SlideShare a Scribd company logo
1 of 5
Successful Women Expatriates: Foreign, Not Female
In a classic article titled “A Gaijin, Not a Woman,” Nancy
Adler debunked one of the key myths regarding women as
expatriates.*Gaijin is the Japanese word for foreigner. From her
research, Adler concluded that it is a mistake to assume that
people from foreign cultures, even traditionally patriarchal
Asian cultures, apply the same gender role expectations to
foreign women that they apply to local women. It seems that
people from even very traditional cultures can view foreign
businesswomen so differently from how they view local women
that gender becomes irrelevant for business purposes. For
example, one businesswoman working in Sudan was surprised
by the behavior of her Sudanese host. She asked him how it was
possible that he could serve her food, give her a cushion to sit
on, and wash her arms after the meal. Men never do these things
for women according to traditional Sudanese gender role
expectations. The Sudanese host reasoned, “Oh, it’s no problem.
Women do not do business; therefore, you are not a
woman.”* After establishing a business relationship, according
to Adler, the real issues that arise in cross-cultural interactions
depend more on how host country people react to people of
another nationality than on how they react to an expatriate’s
gender.
The Woman’s Advantage and Disadvantage
Some studies suggest that women may have some advantages in
expatriate positions, especially in Asia.* Being unique has its
benefits. Because so few women have expatriate assignments,
women who take them report being more visible. Local
businesspeople were more likely to remember them and often
sought them out more than the women’s male colleagues. North
American expatriate women also report that local businessmen
from traditional cultures assume that the woman is the best
person for the job, reasoning, “Why else would the organization
send a woman?”
Women may be more likely to excel in relational skills, a major
factor in expatriate success. Women report that local male
managers can be more open in communication with a woman
than with a man. Local men, even from traditional cultures, can
talk at ease with a woman about an array of subjects that
include issues outside the domain of traditional male-only
conversations. Consequently, being both a businessperson and
female gives expatriate women a wider range of interaction
options than those available to expatriate men or to local
women.*
A recent study provides further insights into the potential
advantages that female expatriates have relative to male
expatriates.* In a comparative small survey of expatriates, the
researchers found that female expatriates had higher scores of
self-transcendence than males. Self-transcendence, made up of
universalism (ability to understand, appreciate, and care for the
well-being of others and nature) and benevolence (ability to
make decisions that shows caring and enhancement of the
wellbeing of others), is expected to help expatriates adjust well
in other cultures. Individuals with high self-transcendence are
expected to be more understanding and open-minded and also
more loyal and forgiving. The researchers do indeed find that
the female expatriates they study have higher self-transcendence
than the male expatriates. The study also shows that higher self-
transcendence is indeed linked to stronger cultural and work
adjustment. The study thus provides some mechanisms as to
why female expatriates do perform better than male expatriates.
· Despite the many obvious advantages women expatriates
enjoy, the situation is nevertheless bleak for many of them. In-
depth interviews with 50 European female expatriates revealed
that they faced much worse situations than their male
counterparts.* Female expatriates are more likely to Face the
glass ceiling: Women expatriates have more difficulty being
taken seriously in the early stages of their career. They are more
likely to face isolation and loneliness.* They must work harder
than their male counterparts, and they constantly need to prove
themselves. Studies have shown that, in some cases, women
have to be at much higher positions than their male counterparts
before they are assigned international positions.
· Need to balance work and family responsibilities: Because of
socialization and childhood experiences, research suggests that
women expatriates may have a higher burden than their male
counterparts to balance family and home responsibilities. There
is evidence that female expatriates may be more likely to have
to choose between having an international career and having a
family, often because of very little support from the partner.
Not surprisingly, women managers are less likely to be married
and more likely to remain childless than their male
counterparts.*
· Need to worry about accompanying spouse: Many female
expatriates felt that they could be successful only if the career
of their spouse became secondary. However, because of societal
norms, it is still difficult for male partners to accept that their
spouses have the primary career. It has been found that female
expatriates are more likely to have partners with professional
careers and that it is more difficult for the company to
accommodate the needs of the male partner because of visa
regulations and other host country work policies.*
Furthermore, even in societies where women may have
advantages because they are viewed differently (e.g., gaijin in
Japan), they still face significant barriers. For instance,
although research found that Western women had some
advantages because they were seen as foreigners rather than as
women, it also found that these women faced significant
barriers, influencing their ability to adjust to the Japanese
environment and to perform well in their jobs.* However, a
more recent study argued that Western women should have an
easier time in Japan.* It reasoned that Japan has experienced
many institutional changes, such as a more flexible market,
growth of foreign multinational presence, growth of women in
the workforce, and Japan’s 1986 Equal Opportunity Act. These
changes should result in some convergence between Western
and Japanese attitudes toward women and make for a better
environment for women. However, results show that many of
the barriers found in a similar study a decade ago are still
formidable. Foreign women managers still face cultural barriers,
making it harder for them to adjust to their new jobs, perform
well, and become accepted in Japan.
The next section explains that women are an ever-growing
segment of the expatriate population and companies can
implement programs to ensure that they have an opportunity to
flourish.What Can Companies Do to Ensure Female Expatriate
Success?
Despite the disadvantages women face, the opportunities for
them as expatriate managers are expected to grow, particularly
with global companies. Scholars see several factors leading to
more women in international assignments.
Many global and multinational companies face an acute
shortage of high-quality multinational managers.* At the same
time, perhaps because of the rise in dual-career couples, fewer
men are willing to take the assignments.* One solution is to tap
the available population of women managers. Freed from local
cultural barriers that restrict the use of women managers,
multinational companies can select the best people for the job
regardless of gender. Because of potentially stronger relational
skills, women managers often may be better qualified for
international positions than their male colleagues.
Because women expatriates are likely to increase in number
and are as motivated and willing to take international
assignments as men, companies must take the necessary steps to
ensure that their female expatriates are successful. Companies
should ensure that the following steps are implemented:
· Provide mentors: Because women expatriates face more
barriers than their male counterparts, mentors can furnish the
necessary psychosocial support to face such obstacles.* Mentors
can be informal and provide guidance to the female expatriates.
Mentors from the home office can supply the necessary support
to facilitate reentry to the home office.
· Offer opportunities for interpersonal networks as a form of
organizational support: Access to a network of colleagues in
similar situation can be a source of social support, contacts, and
opportunities. Although it may be difficult for the female
expatriates to gain access to the typical male-dominated
networks,* the organization can take the necessary steps to
develop formal professional networks of female managers.
· Remove sources of barriers: The organization should ensure
that female expatriates are treated as fairly and equally as their
male counterparts.* The HRM department can be instrumental
in this effort. The organization also needs to educate their
employees and change stereotypical attitudes toward women
expatriates.
· Provide support to cope with dual-career issues: The
organization should accept that women expatriates face peculiar
and more difficult circumstances regarding their spouses than
male counterparts do. It should furnish the necessary counseling
to ensure that the couple is aware of the difficulties an
international assignment will pose for the family. The company
should help the spouse find an equivalent job or provide the
necessary counseling.

More Related Content

Similar to Successful Women Expatriates Foreign, Not FemaleIn a classic ar.docx

Surname 7Student’s NameProfessor’s NameCourseDate How .docx
Surname 7Student’s NameProfessor’s NameCourseDate How .docxSurname 7Student’s NameProfessor’s NameCourseDate How .docx
Surname 7Student’s NameProfessor’s NameCourseDate How .docxdeanmtaylor1545
 
Special issues in IHRM (Gender and Ethics)
Special issues in IHRM (Gender and Ethics)Special issues in IHRM (Gender and Ethics)
Special issues in IHRM (Gender and Ethics)Swe Zin Phyoe
 
Women and Giving: Meaningful Approaches and Stewardship
Women and Giving: Meaningful Approaches and StewardshipWomen and Giving: Meaningful Approaches and Stewardship
Women and Giving: Meaningful Approaches and StewardshipBloomerang
 
12. (TCOs B and E) The Caltor Company gathered the following conde.docx
12. (TCOs B and E) The Caltor Company gathered the following conde.docx12. (TCOs B and E) The Caltor Company gathered the following conde.docx
12. (TCOs B and E) The Caltor Company gathered the following conde.docxhyacinthshackley2629
 
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptx
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptxGENDER-AND-DEVELOPMENT-MAINSTREAMING.pptx
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptxAngelEngbino
 
some debate shit about women being leaders 1
some debate shit about women being leaders 1some debate shit about women being leaders 1
some debate shit about women being leaders 1Alex Bong
 
Feminist Struggle Against Biases in Manju Kapur’s Home
Feminist Struggle Against Biases in Manju Kapur’s HomeFeminist Struggle Against Biases in Manju Kapur’s Home
Feminist Struggle Against Biases in Manju Kapur’s HomeIRJET Journal
 
GAD GST TANAUAN.ppt
GAD GST TANAUAN.pptGAD GST TANAUAN.ppt
GAD GST TANAUAN.pptSevBlanco
 
· First e-Activity, suggest the major reasons why a well-integrate.docx
· First e-Activity, suggest the major reasons why a well-integrate.docx· First e-Activity, suggest the major reasons why a well-integrate.docx
· First e-Activity, suggest the major reasons why a well-integrate.docxoswald1horne84988
 
A Review Of Discrimination In Employment And Workplace
A Review Of Discrimination In Employment And WorkplaceA Review Of Discrimination In Employment And Workplace
A Review Of Discrimination In Employment And WorkplaceLori Moore
 
Qiang 6Gender NormsIntroductionAs human beings, we have a.docx
Qiang 6Gender NormsIntroductionAs human beings, we have a.docxQiang 6Gender NormsIntroductionAs human beings, we have a.docx
Qiang 6Gender NormsIntroductionAs human beings, we have a.docxmakdul
 
Women : Self Build Pillars
Women : Self Build PillarsWomen : Self Build Pillars
Women : Self Build PillarsPrafful Daga
 
Women: Self Build Pillars of Individual, Family and Community
Women: Self Build Pillars of Individual, Family and CommunityWomen: Self Build Pillars of Individual, Family and Community
Women: Self Build Pillars of Individual, Family and CommunityPrafful Daga
 
Focusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfFocusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfarishmarketing21
 
Moving our of the Shadow: Excelling in a Male Dominated Field
Moving our of the Shadow: Excelling in a Male Dominated FieldMoving our of the Shadow: Excelling in a Male Dominated Field
Moving our of the Shadow: Excelling in a Male Dominated FieldSociety of Women Engineers
 
Why we need more women leaders
Why we need more women leadersWhy we need more women leaders
Why we need more women leadersShiftbalance
 
Discrimination Against Women
Discrimination Against WomenDiscrimination Against Women
Discrimination Against WomenAndie Nds
 

Similar to Successful Women Expatriates Foreign, Not FemaleIn a classic ar.docx (20)

Surname 7Student’s NameProfessor’s NameCourseDate How .docx
Surname 7Student’s NameProfessor’s NameCourseDate How .docxSurname 7Student’s NameProfessor’s NameCourseDate How .docx
Surname 7Student’s NameProfessor’s NameCourseDate How .docx
 
Special issues in IHRM (Gender and Ethics)
Special issues in IHRM (Gender and Ethics)Special issues in IHRM (Gender and Ethics)
Special issues in IHRM (Gender and Ethics)
 
Taking The Lead 2019: Global Report
Taking The Lead 2019: Global Report Taking The Lead 2019: Global Report
Taking The Lead 2019: Global Report
 
Women and Giving: Meaningful Approaches and Stewardship
Women and Giving: Meaningful Approaches and StewardshipWomen and Giving: Meaningful Approaches and Stewardship
Women and Giving: Meaningful Approaches and Stewardship
 
12. (TCOs B and E) The Caltor Company gathered the following conde.docx
12. (TCOs B and E) The Caltor Company gathered the following conde.docx12. (TCOs B and E) The Caltor Company gathered the following conde.docx
12. (TCOs B and E) The Caltor Company gathered the following conde.docx
 
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptx
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptxGENDER-AND-DEVELOPMENT-MAINSTREAMING.pptx
GENDER-AND-DEVELOPMENT-MAINSTREAMING.pptx
 
some debate shit about women being leaders 1
some debate shit about women being leaders 1some debate shit about women being leaders 1
some debate shit about women being leaders 1
 
Feminist Struggle Against Biases in Manju Kapur’s Home
Feminist Struggle Against Biases in Manju Kapur’s HomeFeminist Struggle Against Biases in Manju Kapur’s Home
Feminist Struggle Against Biases in Manju Kapur’s Home
 
GAD GST TANAUAN.ppt
GAD GST TANAUAN.pptGAD GST TANAUAN.ppt
GAD GST TANAUAN.ppt
 
· First e-Activity, suggest the major reasons why a well-integrate.docx
· First e-Activity, suggest the major reasons why a well-integrate.docx· First e-Activity, suggest the major reasons why a well-integrate.docx
· First e-Activity, suggest the major reasons why a well-integrate.docx
 
A Review Of Discrimination In Employment And Workplace
A Review Of Discrimination In Employment And WorkplaceA Review Of Discrimination In Employment And Workplace
A Review Of Discrimination In Employment And Workplace
 
Qiang 6Gender NormsIntroductionAs human beings, we have a.docx
Qiang 6Gender NormsIntroductionAs human beings, we have a.docxQiang 6Gender NormsIntroductionAs human beings, we have a.docx
Qiang 6Gender NormsIntroductionAs human beings, we have a.docx
 
Women : Self Build Pillars
Women : Self Build PillarsWomen : Self Build Pillars
Women : Self Build Pillars
 
Women: Self Build Pillars of Individual, Family and Community
Women: Self Build Pillars of Individual, Family and CommunityWomen: Self Build Pillars of Individual, Family and Community
Women: Self Build Pillars of Individual, Family and Community
 
Women Employment In India
Women Employment In IndiaWomen Employment In India
Women Employment In India
 
Focusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdfFocusing on working class women and corporate women in filmtelevisi.pdf
Focusing on working class women and corporate women in filmtelevisi.pdf
 
Gender in the Tank
Gender in the TankGender in the Tank
Gender in the Tank
 
Moving our of the Shadow: Excelling in a Male Dominated Field
Moving our of the Shadow: Excelling in a Male Dominated FieldMoving our of the Shadow: Excelling in a Male Dominated Field
Moving our of the Shadow: Excelling in a Male Dominated Field
 
Why we need more women leaders
Why we need more women leadersWhy we need more women leaders
Why we need more women leaders
 
Discrimination Against Women
Discrimination Against WomenDiscrimination Against Women
Discrimination Against Women
 

More from fredr6

Summarize the article in about 100 to 120 words. The summary shoul.docx
Summarize the article in about 100 to 120 words. The summary shoul.docxSummarize the article in about 100 to 120 words. The summary shoul.docx
Summarize the article in about 100 to 120 words. The summary shoul.docxfredr6
 
Summarize, in Your own words (do not copy from the website.docx
Summarize, in Your own words (do not copy from the website.docxSummarize, in Your own words (do not copy from the website.docx
Summarize, in Your own words (do not copy from the website.docxfredr6
 
summarize chapter 10 for psychology first paragraph Introduction, s.docx
summarize chapter 10 for psychology first paragraph Introduction, s.docxsummarize chapter 10 for psychology first paragraph Introduction, s.docx
summarize chapter 10 for psychology first paragraph Introduction, s.docxfredr6
 
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docx
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docxSUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docx
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docxfredr6
 
summarize the key point or points most critical to the intellig.docx
summarize the key point or points most critical to the intellig.docxsummarize the key point or points most critical to the intellig.docx
summarize the key point or points most critical to the intellig.docxfredr6
 
Summarize your childhood and family. Include the following informati.docx
Summarize your childhood and family. Include the following informati.docxSummarize your childhood and family. Include the following informati.docx
Summarize your childhood and family. Include the following informati.docxfredr6
 
Summarize, for a country of your choice (India)group of non-c.docx
Summarize, for a country of your choice (India)group of non-c.docxSummarize, for a country of your choice (India)group of non-c.docx
Summarize, for a country of your choice (India)group of non-c.docxfredr6
 
Summarize this documentary film about The Rite of Spring balle.docx
Summarize this documentary film about The Rite of Spring balle.docxSummarize this documentary film about The Rite of Spring balle.docx
Summarize this documentary film about The Rite of Spring balle.docxfredr6
 
Summarize this paragraph in your own word when the american colonis.docx
Summarize this paragraph in your own word when the american colonis.docxSummarize this paragraph in your own word when the american colonis.docx
Summarize this paragraph in your own word when the american colonis.docxfredr6
 
Summarize the three (3) current competing theories of the origin of .docx
Summarize the three (3) current competing theories of the origin of .docxSummarize the three (3) current competing theories of the origin of .docx
Summarize the three (3) current competing theories of the origin of .docxfredr6
 
Summarize the process of a program’s development based on the pr.docx
Summarize the process of a program’s development based on the pr.docxSummarize the process of a program’s development based on the pr.docx
Summarize the process of a program’s development based on the pr.docxfredr6
 
Summarize the key details about your chosen leader.Who i.docx
Summarize the key details about your chosen leader.Who i.docxSummarize the key details about your chosen leader.Who i.docx
Summarize the key details about your chosen leader.Who i.docxfredr6
 
Summarize the PICO(T) components of the health care challenge presen.docx
Summarize the PICO(T) components of the health care challenge presen.docxSummarize the PICO(T) components of the health care challenge presen.docx
Summarize the PICO(T) components of the health care challenge presen.docxfredr6
 
Summarize the process of a program’s development based on the prog.docx
Summarize the process of a program’s development based on the prog.docxSummarize the process of a program’s development based on the prog.docx
Summarize the process of a program’s development based on the prog.docxfredr6
 
Summarize the influences of diversity within a workplace.Your .docx
Summarize the influences of diversity within a workplace.Your .docxSummarize the influences of diversity within a workplace.Your .docx
Summarize the influences of diversity within a workplace.Your .docxfredr6
 
Summarize the main theories of human deve.docx
Summarize the main theories of human deve.docxSummarize the main theories of human deve.docx
Summarize the main theories of human deve.docxfredr6
 
summarize the facts about HIV What is HIV, why is HIV a g.docx
summarize the facts about HIV What is HIV, why is HIV a g.docxsummarize the facts about HIV What is HIV, why is HIV a g.docx
summarize the facts about HIV What is HIV, why is HIV a g.docxfredr6
 
Summarize the following subjects  of Chapter 3Different type.docx
Summarize the following subjects  of Chapter 3Different type.docxSummarize the following subjects  of Chapter 3Different type.docx
Summarize the following subjects  of Chapter 3Different type.docxfredr6
 
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docx
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docxSuhayb majid 17026353land law examQ4) EASMENTSThis is th.docx
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docxfredr6
 
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docx
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docxSuicide CrisisBy Christina L. LyonsPub. Date July 12.docx
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docxfredr6
 

More from fredr6 (20)

Summarize the article in about 100 to 120 words. The summary shoul.docx
Summarize the article in about 100 to 120 words. The summary shoul.docxSummarize the article in about 100 to 120 words. The summary shoul.docx
Summarize the article in about 100 to 120 words. The summary shoul.docx
 
Summarize, in Your own words (do not copy from the website.docx
Summarize, in Your own words (do not copy from the website.docxSummarize, in Your own words (do not copy from the website.docx
Summarize, in Your own words (do not copy from the website.docx
 
summarize chapter 10 for psychology first paragraph Introduction, s.docx
summarize chapter 10 for psychology first paragraph Introduction, s.docxsummarize chapter 10 for psychology first paragraph Introduction, s.docx
summarize chapter 10 for psychology first paragraph Introduction, s.docx
 
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docx
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docxSUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docx
SUMMARIZED ANNALYSIS of ANTI-PAMELAednesday, March 18, 2015ANT.docx
 
summarize the key point or points most critical to the intellig.docx
summarize the key point or points most critical to the intellig.docxsummarize the key point or points most critical to the intellig.docx
summarize the key point or points most critical to the intellig.docx
 
Summarize your childhood and family. Include the following informati.docx
Summarize your childhood and family. Include the following informati.docxSummarize your childhood and family. Include the following informati.docx
Summarize your childhood and family. Include the following informati.docx
 
Summarize, for a country of your choice (India)group of non-c.docx
Summarize, for a country of your choice (India)group of non-c.docxSummarize, for a country of your choice (India)group of non-c.docx
Summarize, for a country of your choice (India)group of non-c.docx
 
Summarize this documentary film about The Rite of Spring balle.docx
Summarize this documentary film about The Rite of Spring balle.docxSummarize this documentary film about The Rite of Spring balle.docx
Summarize this documentary film about The Rite of Spring balle.docx
 
Summarize this paragraph in your own word when the american colonis.docx
Summarize this paragraph in your own word when the american colonis.docxSummarize this paragraph in your own word when the american colonis.docx
Summarize this paragraph in your own word when the american colonis.docx
 
Summarize the three (3) current competing theories of the origin of .docx
Summarize the three (3) current competing theories of the origin of .docxSummarize the three (3) current competing theories of the origin of .docx
Summarize the three (3) current competing theories of the origin of .docx
 
Summarize the process of a program’s development based on the pr.docx
Summarize the process of a program’s development based on the pr.docxSummarize the process of a program’s development based on the pr.docx
Summarize the process of a program’s development based on the pr.docx
 
Summarize the key details about your chosen leader.Who i.docx
Summarize the key details about your chosen leader.Who i.docxSummarize the key details about your chosen leader.Who i.docx
Summarize the key details about your chosen leader.Who i.docx
 
Summarize the PICO(T) components of the health care challenge presen.docx
Summarize the PICO(T) components of the health care challenge presen.docxSummarize the PICO(T) components of the health care challenge presen.docx
Summarize the PICO(T) components of the health care challenge presen.docx
 
Summarize the process of a program’s development based on the prog.docx
Summarize the process of a program’s development based on the prog.docxSummarize the process of a program’s development based on the prog.docx
Summarize the process of a program’s development based on the prog.docx
 
Summarize the influences of diversity within a workplace.Your .docx
Summarize the influences of diversity within a workplace.Your .docxSummarize the influences of diversity within a workplace.Your .docx
Summarize the influences of diversity within a workplace.Your .docx
 
Summarize the main theories of human deve.docx
Summarize the main theories of human deve.docxSummarize the main theories of human deve.docx
Summarize the main theories of human deve.docx
 
summarize the facts about HIV What is HIV, why is HIV a g.docx
summarize the facts about HIV What is HIV, why is HIV a g.docxsummarize the facts about HIV What is HIV, why is HIV a g.docx
summarize the facts about HIV What is HIV, why is HIV a g.docx
 
Summarize the following subjects  of Chapter 3Different type.docx
Summarize the following subjects  of Chapter 3Different type.docxSummarize the following subjects  of Chapter 3Different type.docx
Summarize the following subjects  of Chapter 3Different type.docx
 
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docx
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docxSuhayb majid 17026353land law examQ4) EASMENTSThis is th.docx
Suhayb majid 17026353land law examQ4) EASMENTSThis is th.docx
 
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docx
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docxSuicide CrisisBy Christina L. LyonsPub. Date July 12.docx
Suicide CrisisBy Christina L. LyonsPub. Date July 12.docx
 

Recently uploaded

Hierarchy of management that covers different levels of management
Hierarchy of management that covers different levels of managementHierarchy of management that covers different levels of management
Hierarchy of management that covers different levels of managementmkooblal
 
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptx
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptxECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptx
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptxiammrhaywood
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsanshu789521
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxmanuelaromero2013
 
Painted Grey Ware.pptx, PGW Culture of India
Painted Grey Ware.pptx, PGW Culture of IndiaPainted Grey Ware.pptx, PGW Culture of India
Painted Grey Ware.pptx, PGW Culture of IndiaVirag Sontakke
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxOH TEIK BIN
 
EPANDING THE CONTENT OF AN OUTLINE using notes.pptx
EPANDING THE CONTENT OF AN OUTLINE using notes.pptxEPANDING THE CONTENT OF AN OUTLINE using notes.pptx
EPANDING THE CONTENT OF AN OUTLINE using notes.pptxRaymartEstabillo3
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Educationpboyjonauth
 
Earth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatEarth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatYousafMalik24
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxpboyjonauth
 
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTiammrhaywood
 
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdf
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdfFraming an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdf
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdfUjwalaBharambe
 
MARGINALIZATION (Different learners in Marginalized Group
MARGINALIZATION (Different learners in Marginalized GroupMARGINALIZATION (Different learners in Marginalized Group
MARGINALIZATION (Different learners in Marginalized GroupJonathanParaisoCruz
 
Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Jisc
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfSumit Tiwari
 
CELL CYCLE Division Science 8 quarter IV.pptx
CELL CYCLE Division Science 8 quarter IV.pptxCELL CYCLE Division Science 8 quarter IV.pptx
CELL CYCLE Division Science 8 quarter IV.pptxJiesonDelaCerna
 
Roles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceRoles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceSamikshaHamane
 

Recently uploaded (20)

Hierarchy of management that covers different levels of management
Hierarchy of management that covers different levels of managementHierarchy of management that covers different levels of management
Hierarchy of management that covers different levels of management
 
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptx
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptxECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptx
ECONOMIC CONTEXT - PAPER 1 Q3: NEWSPAPERS.pptx
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha elections
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptx
 
Painted Grey Ware.pptx, PGW Culture of India
Painted Grey Ware.pptx, PGW Culture of IndiaPainted Grey Ware.pptx, PGW Culture of India
Painted Grey Ware.pptx, PGW Culture of India
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptx
 
EPANDING THE CONTENT OF AN OUTLINE using notes.pptx
EPANDING THE CONTENT OF AN OUTLINE using notes.pptxEPANDING THE CONTENT OF AN OUTLINE using notes.pptx
EPANDING THE CONTENT OF AN OUTLINE using notes.pptx
 
OS-operating systems- ch04 (Threads) ...
OS-operating systems- ch04 (Threads) ...OS-operating systems- ch04 (Threads) ...
OS-operating systems- ch04 (Threads) ...
 
Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Education
 
Earth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice greatEarth Day Presentation wow hello nice great
Earth Day Presentation wow hello nice great
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptx
 
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
 
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPTECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
ECONOMIC CONTEXT - LONG FORM TV DRAMA - PPT
 
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdf
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdfFraming an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdf
Framing an Appropriate Research Question 6b9b26d93da94caf993c038d9efcdedb.pdf
 
MARGINALIZATION (Different learners in Marginalized Group
MARGINALIZATION (Different learners in Marginalized GroupMARGINALIZATION (Different learners in Marginalized Group
MARGINALIZATION (Different learners in Marginalized Group
 
Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...Procuring digital preservation CAN be quick and painless with our new dynamic...
Procuring digital preservation CAN be quick and painless with our new dynamic...
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
 
ESSENTIAL of (CS/IT/IS) class 06 (database)
ESSENTIAL of (CS/IT/IS) class 06 (database)ESSENTIAL of (CS/IT/IS) class 06 (database)
ESSENTIAL of (CS/IT/IS) class 06 (database)
 
CELL CYCLE Division Science 8 quarter IV.pptx
CELL CYCLE Division Science 8 quarter IV.pptxCELL CYCLE Division Science 8 quarter IV.pptx
CELL CYCLE Division Science 8 quarter IV.pptx
 
Roles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in PharmacovigilanceRoles & Responsibilities in Pharmacovigilance
Roles & Responsibilities in Pharmacovigilance
 

Successful Women Expatriates Foreign, Not FemaleIn a classic ar.docx

  • 1. Successful Women Expatriates: Foreign, Not Female In a classic article titled “A Gaijin, Not a Woman,” Nancy Adler debunked one of the key myths regarding women as expatriates.*Gaijin is the Japanese word for foreigner. From her research, Adler concluded that it is a mistake to assume that people from foreign cultures, even traditionally patriarchal Asian cultures, apply the same gender role expectations to foreign women that they apply to local women. It seems that people from even very traditional cultures can view foreign businesswomen so differently from how they view local women that gender becomes irrelevant for business purposes. For example, one businesswoman working in Sudan was surprised by the behavior of her Sudanese host. She asked him how it was possible that he could serve her food, give her a cushion to sit on, and wash her arms after the meal. Men never do these things for women according to traditional Sudanese gender role expectations. The Sudanese host reasoned, “Oh, it’s no problem. Women do not do business; therefore, you are not a woman.”* After establishing a business relationship, according to Adler, the real issues that arise in cross-cultural interactions depend more on how host country people react to people of another nationality than on how they react to an expatriate’s gender. The Woman’s Advantage and Disadvantage Some studies suggest that women may have some advantages in expatriate positions, especially in Asia.* Being unique has its benefits. Because so few women have expatriate assignments, women who take them report being more visible. Local businesspeople were more likely to remember them and often sought them out more than the women’s male colleagues. North American expatriate women also report that local businessmen from traditional cultures assume that the woman is the best person for the job, reasoning, “Why else would the organization send a woman?”
  • 2. Women may be more likely to excel in relational skills, a major factor in expatriate success. Women report that local male managers can be more open in communication with a woman than with a man. Local men, even from traditional cultures, can talk at ease with a woman about an array of subjects that include issues outside the domain of traditional male-only conversations. Consequently, being both a businessperson and female gives expatriate women a wider range of interaction options than those available to expatriate men or to local women.* A recent study provides further insights into the potential advantages that female expatriates have relative to male expatriates.* In a comparative small survey of expatriates, the researchers found that female expatriates had higher scores of self-transcendence than males. Self-transcendence, made up of universalism (ability to understand, appreciate, and care for the well-being of others and nature) and benevolence (ability to make decisions that shows caring and enhancement of the wellbeing of others), is expected to help expatriates adjust well in other cultures. Individuals with high self-transcendence are expected to be more understanding and open-minded and also more loyal and forgiving. The researchers do indeed find that the female expatriates they study have higher self-transcendence than the male expatriates. The study also shows that higher self- transcendence is indeed linked to stronger cultural and work adjustment. The study thus provides some mechanisms as to why female expatriates do perform better than male expatriates. · Despite the many obvious advantages women expatriates enjoy, the situation is nevertheless bleak for many of them. In- depth interviews with 50 European female expatriates revealed that they faced much worse situations than their male counterparts.* Female expatriates are more likely to Face the glass ceiling: Women expatriates have more difficulty being taken seriously in the early stages of their career. They are more likely to face isolation and loneliness.* They must work harder than their male counterparts, and they constantly need to prove
  • 3. themselves. Studies have shown that, in some cases, women have to be at much higher positions than their male counterparts before they are assigned international positions. · Need to balance work and family responsibilities: Because of socialization and childhood experiences, research suggests that women expatriates may have a higher burden than their male counterparts to balance family and home responsibilities. There is evidence that female expatriates may be more likely to have to choose between having an international career and having a family, often because of very little support from the partner. Not surprisingly, women managers are less likely to be married and more likely to remain childless than their male counterparts.* · Need to worry about accompanying spouse: Many female expatriates felt that they could be successful only if the career of their spouse became secondary. However, because of societal norms, it is still difficult for male partners to accept that their spouses have the primary career. It has been found that female expatriates are more likely to have partners with professional careers and that it is more difficult for the company to accommodate the needs of the male partner because of visa regulations and other host country work policies.* Furthermore, even in societies where women may have advantages because they are viewed differently (e.g., gaijin in Japan), they still face significant barriers. For instance, although research found that Western women had some advantages because they were seen as foreigners rather than as women, it also found that these women faced significant barriers, influencing their ability to adjust to the Japanese environment and to perform well in their jobs.* However, a more recent study argued that Western women should have an easier time in Japan.* It reasoned that Japan has experienced many institutional changes, such as a more flexible market, growth of foreign multinational presence, growth of women in the workforce, and Japan’s 1986 Equal Opportunity Act. These changes should result in some convergence between Western
  • 4. and Japanese attitudes toward women and make for a better environment for women. However, results show that many of the barriers found in a similar study a decade ago are still formidable. Foreign women managers still face cultural barriers, making it harder for them to adjust to their new jobs, perform well, and become accepted in Japan. The next section explains that women are an ever-growing segment of the expatriate population and companies can implement programs to ensure that they have an opportunity to flourish.What Can Companies Do to Ensure Female Expatriate Success? Despite the disadvantages women face, the opportunities for them as expatriate managers are expected to grow, particularly with global companies. Scholars see several factors leading to more women in international assignments. Many global and multinational companies face an acute shortage of high-quality multinational managers.* At the same time, perhaps because of the rise in dual-career couples, fewer men are willing to take the assignments.* One solution is to tap the available population of women managers. Freed from local cultural barriers that restrict the use of women managers, multinational companies can select the best people for the job regardless of gender. Because of potentially stronger relational skills, women managers often may be better qualified for international positions than their male colleagues. Because women expatriates are likely to increase in number and are as motivated and willing to take international assignments as men, companies must take the necessary steps to ensure that their female expatriates are successful. Companies should ensure that the following steps are implemented: · Provide mentors: Because women expatriates face more barriers than their male counterparts, mentors can furnish the necessary psychosocial support to face such obstacles.* Mentors can be informal and provide guidance to the female expatriates. Mentors from the home office can supply the necessary support to facilitate reentry to the home office.
  • 5. · Offer opportunities for interpersonal networks as a form of organizational support: Access to a network of colleagues in similar situation can be a source of social support, contacts, and opportunities. Although it may be difficult for the female expatriates to gain access to the typical male-dominated networks,* the organization can take the necessary steps to develop formal professional networks of female managers. · Remove sources of barriers: The organization should ensure that female expatriates are treated as fairly and equally as their male counterparts.* The HRM department can be instrumental in this effort. The organization also needs to educate their employees and change stereotypical attitudes toward women expatriates. · Provide support to cope with dual-career issues: The organization should accept that women expatriates face peculiar and more difficult circumstances regarding their spouses than male counterparts do. It should furnish the necessary counseling to ensure that the couple is aware of the difficulties an international assignment will pose for the family. The company should help the spouse find an equivalent job or provide the necessary counseling.