1. The opening title sequence of the film establishes key mysteries to grip the audience and set the tone. Scenes showing a depressed mother and a missing girl leave the audience with questions about what happened. Dark music and visuals signal this will be an emotional thriller for the audience to solve. 2. Distribution with 20th Century Fox would be suitable as they have experience with similar mystery thriller genres which tend to be successful. They could promote and distribute the film effectively to the right audience. 3. Test audiences who enjoyed films like Gone Girl and Taken would likely enjoy this film due to the similar mysterious and gripping nature. The film targets those aged 15+ of both genders who enjoy solving mysteries and clues in

1. 1. In our openingsequence we includedthe mostimportantcreditssothatthose are theypeople
whoget the mostrecognition. The Girl withthe DragonTattoo alsousedthistechnique.Afterthe
firstfive creditsthatwere shown, whichwere the productionanddistributioncompaniesandthe
mainactors of the film,the title wasshown.Afterthis,the restof the importantcreditscontinued.
As well asthis,inbetweenthe creditswe had shortclipsof what hadhappenedpreviousto the
eventsthatwouldactuallybe happeninginthe film.Theybuiltupa storyline andmade the audience
understandaboutwhatwouldbe happeningandwhy.Thisisusedinotherfilmstooforthe exact
same reason,itquicklygivesthe viewersanunderstandingof the narrative. ‘MissionImpossible –
Ghost Protocol’ showsclipsinbetweencreditstoshow whatishappeningsothatthe filmwill start
rightaway by justcontinuingwhathasbeenshown, ratherthanstartingcompletelyfromnothing.It
alsogivesthe audience aclearunderstandingof whattype of filmitisgoingto be by containing
fightinganda burningfuse throughoutthe entire openingcredits,
(https://www.youtube.com/watch?v=GJCvU-91eAo).The motherinthe filmislookingverywornout
and as if she is witheringaway.Witha bottle of wine inone handanda syringe inthe other,the
audience canclearlytell thatshe isa severelydepressedwomanwhohashitrockbottom. The news
reporterlooksprofessional andalsotalksveryclearly.Before she evenbegantospeak,youcouldtell
that itwas aboutto be a newsreportbecause of the wayshe wasstoodin the camera shotand her
surroundings.We hada close upof the syringe aboutto be put intothe mothersarm, thishighlights
the importance of thisspecificitemand letsthe audience knowthatitwill be a bigthingthroughout
the whole film.The filmSe7en alsousedcloseupsof itemsinthe openingcreditsasit exaggerates
the importance of those specificitems,suchas blades,scrapbooksandgoryphotographs,which
makesthemseemmore dramatic. The musicthat we chose to go overthe backgroundof the
openingsequence wasslowandmeaningful.Itfitinwiththe storyline assomethingtraumatichad
happened. Itisveryoftenthatthe backgroundmusicfitsinwiththe actual storyof the filmasit
makesyouunderstandthe scenarioandalsogetsyour mindreadytowatch that certaingenre of
film.
2. As soonas you sawthe motherinthe title sequenceof ourfilmyoucouldtell thatshe wasclose
to the people whowere inthe crashsimplybecause of how muchof a badway she was in,her
drainedface andpale complexioninstantlygivesthe audiencethe ideathatshe doesn’tlook after
herself andherveryslimbuildisthe typical bodyof somebodywhohasturnedtodrugsand alcohol
duringa toughtime intheirlives. Aswell asthis,she wascompletelysurroundedbyemptywine
bottleswhichwasthe shotthat confirmedthatshe wasan alcoholic.The newsreporterhada big
luxuriouscoatonand herhair and make-upwasdone veryprofessionally,thisshowsthatshe hasa
veryimportantjobto broadcastnewsto people all overthe country andthat she iswell paidand
lookedafterbythe crewshe worksfor.
3. 20th
CenturyFox distributedthe film‘Gone Girl’whichisof a similargenre andstoryline toour
film‘Astray’.Theyare bothmysterythrillers whichare verygripping.Thiscompanywouldbe agood
one to distribute ourfilm asitalsodistributedall three of the ‘Taken’films. 20th
CenturyFox have
goodexperienceindistributingfilmsof thisgenre whichusuallyturnouttobe a huge success,this
makesthemthe bestcandidate todistribute ‘Astray’astheyknow exactlywhattheyare doing

2. whichmeansthat we couldtrustthemwitheverythingtomake sure thatour filmis a successrather
than a huge failure. Aswell asthis,20th
CenturyFox are alwayssearchingforsmall independentfilms
to make and distribute astheydone justfocusonhuge blockbusterfilms. The partof 20th
Century
Fox that wouldactuallydistributeoutfilmwouldbe the sistercompany,Fox SearchlightPictures. It
specializesinUSdistributionof independentandBritishfilms whichwouldbe perfectforus.
4. The targetaudience forour filmwouldbe bothmale andfemale andthe filmwouldmostlikelybe
a certificate of 15. As well asthis,the people whowouldbe attractedtoourfilmwouldbe those
whoare alreadyintothatspecificgenre of film(thriller) astheyare the oneswhoare alwayslooking
out fornewfilmssimilartothe onesthatthey’ve seenbefore astheyfoundthemgrippingand
interestingsotheyalwayswantmore. Ourmediaproductisfor people wholike all filmswhichare
somewhatgripping.If theylikeotherfilmsof the same genre,theyare mostlikelytoenjoythisone
too.Anybodywhodoesn’tandneverhashadan interestinthistype of filmtendtonot be attracted
to it as theyalreadyknowthattheyprobablywon’tenjoyit. Tofindthisoutwe askedeachof our
classmateswhetherornottheywouldwanttowatch the filmafterseeingthe openingsequence
and theywhyor whynot aftertheygave theiranswer. Ourfilmwouldprobablyappealtopeople
aged15+ and of bothgenders.The thingthat they wouldhave incommonis that theylike wracking
theirbrainstryingto solve aproblem/mystery,pickingupnew cluesasthe filmwenton. Fansof
filmslike ‘Taken’and‘Gone Girl’wouldbe sure toenjoyourfilmastheyare all verysimilarinthe
sense thattheyare odd,grippingandmysterious.
5. First,we chose a fontwhichfittedinwiththe storylineandgenre of the film.We comparedmany
and thenchose the one whichwasthe mostgripping.After thiswe decidedonthe soundtrackwhich
we wouldhave overthe openingsequence,we chose the slow versionof ‘Heaven’asitisquite
emotional.Thismade the audience know thatthe filmwasgoingtobe emotional aswell asthrilling.
Thisway the audience knowexactlywhattoexpectwhentheygotosee the film. Ontopof this,the
filmstartedmidway throughashockingevent,thismakesthe audience wanttofindoutwhythis
eventhappenedandwhatwouldbe happeningafterwards.Itmakesthemfeelasthoughtheyare
nowa part of the eventandthat theyhave to stickthroughand try and solve the mysteryof what
happenedalongwiththe othercharacters. There are several enigmacodesthroughoutthe opening
title sequenceof ourfilm.Whathas happenedthat hasbeensobad that the motherhasturnedto a
life of drugsand alcohol?Whywasthe little girl missingwhenpeople attendedthe crime scene?
Who had herand where wasshe?Using small mysterieslike thisinthe title sequence gripsthe
audience andmakesthemfeel like theyneedtocontinue watchingtofindoutthe answerstoall of
the questionsthatare spinningaroundintheirheads. Ontopof all of this,we made sure that the
storyline we usedwassimilartoothersfromfilmsof the same genre asthenthere wouldbe a
specificaudiencethatwouldturnupto watch the filmastheyare expectingittobe as enjoyable as
the otherfilmstheyhave seenandliked.Todothiswe showedthe mainmysteryatthe very
beginningandalsouseddarkandgritty colouringandfonts,thiswaytheywouldhave beenable to
almostjudge the actual filmbefore ithadevenstarted.

3. 6. We useda lot of differenttechnologiesduringthe processof makingourmediaproduct.Google
was usedmainlyforresearch,withthis we founddifferentfonts,lookedatseveral filmsof the same
genre as the one we were makingtocompare themandtake notesabout themsothat our film
wouldbe as correct as itcouldbe inthe sense thatit representagoodthrillerfilm.Aswell as
Google,we usedYouTube.We searchedforlotsof differentclipsandtitlessequencesof thrillerfilms
so that we couldcompare themand thenmake sure that ourswas similarsothat itfitin withthat
particulargenre.We alsogot our backingmusicfromYouTube by convertingittoand MP3 file.
Bloggerwasusedfor usto keepa note on everythingthatwe didincludingbothfilmingand
research.Thiswaywe couldkeeptrack of ourprogressso that we knew exactlywhatournextstep
wouldneedtobe.The most usedthingthatwas a part of our makingwasAdobe , withthiswe
editedall of ourfilmedpartstogetheraswell asaddingcreditslidesandthe backingmusic.We
couldcrop our clipsto howwe neededthemandwe couldalsodrag anddrop themto whereverwe
neededthemsothattheywouldflowtogetherwell.
7. With our preliminarytaskwe were quite shakywiththe cameraaswe were justgettingusedto
the way that we hadto use it.Whenwe didthe filmingforourfinal mediaproduct,we usedatripod
some of the time andalsohad somebodyguidingthe personwhowasholdingthe camerasothat
theyonlyhadto thinkabout keepingthe camerastill ratherthanthatand where theywere moving
to, thismade our filmingalotsmoother. Aswell asthis,we didn’tplanandprepare verywell before
the preliminarytaskwasfilmedasitdidn’tcountfor anythingandwasjust like apractice film.For
our actual filmwe made detailedscripts,storyboards andevenfilmedpartsmore thanonce so that
we got the sectionsexactlyhowwe neededthemtobe. The storyboardshelpedusvisualise what
our filmwould sortof looklike whenwe actuallygotitactedout forthe real thing.