Gallery of Images
•Download as PPT, PDF•
1 like•932 views
Spend-A-Day Adult Day Service offers a variety of daily activities and therapies for older adults, including baking, crafts, exercise, outings, and intergenerational activities. Participants can receive physical, occupational or speech therapy while attending the program. Spend-A-Day has been serving older adults who choose to live at home since 1975 by providing engaging daily programs and helping participants and their families in parts of four New Jersey counties.
Report
Share
Report
Share
Recommended
Gallery of images II
Spend-A-Day Adult Day Service offers a variety of daily activities such as baking, crafts, exercise classes, games, and outings to accommodate different interests and abilities of participants. Therapies are also available through a partnership with Fox Rehab. The program aims to help older adults live at home and spend their days socializing while caregivers work. It has operated in Summit, New Jersey since 1975 and serves parts of four counties.
Cas class may 23rd
This document provides information and deadlines for an upcoming trip, including needing passports by the end of the weekend and paying outstanding fees by early June. It also mentions an upcoming meeting to finalize last-minute details for the trip and checks that registration has been completed online. Additionally, it provides guidance on documenting activities in Managebac by including a title, description, and reflection, and notes the need to reflect regularly. Finally, it announces that the school will host visiting overseas schools as tour guides to raise money for projects, and outlines upcoming beach and school cleanup events.
Which is which
A tulip is a type of flower. The document asks which flower is a tulip as part of a quiz. It then directs the reader back to the quiz.
Beberapa minggu terakhir banyak kasus yang diberitakan oleh mass media terkai...
siswa dan masalahnya
Moma 1991 0098_71
The Museum of Modern Art will host an exhibition titled "DISLOCATIONS" from October 1991 to January 1992. The exhibition will feature new installations by seven artists- Louise Bourgeois, Chris Burden, Sophie Calle, David Hammons, Ilya Kabakov, Bruce Nauman, and Adrian Piper. These installations have been created specifically for the exhibition and are intended to challenge viewers' habits of observation and settled attitudes. The installations are spread throughout the museum and range from monumental sculptures to found objects.
Risk Of Help
Crispin secretly follows Bear to save him from the one-eyed man. The chapter introduces the major characters of Crispin, who tries to save his friend Bear from getting into trouble, and Bear, who leaves for the village but Crispin realizes it isn't safe. The one-eyed man is a mysterious and tense presence who appears related to John Aycliffe. The document provides context and a prediction for the story.
Nm2216 DW6-03 Presentation
The document discusses a proposed solution to monitor the health of elderly and busy middle-aged people living alone using a wristband device and specialized pill dispenser.
The wristband would monitor vital signs, display alerts, and send notifications. The pill dispenser would hold and compartmentalize medication with a two-way link to the wristband. This solution aims to save lives by providing health monitoring and ensuring prompt medication in emergencies. However, some may be unwilling to wear a monitoring device constantly and costs need to be controlled.
Recommended
Gallery of images II
Spend-A-Day Adult Day Service offers a variety of daily activities such as baking, crafts, exercise classes, games, and outings to accommodate different interests and abilities of participants. Therapies are also available through a partnership with Fox Rehab. The program aims to help older adults live at home and spend their days socializing while caregivers work. It has operated in Summit, New Jersey since 1975 and serves parts of four counties.
Cas class may 23rd
This document provides information and deadlines for an upcoming trip, including needing passports by the end of the weekend and paying outstanding fees by early June. It also mentions an upcoming meeting to finalize last-minute details for the trip and checks that registration has been completed online. Additionally, it provides guidance on documenting activities in Managebac by including a title, description, and reflection, and notes the need to reflect regularly. Finally, it announces that the school will host visiting overseas schools as tour guides to raise money for projects, and outlines upcoming beach and school cleanup events.
Which is which
A tulip is a type of flower. The document asks which flower is a tulip as part of a quiz. It then directs the reader back to the quiz.
Beberapa minggu terakhir banyak kasus yang diberitakan oleh mass media terkai...
siswa dan masalahnya
Moma 1991 0098_71
The Museum of Modern Art will host an exhibition titled "DISLOCATIONS" from October 1991 to January 1992. The exhibition will feature new installations by seven artists- Louise Bourgeois, Chris Burden, Sophie Calle, David Hammons, Ilya Kabakov, Bruce Nauman, and Adrian Piper. These installations have been created specifically for the exhibition and are intended to challenge viewers' habits of observation and settled attitudes. The installations are spread throughout the museum and range from monumental sculptures to found objects.
Risk Of Help
Crispin secretly follows Bear to save him from the one-eyed man. The chapter introduces the major characters of Crispin, who tries to save his friend Bear from getting into trouble, and Bear, who leaves for the village but Crispin realizes it isn't safe. The one-eyed man is a mysterious and tense presence who appears related to John Aycliffe. The document provides context and a prediction for the story.
Nm2216 DW6-03 Presentation
The document discusses a proposed solution to monitor the health of elderly and busy middle-aged people living alone using a wristband device and specialized pill dispenser.
The wristband would monitor vital signs, display alerts, and send notifications. The pill dispenser would hold and compartmentalize medication with a two-way link to the wristband. This solution aims to save lives by providing health monitoring and ensuring prompt medication in emergencies. However, some may be unwilling to wear a monitoring device constantly and costs need to be controlled.
Upayapeningkatanaktivitassiswadalampembelajaranpkndenganmenggunakanmodelpembe...
Penelitian ini bertujuan untuk meningkatkan aktivitas siswa dalam pembelajaran Pendidikan Kewarganegaraan di SMPN 1 X Koto Singkarak dengan menerapkan model pembelajaran kooperatif jigsaw. Model ini diharapkan dapat meningkatkan partisipasi siswa dan tanggung jawab siswa dalam kelompok."
09) taxonomi
Dokumen tersebut membahas tentang taksonomi Bloom yang direvisi oleh Anderson dan Krathwohl. Taksonomi Bloom direvisi dengan mengubah terminologi dari kata benda menjadi kata kerja dan mengubah strukturnya menjadi dua dimensi yang ditinjau dari jenis pengetahuan dan proses berpikir. Revisi ini berfokus pada penggunaan taksonomi sebagai alat untuk merancang kurikulum, penyampaian materi, dan penilaian.
DLA SDP Trifold
The document describes the senior day program and respite care services offered at Grand Villa of DeLand. The program provides socialization and activities for seniors during the day while also offering assistance with tasks like medication, hygiene, and meals. It allows caregivers to take a break while their loved one is in a stimulating environment and receiving care. The senior day program has flexible hours and is available seven days a week.
GV DeLand Options Trifold
The document describes the services offered by Grand Villa of DeLand, including a senior day program, short-term stays, assisted living, personal care, and a memory care neighborhood. The senior day program provides activities and socialization during the day while also giving caregivers a break. Short-term stays offer recuperation services and respite for caregivers. Assisted living provides independence with support like medication management, meals, activities and housekeeping. Personal care provides 24-hour supervision and assistance with tasks like bathing. The memory care neighborhood uses a therapeutic program in a secure setting to engage residents with dementia.
GV DeLand 2015 MC Trifold
Grand Villa offers memory care respite stays for families to take a break from caregiving. The memory care program focuses on residents' abilities through individualized activities and a home-like environment. Family involvement is encouraged and the staff works as part of the care team. Grand Villa provides comprehensive memory care services and amenities in a secure, specially designed neighborhood.
Energiser Event
The document describes Dove Nest Group's "Summer Sizzlers" team building event in the Lake District. The two-day event uses interactive exercises and activities to energize teams and improve performance through shared experiences, effective communication, and learning about teammates. It offers challenges suited to all participants and is held at scenic venues near Windermere or in the Lyth Valley. The special summer package costs £4,000 plus VAT for up to 12 people, covering management, accommodations, meals, and insurance.
In homecare recession
This document provides tips and information for family caregivers on providing in-home care during economic difficulties. It discusses affordable housing options for seniors, the benefits of senior centers and adult day care, financing care beyond insurance, creating a team approach to caregiving, and how caregivers can potentially get paid for their services. The presentation was given by Home Instead Senior Care to educate caregivers.
Hearthstone Care, May 2017
Welcome to our new Social Adult Day Care - Hearthstone Care. Providing services in-home and in our new and modern home-like center
Senior finances presentation
This presentation is one of many available on senior topics to help families better understand the aging process and find resources to help their loved one remain safe and healthy in their home. To sign up for a workshop please contact our office. Note: Videos and manuals affiliated with this presentation are only available when attending the workshop.
For more information go to www.homeinstead.com/650.
June 2012 newsletter
This document provides tips for having a safe and fun summer vacation. It recommends checking your vehicle for proper tire pressure, fluid levels, and spare tire before traveling. It advises drinking plenty of water to stay hydrated, as caffeinated drinks and alcohol can dehydrate the body. When recreating in water, it warns against mixing alcohol and water activities like boating, as alcohol can impair coordination and judgment. Proper safety gear like life jackets is emphasized for water sports. Taking basic first aid and calling for help in emergencies are also suggested to ensure a safe and enjoyable vacation.
Sleep- away Camp.pptx
Our Maine overnight summer camp helps children build 21st century skills like collaboration, communication, critical thinking and creativity through outdoor activities that take them out of their comfort zone. This new england camp provides a safe environment for kids to gain independence and confidence when facing new challenges in life. The camp offers various programs and activities to help campers develop social skills, make new friends, build confidence and learn new skills through hands-on workshops. Regular exercise and physical activity is also encouraged to promote children's healthy development.
Wrap brochure
Edgewood Wraparound is a team-based service provided by Edgewood Center for Children and Families that aims to help at-risk youth in the child welfare, probation, or mental health systems transition to family settings. Wraparound teams include the youth, family, and formal/informal supports who work collaboratively to create individualized plans focused on the family's strengths, needs, and goals. Interventions are comprehensive and aim to support youth in their communities and prevent group home placements. Edgewood Wraparound is founded on principles like family voice and choice, cultural competence, and using natural community supports.
More Related Content
Viewers also liked
Upayapeningkatanaktivitassiswadalampembelajaranpkndenganmenggunakanmodelpembe...
Penelitian ini bertujuan untuk meningkatkan aktivitas siswa dalam pembelajaran Pendidikan Kewarganegaraan di SMPN 1 X Koto Singkarak dengan menerapkan model pembelajaran kooperatif jigsaw. Model ini diharapkan dapat meningkatkan partisipasi siswa dan tanggung jawab siswa dalam kelompok."
09) taxonomi
Dokumen tersebut membahas tentang taksonomi Bloom yang direvisi oleh Anderson dan Krathwohl. Taksonomi Bloom direvisi dengan mengubah terminologi dari kata benda menjadi kata kerja dan mengubah strukturnya menjadi dua dimensi yang ditinjau dari jenis pengetahuan dan proses berpikir. Revisi ini berfokus pada penggunaan taksonomi sebagai alat untuk merancang kurikulum, penyampaian materi, dan penilaian.
Viewers also liked (12)
Upayapeningkatanaktivitassiswadalampembelajaranpkndenganmenggunakanmodelpembe...
Upayapeningkatanaktivitassiswadalampembelajaranpkndenganmenggunakanmodelpembe...
Similar to Gallery of Images
DLA SDP Trifold
The document describes the senior day program and respite care services offered at Grand Villa of DeLand. The program provides socialization and activities for seniors during the day while also offering assistance with tasks like medication, hygiene, and meals. It allows caregivers to take a break while their loved one is in a stimulating environment and receiving care. The senior day program has flexible hours and is available seven days a week.
GV DeLand Options Trifold
The document describes the services offered by Grand Villa of DeLand, including a senior day program, short-term stays, assisted living, personal care, and a memory care neighborhood. The senior day program provides activities and socialization during the day while also giving caregivers a break. Short-term stays offer recuperation services and respite for caregivers. Assisted living provides independence with support like medication management, meals, activities and housekeeping. Personal care provides 24-hour supervision and assistance with tasks like bathing. The memory care neighborhood uses a therapeutic program in a secure setting to engage residents with dementia.
GV DeLand 2015 MC Trifold
Grand Villa offers memory care respite stays for families to take a break from caregiving. The memory care program focuses on residents' abilities through individualized activities and a home-like environment. Family involvement is encouraged and the staff works as part of the care team. Grand Villa provides comprehensive memory care services and amenities in a secure, specially designed neighborhood.
Energiser Event
The document describes Dove Nest Group's "Summer Sizzlers" team building event in the Lake District. The two-day event uses interactive exercises and activities to energize teams and improve performance through shared experiences, effective communication, and learning about teammates. It offers challenges suited to all participants and is held at scenic venues near Windermere or in the Lyth Valley. The special summer package costs £4,000 plus VAT for up to 12 people, covering management, accommodations, meals, and insurance.
In homecare recession
This document provides tips and information for family caregivers on providing in-home care during economic difficulties. It discusses affordable housing options for seniors, the benefits of senior centers and adult day care, financing care beyond insurance, creating a team approach to caregiving, and how caregivers can potentially get paid for their services. The presentation was given by Home Instead Senior Care to educate caregivers.
Hearthstone Care, May 2017
Welcome to our new Social Adult Day Care - Hearthstone Care. Providing services in-home and in our new and modern home-like center
Senior finances presentation
This presentation is one of many available on senior topics to help families better understand the aging process and find resources to help their loved one remain safe and healthy in their home. To sign up for a workshop please contact our office. Note: Videos and manuals affiliated with this presentation are only available when attending the workshop.
For more information go to www.homeinstead.com/650.
June 2012 newsletter
This document provides tips for having a safe and fun summer vacation. It recommends checking your vehicle for proper tire pressure, fluid levels, and spare tire before traveling. It advises drinking plenty of water to stay hydrated, as caffeinated drinks and alcohol can dehydrate the body. When recreating in water, it warns against mixing alcohol and water activities like boating, as alcohol can impair coordination and judgment. Proper safety gear like life jackets is emphasized for water sports. Taking basic first aid and calling for help in emergencies are also suggested to ensure a safe and enjoyable vacation.
Sleep- away Camp.pptx
Our Maine overnight summer camp helps children build 21st century skills like collaboration, communication, critical thinking and creativity through outdoor activities that take them out of their comfort zone. This new england camp provides a safe environment for kids to gain independence and confidence when facing new challenges in life. The camp offers various programs and activities to help campers develop social skills, make new friends, build confidence and learn new skills through hands-on workshops. Regular exercise and physical activity is also encouraged to promote children's healthy development.
Wrap brochure
Edgewood Wraparound is a team-based service provided by Edgewood Center for Children and Families that aims to help at-risk youth in the child welfare, probation, or mental health systems transition to family settings. Wraparound teams include the youth, family, and formal/informal supports who work collaboratively to create individualized plans focused on the family's strengths, needs, and goals. Interventions are comprehensive and aim to support youth in their communities and prevent group home placements. Edgewood Wraparound is founded on principles like family voice and choice, cultural competence, and using natural community supports.
Similar to Gallery of Images (10)
Recently uploaded
Pollen and Fungal allergy: aeroallergy.pdf
Pollen and Fungal allergy: aeroallergy.pdfChulalongkorn Allergy and Clinical Immunology Research Group
Pollen and Fungal allergy
Presented by Chaloemchai Chumsaengchotsakul, MD.
June 14, 2024Computer in pharmaceutical research and development-Mpharm(Pharmaceutics)
Statistics- Statistics is the science of collecting, organizing, presenting, analyzing and interpreting numerical data to assist in making more effective decisions.
A statistics is a measure which is used to estimate the population parameter
Parameters-It is used to describe the properties of an entire population.
Examples-Measures of central tendency Dispersion, Variance, Standard Deviation (SD), Absolute Error, Mean Absolute Error (MAE), Eigen Value
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14...
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14th Edition (Hinkle, 2017) Verified Chapter's 1 - 73 Complete.pdf
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14th Edition (Hinkle, 2017) Verified Chapter's 1 - 73 Complete.pdf
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14th Edition (Hinkle, 2017) Verified Chapter's 1 - 73 Complete.pdf
acne vulgaris -Mpharm (2nd semester) Cosmetics and cosmeceuticals
cosmetics and cosmeceuticals
Muskan
mpharm
2nd semester
Guru Gobind Singh college of pharmacy, yamunanagar, haryana
RESPIRATORY DISEASES by bhavya kelavadiya
The Children are very vulnerable to get affected with respiratory disease.
In our country, the respiratory Disease conditions are consider as major cause for mortality and Morbidity in Child.
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
This quiz was conducted as a promotional event for the 2024 Annual Meet of Kerala Chapter of API.
More than 20 participants took part everyday !
Giloy in Ayurveda - Classical Categorization and Synonyms
Giloy, also known as Guduchi or Amrita in classical Ayurvedic texts, is a revered herb renowned for its myriad health benefits. It is categorized as a Rasayana, meaning it has rejuvenating properties that enhance vitality and longevity. Giloy is celebrated for its ability to boost the immune system, detoxify the body, and promote overall wellness. Its anti-inflammatory, antipyretic, and antioxidant properties make it a staple in managing conditions like fever, diabetes, and stress. The versatility and efficacy of Giloy in supporting health naturally highlight its importance in Ayurveda. At Planet Ayurveda, we provide a comprehensive range of health services and 100% herbal supplements that harness the power of natural ingredients like Giloy. Our products are globally available and affordable, ensuring that everyone can benefit from the ancient wisdom of Ayurveda. If you or your loved ones are dealing with health issues, contact Planet Ayurveda at 01725214040 to book an online video consultation with our professional doctors. Let us help you achieve optimal health and wellness naturally.
Osvaldo Bernardo Muchanga-GASTROINTESTINAL INFECTIONS AND GASTRITIS-2024.pdf
Osvaldo Bernardo Muchanga-GASTROINTESTINAL INFECTIONS AND GASTRITIS-2024.pdfOsvaldo Bernardo Muchanga
GASTROINTESTINAL INFECTIONS AND GASTRITIS
Osvaldo Bernardo Muchanga
Gastrointestinal Infections
GASTROINTESTINAL INFECTIONS result from the ingestion of pathogens that cause infections at the level of this tract, generally being transmitted by food, water and hands contaminated by microorganisms such as E. coli, Salmonella, Shigella, Vibrio cholerae, Campylobacter, Staphylococcus, Rotavirus among others that are generally contained in feces, thus configuring a FECAL-ORAL type of transmission.
Among the factors that lead to the occurrence of gastrointestinal infections are the hygienic and sanitary deficiencies that characterize our markets and other places where raw or cooked food is sold, poor environmental sanitation in communities, deficiencies in water treatment (or in the process of its plumbing), risky hygienic-sanitary habits (not washing hands after major and/or minor needs), among others.
These are generally consequences (signs and symptoms) resulting from gastrointestinal infections: diarrhea, vomiting, fever and malaise, among others.
The treatment consists of replacing lost liquids and electrolytes (drinking drinking water and other recommended liquids, including consumption of juicy fruits such as papayas, apples, pears, among others that contain water in their composition).
To prevent this, it is necessary to promote health education, improve the hygienic-sanitary conditions of markets and communities in general as a way of promoting, preserving and prolonging PUBLIC HEALTH.
Gastritis and Gastric Health
Gastric Health is one of the most relevant concerns in human health, with gastrointestinal infections being among the main illnesses that affect humans.
Among gastric problems, we have GASTRITIS AND GASTRIC ULCERS as the main public health problems. Gastritis and gastric ulcers normally result from inflammation and corrosion of the walls of the stomach (gastric mucosa) and are generally associated (caused) by the bacterium Helicobacter pylor, which, according to the literature, this bacterium settles on these walls (of the stomach) and starts to release urease that ends up altering the normal pH of the stomach (acid), which leads to inflammation and corrosion of the mucous membranes and consequent gastritis or ulcers, respectively.
In addition to bacterial infections, gastritis and gastric ulcers are associated with several factors, with emphasis on prolonged fasting, chemical substances including drugs, alcohol, foods with strong seasonings including chilli, which ends up causing inflammation of the stomach walls and/or corrosion. of the same, resulting in the appearance of wounds and consequent gastritis or ulcers, respectively.
Among patients with gastritis and/or ulcers, one of the dilemmas is associated with the foods to consume in order to minimize the sensation of pain and discomfort. PGx Analysis in VarSeq: A User’s Perspective
Since our release of the PGx capabilities in VarSeq, we’ve had a few months to gather some insights from various use cases. Some users approach PGx workflows by means of array genotyping or what seems to be a growing trend of adding the star allele calling to the existing NGS pipeline for whole genome data. Luckily, both approaches are supported with the VarSeq software platform. The genotyping method being used will also dictate what the scope of the tertiary analysis will be. For example, are your PGx reports a standalone pipeline or would your lab’s goal be to handle a dual-purpose workflow and report on PGx + Diagnostic findings.
The purpose of this webcast is to:
Discuss and demonstrate the approaches with array and NGS genotyping methods for star allele calling to prep for downstream analysis.
Following genotyping, explore alternative tertiary workflow concepts in VarSeq to handle PGx reporting.
Moreover, we will include insights users will need to consider when validating their PGx workflow for all possible star alleles and options you have for automating your PGx analysis for large number of samples. Please join us for a session dedicated to the application of star allele genotyping and subsequent PGx workflows in our VarSeq software.
District Residency Programme (DRP) for PGs in India.pptx
District Residency Programme (DRP) for PG in India
Microbiology & Parasitology Exercises Parts of the Microscope
Exercise 1 of Microbiology and Parasitology which is the parts of the microscope and their uses
NARCOTICS- POLICY AND PROCEDURES FOR ITS USE
This document outlines policies and procedures for handling narcotic and controlled drugs in NABH accredited hospitals.
Helminthiasis or Worm infestation in Children for Nursing students
Brief description worm infestation/Helminthiasis for Basic B.Sc Nursing students
Pharmacology of 5-hydroxytryptamine and Antagonist
5-hydroxytryptamine or 5-HT or Serotonin is a neurotransmitter that serves a range of roles in the human body. It is sometimes referred to as the happy chemical since it promotes overall well-being and happiness.
It is mostly found in the brain, intestines, and blood platelets.
5-HT is utilised to transport messages between nerve cells, is known to be involved in smooth muscle contraction, and adds to overall well-being and pleasure, among other benefits. 5-HT regulates the body's sleep-wake cycles and internal clock by acting as a precursor to melatonin.
It is hypothesised to regulate hunger, emotions, motor, cognitive, and autonomic processes.
Breast cancer: Post menopausal endocrine therapy
Breast cancer in postmenopausal women with hormone receptor-positive (HR+) status is a common and complex condition that necessitates a multifaceted approach to management. HR+ breast cancer means that the cancer cells grow in response to hormones such as estrogen and progesterone. This subtype is prevalent among postmenopausal women and typically exhibits a more indolent course compared to other forms of breast cancer, which allows for a variety of treatment options.
Diagnosis and Staging
The diagnosis of HR+ breast cancer begins with clinical evaluation, imaging, and biopsy. Imaging modalities such as mammography, ultrasound, and MRI help in assessing the extent of the disease. Histopathological examination and immunohistochemical staining of the biopsy sample confirm the diagnosis and hormone receptor status by identifying the presence of estrogen receptors (ER) and progesterone receptors (PR) on the tumor cells.
Staging involves determining the size of the tumor (T), the involvement of regional lymph nodes (N), and the presence of distant metastasis (M). The American Joint Committee on Cancer (AJCC) staging system is commonly used. Accurate staging is critical as it guides treatment decisions.
Treatment Options
Endocrine Therapy
Endocrine therapy is the cornerstone of treatment for HR+ breast cancer in postmenopausal women. The primary goal is to reduce the levels of estrogen or block its effects on cancer cells. Commonly used agents include:
Selective Estrogen Receptor Modulators (SERMs): Tamoxifen is a SERM that binds to estrogen receptors, blocking estrogen from stimulating breast cancer cells. It is effective but may have side effects such as increased risk of endometrial cancer and thromboembolic events.
Aromatase Inhibitors (AIs): These drugs, including anastrozole, letrozole, and exemestane, lower estrogen levels by inhibiting the aromatase enzyme, which converts androgens to estrogen in peripheral tissues. AIs are generally preferred in postmenopausal women due to their efficacy and safety profile compared to tamoxifen.
Selective Estrogen Receptor Downregulators (SERDs): Fulvestrant is a SERD that degrades estrogen receptors and is used in cases where resistance to other endocrine therapies develops.
Combination Therapies
Combining endocrine therapy with other treatments enhances efficacy. Examples include:
Endocrine Therapy with CDK4/6 Inhibitors: Palbociclib, ribociclib, and abemaciclib are CDK4/6 inhibitors that, when combined with endocrine therapy, significantly improve progression-free survival in advanced HR+ breast cancer.
Endocrine Therapy with mTOR Inhibitors: Everolimus, an mTOR inhibitor, can be added to endocrine therapy for patients who have developed resistance to aromatase inhibitors.
Chemotherapy
Chemotherapy is generally reserved for patients with high-risk features, such as large tumor size, high-grade histology, or extensive lymph node involvement. Regimens often include anthracyclines and taxanes.
Spontaneous Bacterial Peritonitis - Pathogenesis , Clinical Features & Manage...
In this presentation , SBP ( spontaneous bacterial peritonitis ) , which is a common complication in patients with cirrhosis and ascites is described in detail.
The reference for this presentation is Sleisenger and Fordtran's Gastrointestinal and Liver Disease Textbook ( 11th edition ).
Recently uploaded (20)
Computer in pharmaceutical research and development-Mpharm(Pharmaceutics)
Computer in pharmaceutical research and development-Mpharm(Pharmaceutics)
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14...
TEST BANK For Brunner and Suddarth's Textbook of Medical-Surgical Nursing, 14...
acne vulgaris -Mpharm (2nd semester) Cosmetics and cosmeceuticals
acne vulgaris -Mpharm (2nd semester) Cosmetics and cosmeceuticals
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
Medical Quiz ( Online Quiz for API Meet 2024 ).pdf
Giloy in Ayurveda - Classical Categorization and Synonyms
Giloy in Ayurveda - Classical Categorization and Synonyms
Osvaldo Bernardo Muchanga-GASTROINTESTINAL INFECTIONS AND GASTRITIS-2024.pdf
Osvaldo Bernardo Muchanga-GASTROINTESTINAL INFECTIONS AND GASTRITIS-2024.pdf
District Residency Programme (DRP) for PGs in India.pptx
District Residency Programme (DRP) for PGs in India.pptx
Microbiology & Parasitology Exercises Parts of the Microscope
Microbiology & Parasitology Exercises Parts of the Microscope
Tele Optometry (kunj'sppt) / Basics of tele optometry.
Tele Optometry (kunj'sppt) / Basics of tele optometry.
Helminthiasis or Worm infestation in Children for Nursing students
Helminthiasis or Worm infestation in Children for Nursing students
Pharmacology of 5-hydroxytryptamine and Antagonist
Pharmacology of 5-hydroxytryptamine and Antagonist
pharmacy exam preparation for undergradute students.pptx
pharmacy exam preparation for undergradute students.pptx
Spontaneous Bacterial Peritonitis - Pathogenesis , Clinical Features & Manage...
Spontaneous Bacterial Peritonitis - Pathogenesis , Clinical Features & Manage...
Gallery of Images
- 1. Live at home … spend your days with us! Spend-A-Day Adult Day Service: a part of SAGE Eldercare
- 3. Spend-A-Day’s Gardening Club Bowling on Nintendo Wii
- 4. Spend-A-Day offers a wide variety of activities to accommodate the participants’ variety of interests and functional levels. Today may start with Baking Group and Word Scramble. Tomorrow morning may offer Book Club and Crafts.
- 5. Through a partnership with Fox Rehab, participants can receive physical, occupational, or speech therapy while attending the program.
- 6. Daily exercise includes Tai Chi, walking program, & aerobics
- 7. … and we know how to celebrate!
- 11. Spend-A-Day schedules regular outings to lunch and local attractions
- 13. Since 1975, older adults have chosen to live at home, and spend their days with us. Call 908-598-5520 to arrange for a personal tour. Financial assistance and transportation available. Private pay, Medicaid, & Respite accepted. Helping older adults and families in parts of Union, Essex, Morris and Somerset counties. Located in Summit, NJ. Established 1975.