, current address abroad, and reason for being absent from India.
3. The applicant declares that they are a citizen of India, have not acquired citizenship elsewhere, and undertakes to inform authorities of any change in citizenship or address.
The document provides an introduction to project cycle management (PCM) and improving project quality. It discusses that PCM follows the phases of the project cycle using the logical framework approach as its core design and management tool. It emphasizes beneficiary involvement in decision making and building sustainability into project design. The document outlines the basic characteristics of PCM, the key phases of the project cycle, major documents used, and factors important for project quality such as relevance, feasibility and sustainability.
Presentacion JDE Customers Day 1 E1 Gestion de Mantenimientooracledirect
This document discusses Oracle's Enterprise Asset Management solution and how it can help facilitate asset uptime by providing integrated asset maintenance management capabilities. It highlights key features such as comprehensive asset visibility, preventative and predictive maintenance support, integrated financial management, and regulatory compliance tools. The solution aims to optimize asset performance and value over their lifecycles by improving maintenance decision-making. Real-world customer examples are also provided.
The Japanese Ministry of Health, Labor and Welfare revised the Drinking Water Quality Standards in 2003. Key changes included expanding the number of regulated items from 46 to 50, adding items like E. coli and aluminum, and introducing a rolling revision system to continuously improve standards. A new framework was established with Drinking Water Quality Standards, Complementary items including 101 pesticides, and Items for Further Study. Water suppliers must now prepare Water Quality Analysis Plans outlining their testing procedures.
This document summarizes the implementation of Puppet at RMIT University to facilitate continuous delivery. It describes their progression from initial baby steps using Puppet Enterprise to install applications, to separating development and production environments and implementing a workflow process. It also discusses how they addressed challenges like preventing accidental changes from one person from taking down the entire infrastructure and preparing for human errors.
This property report provides an overview of investment opportunities in Detroit, Michigan. It notes that contrary to perceptions, Detroit is seeing significant real estate activity and offers a wide range of investment properties, from luxury condos downtown to single and multi-family homes. The report highlights Detroit's history, current facts, and potential for capital appreciation as the city works to diversify its economy and regenerate neighborhoods.
This document provides information about a book titled "Cada quien pone su parte. Conflictos en la escuela" which is part of the "Somos Maestros" collection published by Ediciones SM. The collection aims to provide teachers with resources to improve their classroom practice and develop innovative school proposals. It also documents successful educational experiences. This particular book analyzes various topics related to managing conflicts in schools to make them formative experiences.
Pinterest is a visual social media platform that allows users to share images and videos by pinning them to boards. It has grown rapidly in popularity in recent months. Pinterest is very effective at driving traffic to websites compared to other social networks like Facebook. Marketers are interested in using Pinterest to increase website traffic and sales. The book will provide strategies for how businesses can leverage Pinterest for marketing purposes.
Official Visitors Guide for Grand Island, NebraskaGrandIslandCVB
This document provides a visitor's guide for the Greater Grand Island area of Nebraska, highlighting its history, attractions, shopping, lodging, dining, arts, events, recreation, and local resources. The guide discusses how Grand Island got its name from French explorers and the growth of the city along wagon trails and railroads. It also summarizes some of the area's museums that showcase local history and heritage, as well as historical sites and markers commemorating pioneer life.
Official Visitors Guide for Grand Island, NebraskaPaul Nielsen
The Greater Grand Island area has a rich history, from its early days as part of the Great American Desert to becoming the Great American Bread Basket with westward expansion and the arrival of wagon trails, railroads, and highways. Several local museums examine the area's heritage, and historic markers commemorate pioneer life. Grand Island derives its name from the French "La Grande Ile," meaning the large island in the Platte River.
Oracle technology day 19.5.2010. introduction to the web logic diagnostics f...Oracle Hrvatska
The WebLogic Diagnostics Framework (WLDF) provides a coordinated set of monitoring and diagnostic services that run within the WebLogic Server process. It allows the collection, analysis, archiving, and access of diagnostic data generated by running servers and applications. WLDF components like instrumentation, harvesting, and watching are configured using MBeans and persisted in XML files. The diagnostic system enables insights into runtime performance to isolate and diagnose faults.
This paper presents the results of studies using Cuban pine oleoresin in its natural state as a raw material for obtaining various chemical additives as substitutes for traditional rosin. The applications studied include three varieties of paper sizing, surfactants, and specialized lubricants. Characterization of the oleoresin and rosin obtained from different pine species in Cuba is provided. Considerations for the practical introduction of these products derived from pine oleoresin into Cuban industry are also discussed.
This document provides guidance for integrated management of childhood illnesses for children aged up to 5 years. It outlines how to assess, classify, and treat sick young infants aged up to 6 months as well as sick children aged 6 months to 5 years. It describes how to check for general danger signs, ask about main symptoms, classify illnesses, and identify appropriate treatment plans. It also provides counseling guidance for mothers on feeding recommendations, hygiene, follow-up care, and when to return to the health worker.
Aerotek, a clinical/scientific staffing provider headquartered in Hanover, Maryland, was listed as the largest US clinical/scientific temporary staffing firm for 2010 based on 2009 revenue. According to a report by Staffing Industry Analysts, Aerotek alone generated approximately $222 million in clinical/scientific revenue in 2009, more than 15% of the entire estimated $1 billion clinical/scientific segment. Aerotek operates more than 200 non-franchised offices throughout the US, Canada and Europe.
The generalization of the Periodic table. The "Periodic table" of "dark matter"Vasil Penchev
The thesis is: the “periodic table” of “dark matter” is equivalent to the standard periodic table of the visible matter being entangled. Thus, it is to consist of all possible entangled states of the atoms of chemical elements as quantum systems. In other words, an atom of any chemical element and as a quantum system, i.e. as a wave function, should be represented as a non-orthogonal in general (i.e. entangled) subspace of the separable complex Hilbert space relevant to the system to which the atom at issue is related as a true part of it. The paper follows previous publications of mine stating that “dark matter” and “dark energy” are projections of arbitrarily entangled states on the cognitive “screen” of Einstein’s “Mach’s principle” in general relativity postulating that gravitational field can be generated only by mass or energy.
Modal History versus Counterfactual History: History as IntentionVasil Penchev
The distinction of whether real or counterfactual history makes sense only post factum. However, modal history is to be defined only as ones’ intention and thus, ex-ante. Modal history is probable history, and its probability is subjective. One needs phenomenological “epoché” in relation to its reality (respectively, counterfactuality). Thus, modal history describes historical “phenomena” in Husserl’s sense and would need a specific application of phenomenological reduction, which can be called historical reduction. Modal history doubles history just as the recorded history of historiography does it. That doubling is a necessary condition of historical objectivity including one’s subjectivity: whether actors’, ex-anteor historians’ post factum. The objectivity doubled by ones’ subjectivity constitute “hermeneutical circle”.
Both classical and quantum information [autosaved]Vasil Penchev
Information can be considered a the most fundamental, philosophical, physical and mathematical concept originating from the totality by means of physical and mathematical transcendentalism (the counterpart of philosophical transcendentalism). Classical and quantum information. particularly by their units, bit and qubit, correspond and unify the finite and infinite:
As classical information is relevant to finite series and sets, as quantum information, to infinite ones. The separable complex Hilbert space of quantum mechanics can be represented equivalently as “qubit space”) as quantum information and doubled dually or “complimentary” by Hilbert arithmetic (classical information).
A CLASS OF EXEMPLES DEMONSTRATING THAT “푃푃≠푁푁푁 ” IN THE “P VS NP” PROBLEMVasil Penchev
The CMI Millennium “P vs NP Problem” can be resolved e.g. if one shows at least one counterexample to the “P=NP” conjecture. A certain class of problems being such counterexamples will be formulated. This implies the rejection of the hypothesis “P=NP” for any conditions satisfying the formulation of the problem. Thus, the solution “P≠NP” of the problem in general is proved. The class of counterexamples can be interpreted as any quantum superposition of any finite set of quantum states. The Kochen-Specker theorem is involved. Any fundamentally random choice among a finite set of alternatives belong to “NP’ but not to “P”. The conjecture that the set complement of “P” to “NP” can be described by that kind of choice exhaustively is formulated.
FERMAT’S LAST THEOREM PROVED BY INDUCTION (accompanied by a philosophical com...Vasil Penchev
A proof of Fermat’s last theorem is demonstrated. It is very brief, simple, elementary, and absolutely arithmetical. The necessary premises for the proof are only: the three definitive properties of the relation of equality (identity, symmetry, and transitivity), modus tollens, axiom of induction, the proof of Fermat’s last theorem in the case of n=3 as well as the premises necessary for the formulation of the theorem itself. It involves a modification of Fermat’s approach of infinite descent. The infinite descent is linked to induction starting from n=3 by modus tollens. An inductive series of modus tollens is constructed. The proof of the series by induction is equivalent to Fermat’s last theorem. As far as Fermat had been proved the theorem for n=4, one can suggest that the proof for n≥4 was accessible to him.
An idea for an elementary arithmetical proof of Fermat’s last theorem (FLT) by induction is suggested. It would be accessible to Fermat unlike Wiles’s proof (1995), and would justify Fermat’s claim (1637) for its proof. The inspiration for a simple proof would contradict to Descartes’s dualism for appealing to merge “mind” and “body”, “words” and “things”, “terms” and “propositions”, all orders of logic. A counterfactual course of history of mathematics and philosophy may be admitted. The bifurcation happened in Descartes and Fermat’s age. FLT is exceptionally difficult to be proved in our real branch rather than in the counterfactual one.
The space-time interpretation of Poincare’s conjecture proved by G. Perelman Vasil Penchev
This document discusses the generalization of Poincaré's conjecture to higher dimensions and its interpretation in terms of special relativity. It proposes that Poincaré's conjecture can be generalized to state that any 4-dimensional ball is topologically equivalent to 3D Euclidean space. This generalization has a physical interpretation in which our 3D space can be viewed as a "4-ball" closed in a fourth dimension. The document also outlines ideas for how one might prove this generalization by "unfolding" the problem into topological equivalences between Euclidean spaces.
FROM THE PRINCIPLE OF LEAST ACTION TO THE CONSERVATION OF QUANTUM INFORMATION...Vasil Penchev
In fact, the first law of conservation (that of mass) was found in chemistry and generalized to the conservation of energy in physics by means of Einstein’s famous “E=mc2”. Energy conservation is implied by the principle of least action from a variational viewpoint as in Emmy Noether’s theorems (1918): any chemical change in a conservative (i.e. “closed”) system can be accomplished only in the way conserving its total energy. Bohr’s innovation to found Mendeleev’s periodic table by quantum mechanics implies a certain generalization referring to
the quantum leaps as if accomplished in all possible trajectories (according to Feynman’s interpretation) and therefore generalizing the principle of least action and needing a certain generalization of energy conservation as to any quantum change.The transition from the first to the second theorem of Emmy Noether represents well the necessary generalization: its chemical meaning is the ge eralization of any chemical reaction to be accomplished as if any possible course of time rather than in the standard evenly running time (and equivalent to energy conservation according to the first theorem). The problem: If any quantum change is accomplished in al possible “variations (i.e. “violations) of energy conservation” (by different probabilities),
what (if any) is conserved? An answer: quantum information is what is conserved. Indeed, it can be particularly defined as the counterpart (e.g. in the sense of Emmy Noether’s theorems) to the physical quantity of action (e.g. as energy is the counterpart of time in them). It is valid in any course of time rather than in the evenly running one. That generalization implies a generalization of the periodic table including any continuous and smooth transformation between two chemical elements.
From the principle of least action to the conservation of quantum information...Vasil Penchev
In fact, the first law of conservation (that of mass) was found in chemistry and generalized to the conservation of energy in physics by means of Einstein’s famous “E=mc2”. Energy conservation is implied by the principle of least action from a variational viewpoint as in Emmy Noether’s theorems (1918):any chemical change in a conservative (i.e. “closed”) system can be accomplished only in the way conserving its total energy. Bohr’s innovation to found Mendeleev’s periodic table by quantum mechanics implies a certain generalization referring to the quantum leaps as if accomplished in all possible trajectories (e.g. according to Feynman’s viewpoint) and therefore generalizing the principle of least action and needing a certain generalization of energy conservation as to any quantum change.
The transition from the first to the second theorem of Emmy Noether represents well the necessary generalization: its chemical meaning is the generalization of any chemical reaction to be accomplished as if any possible course of time rather than in the standard evenly running time (and equivalent to energy conservation according to the first theorem).
The problem: If any quantum change is accomplished in all possible “variations (i.e. “violations) of energy conservation” (by different probabilities), what (if any) is conserved?
An answer: quantum information is what is conserved. Indeed it can be particularly defined as the counterpart (e.g. in the sense of Emmy Noether’s theorems) to the physical quantity of action (e.g. as energy is the counterpart of time in them). It is valid in any course of time rather than in the evenly running one. (An illustration: if observers in arbitrarily accelerated reference frames exchange light signals about the course of a single chemical reaction observed by all of them, the universal viewpoint shareаble by all is that of quantum information).
That generalization implies a generalization of the periodic table including any continuous and smooth transformation between two chemical elements necessary conserving quantum information rather than energy: thus it can be called “alchemical periodic table”.
Poincaré’s conjecture proved by G. Perelman by the isomorphism of Minkowski s...Vasil Penchev
- The document discusses the relationship between separable complex Hilbert spaces (H) and sets of ordinals (H) and how they should not be equated if natural numbers are identified as finite.
- It presents two interpretations of H: as vectors in n-dimensional complex space or as squarely integrable functions, and discusses how the latter adds unitarity from energy conservation.
- It argues that Η rather than H should be used when not involving energy conservation, and discusses how the relation between H and HH generates spheres representing areas and can be interpreted physically in terms of energy and force.
Why anything rather than nothing? The answer of quantum mechnaicsVasil Penchev
Many researchers determine the question “Why anything
rather than nothing?” to be the most ancient and fundamental philosophical problem. It is closely related to the idea of Creation shared by religion, science, and philosophy, for example in the shape of the “Big Bang”, the doctrine of first cause or causa sui, the Creation in six days in the Bible, etc. Thus, the solution of quantum mechanics, being scientific in essence, can also be interpreted philosophically, and even religiously. This paper will only discuss the philosophical interpretation. The essence of the answer of quantum mechanics is: 1.) Creation is necessary in a rigorously mathematical sense. Thus, it does not need any hoice, free will, subject, God, etc. to appear. The world exists by virtue of mathematical necessity, e.g. as any mathematical truth such as 2+2=4; and 2.) Being is less than nothing rather than ore than nothing. Thus creation is not an increase of nothing, but the decrease of nothing: it is a deficiency in relation to nothing. Time and its “arrow” form the road from that diminishment or incompleteness to nothing.
The Square of Opposition & The Concept of Infinity: The shared information s...Vasil Penchev
The power of the square of opposition has been proved during millennia, It supplies logic by the ontological language of infinity for describing anything...
6th WORLD CONGRESS ON THE SQUARE OF OPPOSITION
http://www.square-of-opposition.org/square2018.html
Mamardashvili, an Observer of the Totality. About “Symbol and Consciousness”,...Vasil Penchev
The paper discusses a few tensions “crucifying” the works and even personality of the great Georgian philosopher Merab Mamardashvili: East and West; human being and thought, symbol and consciousness, infinity and finiteness, similarity and differences. The observer can be involved as the correlative counterpart of the totality: An observer opposed to the totality externalizes an internal part outside. Thus the phenomena of an observer and the totality turn out to converge to each other or to be one and the same. In other words, the phenomenon of an observer includes the singularity of the solipsistic Self, which (or “who”) is the same as that of the totality. Furthermore, observation can be thought as that primary and initial action underlain by the phenomenon of an observer. That action of observation consists in the externalization of the solipsistic Self outside as some external reality. It is both a zero action and the singularity of the phenomenon of action. The main conclusions are: Mamardashvili’s philosophy can be thought both as the suffering effort to be a human being again and again as well as the philosophical reflection on the genesis of thought from itself by the same effort. Thus it can be recognized as a powerful tension between signs anа symbol, between conscious structures and consciousness, between the syncretism of the East and the discursiveness of the West crucifying spiritually Georgia
Completeness: From henkin's Proposition to Quantum ComputerVasil Penchev
This document discusses how Leon Henkin's proposition relates to concepts in logic, set theory, information theory, and quantum mechanics. It argues that Henkin's proposition, which states the provability of a statement within a formal system, is equivalent to an internal and consistent position regarding infinity. The document then explores how this connects to Martin Lob's theorem, the Einstein-Podolsky-Rosen paradox in quantum mechanics, theorems about the absence of hidden variables, entanglement, quantum information, and ultimately quantum computers.
Why anything rather than nothing? The answer of quantum mechanicsVasil Penchev
This document discusses the philosophical question of why there is something rather than nothing from the perspective of quantum mechanics. It argues that quantum mechanics provides a solution where creation is permanent and due to the irreversibility of time. The creation in quantum mechanics represents a necessary loss of information as alternatives are rejected in the course of time, rather than being due to some external cause like God's will. This permanent creation process makes the universe mathematically necessary rather than requiring an initial singular event like the Big Bang.
The outlined approach allows a common philosophical viewpoint to the physical world, language and some mathematical structures therefore calling for the universe to be understood as a joint physical, linguistic and mathematical universum, in which physical motion and metaphor are one and the same rather than only similar in a sense.
Hilbert Space and pseudo-Riemannian Space: The Common Base of Quantum Informa...Vasil Penchev
Hilbert space underlying quantum mechanics and pseudo-Riemannian space underlying general relativity share a common base of quantum information. Hilbert space can be interpreted as the free variable of quantum information, and any point in it, being equivalent to a wave function (and thus, to a state of a quantum system), as a value of that variable of quantum information. In turn, pseudo-Riemannian space can be interpreted as the interaction of two or more quantities of quantum information and thus, as two or more entangled quantum systems. Consequently, one can distinguish local physical interactions describable by a single Hilbert space (or by any factorizable tensor product of such ones) and non-local physical interactions describable only by means by that Hilbert space, which cannot be factorized as any tensor product of the Hilbert spaces, by means of which one can describe the interacting quantum subsystems separately. Any interaction, which can be exhaustedly described in a single Hilbert space, such as the weak, strong, and electromagnetic one, is local in terms of quantum information. Any interaction, which cannot be described thus, is nonlocal in terms of quantum information. Any interaction, which is exhaustedly describable by pseudo-Riemannian space, such as gravity, is nonlocal in this sense. Consequently all known physical interaction can be described by a single geometrical base interpreting it in terms of quantum information.
This document discusses using Richard Feynman's interpretation of quantum mechanics as a way to formally summarize different explanations of quantum mechanics given to hypothetical children. It proposes that each child's understanding could be seen as one "pathway" or explanation, with the total set of explanations forming a distribution. The document then suggests that quantum mechanics itself could provide a meta-explanation that encompasses all the children's perspectives by describing phenomena probabilistically rather than deterministically. Finally, it gives some examples of how this approach could allow defining and experimentally studying the concept of God through quantum mechanics.
This document discusses whether artificial intelligence can have a soul from both scientific and religious perspectives. It begins by acknowledging that "soul" is a religious concept while AI is a scientific one. The document then examines how Christianity views creativity as a criterion for having a soul. It proposes formal scientific definitions of creativity involving learning rates and probabilities. An example is given comparing a master's creativity to an apprentice's. The document argues science can describe God's infinite creativity and human's finite creativity uniformly. It analyzes whether criteria for creativity can apply to AI like a Turing machine. Hypothetical examples involving infinite algorithms and self-learning machines are discussed.
Analogia entis as analogy universalized and formalized rigorously and mathema...Vasil Penchev
THE SECOND WORLD CONGRESS ON ANALOGY, POZNAŃ, MAY 24-26, 2017
(The Venue: Sala Lubrańskiego (Lubrański’s Hall at the Collegium Minus), Adam Mickiewicz University, Address: ul. Wieniawskiego 1) The presentation: 24 May, 15:30
How to Manage Your Lost Opportunities in Odoo 17 CRMCeline George
Odoo 17 CRM allows us to track why we lose sales opportunities with "Lost Reasons." This helps analyze our sales process and identify areas for improvement. Here's how to configure lost reasons in Odoo 17 CRM
How to Make a Field Mandatory in Odoo 17Celine George
In Odoo, making a field required can be done through both Python code and XML views. When you set the required attribute to True in Python code, it makes the field required across all views where it's used. Conversely, when you set the required attribute in XML views, it makes the field required only in the context of that particular view.
This slide is special for master students (MIBS & MIFB) in UUM. Also useful for readers who are interested in the topic of contemporary Islamic banking.
Strategies for Effective Upskilling is a presentation by Chinwendu Peace in a Your Skill Boost Masterclass organisation by the Excellence Foundation for South Sudan on 08th and 09th June 2024 from 1 PM to 3 PM on each day.
हिंदी वर्णमाला पीपीटी, hindi alphabet PPT presentation, hindi varnamala PPT, Hindi Varnamala pdf, हिंदी स्वर, हिंदी व्यंजन, sikhiye hindi varnmala, dr. mulla adam ali, hindi language and literature, hindi alphabet with drawing, hindi alphabet pdf, hindi varnamala for childrens, hindi language, hindi varnamala practice for kids, https://www.drmullaadamali.com
Leveraging Generative AI to Drive Nonprofit InnovationTechSoup
In this webinar, participants learned how to utilize Generative AI to streamline operations and elevate member engagement. Amazon Web Service experts provided a customer specific use cases and dived into low/no-code tools that are quick and easy to deploy through Amazon Web Service (AWS.)
Walmart Business+ and Spark Good for Nonprofits.pdfTechSoup
"Learn about all the ways Walmart supports nonprofit organizations.
You will hear from Liz Willett, the Head of Nonprofits, and hear about what Walmart is doing to help nonprofits, including Walmart Business and Spark Good. Walmart Business+ is a new offer for nonprofits that offers discounts and also streamlines nonprofits order and expense tracking, saving time and money.
The webinar may also give some examples on how nonprofits can best leverage Walmart Business+.
The event will cover the following::
Walmart Business + (https://business.walmart.com/plus) is a new shopping experience for nonprofits, schools, and local business customers that connects an exclusive online shopping experience to stores. Benefits include free delivery and shipping, a 'Spend Analytics” feature, special discounts, deals and tax-exempt shopping.
Special TechSoup offer for a free 180 days membership, and up to $150 in discounts on eligible orders.
Spark Good (walmart.com/sparkgood) is a charitable platform that enables nonprofits to receive donations directly from customers and associates.
Answers about how you can do more with Walmart!"
Chapter wise All Notes of First year Basic Civil Engineering.pptxDenish Jangid
Chapter wise All Notes of First year Basic Civil Engineering
Syllabus
Chapter-1
Introduction to objective, scope and outcome the subject
Chapter 2
Introduction: Scope and Specialization of Civil Engineering, Role of civil Engineer in Society, Impact of infrastructural development on economy of country.
Chapter 3
Surveying: Object Principles & Types of Surveying; Site Plans, Plans & Maps; Scales & Unit of different Measurements.
Linear Measurements: Instruments used. Linear Measurement by Tape, Ranging out Survey Lines and overcoming Obstructions; Measurements on sloping ground; Tape corrections, conventional symbols. Angular Measurements: Instruments used; Introduction to Compass Surveying, Bearings and Longitude & Latitude of a Line, Introduction to total station.
Levelling: Instrument used Object of levelling, Methods of levelling in brief, and Contour maps.
Chapter 4
Buildings: Selection of site for Buildings, Layout of Building Plan, Types of buildings, Plinth area, carpet area, floor space index, Introduction to building byelaws, concept of sun light & ventilation. Components of Buildings & their functions, Basic concept of R.C.C., Introduction to types of foundation
Chapter 5
Transportation: Introduction to Transportation Engineering; Traffic and Road Safety: Types and Characteristics of Various Modes of Transportation; Various Road Traffic Signs, Causes of Accidents and Road Safety Measures.
Chapter 6
Environmental Engineering: Environmental Pollution, Environmental Acts and Regulations, Functional Concepts of Ecology, Basics of Species, Biodiversity, Ecosystem, Hydrological Cycle; Chemical Cycles: Carbon, Nitrogen & Phosphorus; Energy Flow in Ecosystems.
Water Pollution: Water Quality standards, Introduction to Treatment & Disposal of Waste Water. Reuse and Saving of Water, Rain Water Harvesting. Solid Waste Management: Classification of Solid Waste, Collection, Transportation and Disposal of Solid. Recycling of Solid Waste: Energy Recovery, Sanitary Landfill, On-Site Sanitation. Air & Noise Pollution: Primary and Secondary air pollutants, Harmful effects of Air Pollution, Control of Air Pollution. . Noise Pollution Harmful Effects of noise pollution, control of noise pollution, Global warming & Climate Change, Ozone depletion, Greenhouse effect
Text Books:
1. Palancharmy, Basic Civil Engineering, McGraw Hill publishers.
2. Satheesh Gopi, Basic Civil Engineering, Pearson Publishers.
3. Ketki Rangwala Dalal, Essentials of Civil Engineering, Charotar Publishing House.
4. BCP, Surveying volume 1
1. Vasil Penchev, PhD, Assoc. Prof. –
SEARCHING Department “Philosophy of History”,
& Institute for Philosophical Research of
CLASSIFYING the Bulgarian Academy of Sciences
E-mail: vasildinev@gmail.com
Universal taxonomy of Carolus
Linnaeus > mathesis universalis of
Leibniz are the ground of Michel http://four.fsphost.com/vasil7penchev
Foucault’s conception ‘episteme’
$EVWUDFW $EVWUDFW
‘Episteme’ designates the accepted mode of
acquiring and arranging knowledge in a )RXFDXOWDWWHPSWHGWRVKRZKRZDQ
given period. An episteme unites the various
discourses and guarantees their coherence
HSLVWHPHEDVHGRQWKHGHWHFWLRQRI
within an underlying structure of implicit UHVHPEODQFHVZDVUHSODFHGLQWKH
assumptions about the status of knowledge. WKFHQWXUEDQHZHSLVWHPHRI
The term has gained currency from the work GLIIHUHQFHVDQGGLVWLQFWLRQVZKLOH
of the French philosopher Michel Foucault,
WKHWKFHQWXULQWURGXFHGD
especially his Les Mots et les choses (The
Order of Things, 1966; Bulgarian edition: IXUWKHUHSLVWHPHRIKLVWRULFDO
GZmdZ b badmklh, 1990). HYROXWLRQ
HGLVSXWHG/HLEKL]oVLGHDRI nPDWKHVLV
$EVWUDFW o0DWKHVLVo DQG oWD[RQRPo
%KHUHE URXJKOWKH H[WHQVLYHQHWZRUN
XQLYHUVDOLVo nFKDUDFUFWHULVWLFD RIHPSLULFDONQRZOHGJHZDVRXWOLQHG
XQLYHUVDOLVo pDSURMHFWRIDJHQHUDO WKDWRIQRQTXDQWLWDWLYHRUGHULQJV
VFLHQFHRIRUGHUDWKHRURIVLJQ 0DEHDGLVWDQWEXWSHUVLVWHQW XQLWRI
DQDO]LQJWKHZDIRUDQWKLQJWREH DXQLYHUVDO WD[RQRP ZRXOGEH
UHSUHVHQWHGq$OOWKHKDSWHU SURPLQHQWIRUWKHHQWLUHFOHDUQHVVDIWHU
pODVVLILQJq RI/HV 0RWV HWOHV FKRVHV /LQQéZKHQKHVXJJHVWHGWKDWKHZRXOG
LVEDVHGRIERWKWKHPDLQSDSHUVRI EULQJWROLJKWWKHVDPHGLVWULEXWLRQDQG
DUROXV/LQQDHXV 6VWHPZ naturaeDQG WKHVDPHRUGHULQDQFRQFUHWHGRPDLQV
HVSHFLDOO 3KLORVRSKLHbotanique RIQDWXUHDQGVRFLHW
1
2. p:KDWPDNHVWKHWRWDOLWRIWKH
ODVVLFDOHSLVWHPHSRVVLEOHLV
p. 86-87
SULPDULOWKHUHODWLRQWRD
NQRZOHGJHRIRUGHU:KHQGHDOLQJ
ZLWKWKHRUGHULQJRIVLPSOHQDWXUHV
RQHKDVUHFRXUVHWRD PDWKHVLVRI
ZKLFKWKHXQLYHUVDOPHWKRGLV
VI. €0$7+(6,6 ?L €7$;,120,$ DOJHEUDqS
3. .
LQ Les mots et les choses E0)RXFDXOW
“:KHQGHDOLQJZLWKWKHRUGHULQJRI The English translation is from:
FRPSOH[QDWXUHVUHSUHVHQWDWLRQVLQ
JHQHUDODVWKHDUHJLYHQLQ www.illogicaloperation.com/textz/
H[SHULHQFH
5. 6VWHPD naturae In Systema naturae (1735) he presented
his classification of plants, animals, and
minerals, and in Genera plantarum
(1737) he explained his system for
classifying plants largely on the basis
of the number of stamens and pistils in
the flower. Despite the artificiality of
some of his premises, the Linnaean
system has remained the basis of
modern taxonomy.
%HFDXVH/LQQDHXV ZDVWKHILUVWWR
DFKLHYHDFRQVLVWHQWDQGHIILFLHQW
7KH6LJQDWXUHRI/LQQDHXV
VVWHPRIQRPHQFODWXUHERWDQLVWV
DJUHHGLQWRDFFHSWKLV
p6SHFLHVSODQWDUXPq YROV
8. 7KHPDLQSULQFLSOHVRI
/LQQHDXVWD[RQRP 7KHRDWRI$UPV
RIDUOYRQ/LQQé
*UDGXDOO /LQQDHXV DOVRGHYHORSHG
DFRQVLVWHQWVVWHPRIQDPHVLQ
ZKLFKHDFKVSHFLHVRISODQWDQG
DQLPDOKDGDJHQXVQDPHIROORZHG
EDVSHFLILFQDPH,WZDVFDOOHG
%LQRPLDO1RPHQFODWXUHDQG
ODVVLILFDWLRQ
Les mots et les choses
E0LFKHO)RXFDXOW
)UHQFK
'LFWLRQDU
DERXW
les mots et
les choses
(1680)
/HVPRWVHWOHVFKRVHV
7KH2UGHURI7KLQJVLQ(QJOLVK
9. Frontispiece
pfOoKRPPHQoHVWTXoXQH
for LQYHQWLRQUéFHQWHXQHILJXUH
Foucault's
The Order
TXLQoDSDVGHX[VLèFOHVXQ
of Things, VLPSOHSOLGDQVQRWUHVDYRLUHW
28.5 x 19,
acrylic TXoLOGLVSDUDîWUD GèVTXHFHOXL
on panel, FLDXUDWURXYé XQHIRUPH
1995.
Private QRXYHOOHqS
17. RWKHUUXOHVRIWKH5HJXOæ
“… there must be some general science to
explain everything which can be asked
concerning measure and order not predicated
of any special subject matter. This, I
perceived, was called “Universal
Mathematics”, not a far fetched designation,
but one of long standing which has passed
into current use, because in this science is
contained everything on account of which
others are called parts of mathematics.”
6
18. -RKQ$6FKXVWHU'HVFDUWHVo 0DWKHVLVXQLYHUVDOLVDIWHU/HLEQL]
0DWKHVLV8QLYHUVOLV
In: 'HVFDUWHV3KLORVRSK
0DWKHPDWLFVDQG3KVLFV
7KH+DUYHVWHU3UHVV6XVVH[
%XUQHV 1REOHERRNV1HZ
-HUVHSS
$/8/(086 http://www.uni-muenster.de/Leibniz
p,WDTXHSURIHUWXU KLFFDOFXOXV TXLGDPQRYXV - BandVI4 - TeilbandA: Seite 1-509
HW PLULILFXVTXLLQRPQLEXV QRVWULV
UDWLRFLQDWLRQLEXV ORFXP KDEHWHWTXLQRQ
PLQXVDFFXUDWH SURFHGLW TXDP$ULWKPHWLFD Synopsis libri cui titulus er it:
DXW $OJHEUD4XR DGKLELWRVHPSHUWHUPLQDUL
Initia et Specimina Scientiae novae
SRVVXQWFRQWURYHUVLDH TXDQWXPH[ GDWLVHDV
GHWHUPLQDULSRVVLELOH HVW PDQXWDQWXP DG
Generalis
FDODPXPDGPRWD XWVXIILFLDW GXRV pro Instauratione et Augmentis
GLVSXWDQWHVRPLVVLVYHUERUXP
Scientiarum
FRQFHUWDWLRQLEXVVLELLQYLFHPGLFHUH
FDOFXOHPXVq S
21. (OHPHQWVRI8QLYHUVDO6FLHQFH 3DUV,,QLWLD 6FLHQWLDH*HQHUDOLV
p,8QLYHUVDOPDWKHPDWLFV IRU /LE,(OHPHQWD9HULWDWLV DHWHUQDH
PDJQLWXGHVRUTXDQWLWLHVDQGVLPL VHX GHIRUPD DUJXPHQWDQGL TXD
ODULWLHVRUTXDOLWLHVWREHGHWHUPL SHUPRGXP FDOFXOL RPQHVFRQWURYHUVLDH
QHGDOOWKHFDOFXODWLRQVUHDOL]HE GHPRQVWUDWLYH WROODQWXU f
QHZPHWKRGVEQXPEHUVDVIL[HG /LE,,'H$UWH,QYHQLHQGL f S
ZKLFKDULWKPHWLFVWXGLHVDVLQGHIL
22. f
QLWHZKLFKDOJHEUDVWXGLHV DQGE /LE,,, RQVLOLXP GH (QFFORSDHGLD
ZKLFKZKDWVHHPVKLWKHUWRLPSRV FRQGHQGD YHOXW,QYHQWDULRFRJQLWLRQLV
VLEOH UHVROYHVq KXPDQDHFRQGHQGR f S
23. Part I. Principles of Universal .DQWoV.ULWLNGHUUHLQHQ9HUQXQIW
Science
%RRN7KHHOHPHQWVRIHWHUQDO
YHULW f DOOWKH FRQWURYHUVLRQV VHWWOH
EPHDQVRIFDOFXODWLRQVf
%RRN7KHDUWRIGLVFRYHU f
%RRN$SODQIRU(QFFORSHGLD
IRUDQDFFHVVLRQERRNRIKXPDQ
The first edition The second edition
NQRZOHGJHWREHFUHDWHGf
3K6ORDQDERXWpWKHELRORJLFDO p.HLPHqDQGp$QODJHqDIWHU.DQW
URRWVRI.DQWoVDSULRULq
pS
28. p ,QELUGVRIWKHVDPHFSHFLHVZKLFK
IRUDGHWHUPLQDWHXQIROGLQJEHVWLPWHQ KDSSHQWROLYHLQGLIIHUHQWFOLPDWHV
$XVZLFNHOXQJ@DUHFDOOHGJHUPVKeime@ OLHJHUPVIRUWKHXQIROGLQJRIDQHZ
ZKHQWKLVXQIROGLQJDIIHFWVVSHFLILFSDUWV ODHURIIHDWHUVLIWKHOLYHLQFROG
%XWZKHQLWDIIHFWVRQOWKHVL]HRUWKH
FOLPDWHVZKLFKZLOOEHVXUSULVHG
UHODWLRQVRIWKHSDUWVWRRQHDQRWKHU,FDOO
WKHPQDWXUDOSUHGLSRVLWLRQVnatürliche
ZKHQWH UHVLGHLQWHPSHUDWXUH
Anlagen@q FOLPDWHV@fq
pKDQFHRUJHQHUDOPHFKDQLFDOODZV 7UDQVODWLRQE3K6ORDQ
[algemeine mechanische Gesetze] FDQQRWEULQJ (op. cit. p. 240)
EHLQJIRUWKVXFKDGDSWDWLRQV7KHUHEZH
PXVWFRQVLGHUVXFKRSSRUWXQLVWLFXQIROGLQJ
[Auswickelungen] DVSUHIRUPHG [vorgebildet]. Immanuel Kant. Kritik der
(YHQWKHQZKHUHQRWKLQJSXUSRVLYHLV
GLVSODHG, WKHEDUHFDSDFLW [vermögen] WR
reinen Vernunft (Hamburh:
SURSDJDWHLWVVSHFLDODFTXLUHGFKDUDFWHULV Meiner, 1980), S. 433-435.
DOUHDGGHPRQVWUDWLRQHQRXJKWKDWD
SDUWLFXODUJHUPRUQDWXUDOSUHGLVSRVLWLRQ
Editor: Jens Timmerman
[Keime oder natürliche Anlagen] IRULWKDV
EHHQGLVFRYHUHGLQRUJDQLFFUHDWLRQq
.DQWoV .ULWLN GHU8UWHLOVNUDIW “Wenn man dagegen an dem Verteidiger
der Epigenesis den großen Vorzug, den er
in Ansehung der Erfahrungsgründe zum
Beweise seiner Theorie vor dem ersteren
hat, gleich nicht kennete: so würde die Ver-
nunft doch schon zum voraus für seine Er-
klärungsart mit vorzüglicher Gunst einge-
nommen sein, weil sie die Natur in Anse-
hung der Dinge, welche man ursprünglich
nur nach der Kausalität der Zwecke sich als
S. 424 möglich vorstellen kann…”
9
29. “ … doch wenigstens, was die Fort-
pflanzung betrifft, als selbst hervor-
bringend, nicht bloß als entwickelnd,
betrachtet, und so doch mit dem kleinst- $FFRUGLQJWR.DQWWKHWKHRURI
möglichen Aufwande des Übernatürlichen HSLJHQHVLVFRQVLGHUHGQDWXUHQRW
alles Folgende vom ersten Anfange an der RQODVGHYHORSLQJEXWDOVRDV
Natur überläßt (ohne aber über diesen VHOIJHQHUDWLYHQDWXUH
ersten Anfang, an dem die Physik
überhaupt scheitert, sie mag es mit einer
Kette der Ursachen versuchen, mit welcher
sie wolle, etwas zu bestimten)”
.DQWoV .ULWLN GHU UHLQHQ9HUQXQIW
“Folglich bleibt nur das zweite übrig
(gleichsam ein System der
Epigenesis der reinen Vernunft):
daß nämlich die Kategorien von
seiten des Verstandes die Gründe
der Möglichkeit aller Erfahrung
überhaupt enthalten.”
S. 128
7UDQVODWHGE-0'0HLNOHMRKQ
.DQWoV .ULWLN GHU UHLQHQ9HUQXQIW
www.ilt.columbia.edu/academic/digitexts/kant/
pure_reason/pure_reason.txt
pRQVHTXHQWOQRWKLQJUHPDLQVEXW
WRDGRSWWKHVHFRQGDOWHUQDWLYH
ZKLFKSUHVHQWVXVZLWKDVVWHP
DVLWZHUHRIWKH HSLJHQHVLV RISXUH
UHDVRQ
31. Der transzendentalen Analytik
Die Analytik der Begriffe Translated by J. M. D. Meiklejohn
p:LUZHUGHQ DOVRGLH UHLQHQ%HJULIIH p:HVKDOOWKHUHIRUHIROORZXSWKHSXUH
ELV]XLKUHQHUVWHQ.HLPHQ XQG$QODJHQ FRQFHSWLRQVHYHQWRWKHLUJHUPVDQG
LPPHQVFKOLFKHQ9HUVWDQGHYHUIROJHQLQ EHJLQQLQJVLQWKHKXPDQXQGHUVWDQGLQJ
GHQHQVLHYRUEHUHLWHWOLHJHQ ELVVLH LQZKLFKWKHOLHXQWLOWKHDUH
HQGOLFKEHL*HOHJHQKHLW GHU (UIDKUXQJ GHYHORSHGRQRFFDVLRQVSUHVHQWHGE
HQWZLFNHOW XQG GXUFKHEHQGHQVHOEHQ H[SHULHQFHDQGIUHHGEWKHVDPH
9HUVWDQGYRQGHQLKQHQ DQKäQJHQGHQ XQGHUVWDQGLQJIURPWKHHPSLULFDO
HPSLULVFKHQ%HGLQJXQJHQEHIUHLWLQ FRQGLWLRQVDWWDFKLQJWRWKHPDUHVHW
LKUHU/DXWHUNHLWGDUJHVWHOOWZHUGHQq IRUWKLQWKHLUXQDOORHGSXULWq
RQFOXVLRQ
Two centuries later, Michel Foucault
attempted to classify analogically all
XVII century, the century of Linné
passed under the sign of classification. It the knowledge not by its
was sanctioned by a leaving His Creation correspondence to things, but by its
Creator, however yet remaining the focus coherence with itself. The hidden
of things, the order of thing as a specific focus of his notion of “epistema”, of
part of the world allowing for people to that coherence of words with
classify all the plants and animals… themselves, turned out Linné’s
principle of classification…
11