Pioneer dehradun-english-edition-2021-08-19

1. 298D?B4CF8C7A4?ACB
9D364B´0??8=C4=CB
=Tf3T[WX) CWT_a^RTbb^U
P__^X]cT]c^UYdSVTbXb
°bPRa^bP]Rc±P]ScWTTSXP
dbcaTR^V]XbTXcbbP]RcXch
2WXTU9dbcXRT^U8]SXP298=E
APP]PbPXS^]FTS]TbSPh
fWX[TTg_aTbbX]VP]VdXbWP]S
cTaX]V°eTahd]U^acd]PcT±
RTacPX]b_TRd[PcXeT]TfbaT_^acb
PQ^dccWT2^[[TVXdTTcX]V
20?BD;4
0?Q :01D;
Afghanistan’s former
President Hamid Karzai
on Wednesday met with a
senior leader of a powerful
Taliban faction who was once
jailed and whose group has
been listed by the US as a ter-
rorist network.
Karzai and Abdullah
Abdullah, a senior official in
the ousted Government, met
with Anas Haqqani as part of
preliminary meetings that a
spokesman for Karzai said
would would facilitate eventu-
al negotiations with Mullah
Abdul Ghani Baradar, the top
Taliban political leader.
The US branded the
Haqqani network a terrorist
group in 2012, and its involve-
ment in a future Government
could trigger international
sanctions.
The Taliban have pledged
to form an “inclusive, Islamic
government,” although skeptics
point to its past record of
intolerance for those not adher-
ing to its extreme interpreta-
tions of Islam.
The Taliban’s top political
leader, who made a triumphal
return to Afghanistan this
week, battled the US and its
allies for decades but then
signed a landmark peace agree-
ment with the Trump admin-
istration.
Mullah Abdul Ghani
Baradar is now expected to play
a key role in negotiations
between the Taliban and offi-
cials from the Afghan
Government that the militant
group deposed in its blitz
across the country.
The Taliban say they seek
an “inclusive, Islamic”
Government and claim they
have become more moderate
since they last held power. But
many remain skeptical, and all
eyes are now on Baradar, who
has said little about how the
group will govern but has
proven pragmatic in the past.
Baradar’s biography charts
the arc of the Taliban’s journey
from an Islamic militia that bat-
tled warlords during the civil
war in the 1990s, ruled the
country in accordance with a
strict interpretation of Islamic
law and then waged a two-
decade insurgency against the
US.
His experience also sheds
light on the Taliban’s compli-
cated relationship with neigh-
boring Pakistan.
Baradar is the only surviv-
ing Taliban leader to have been
personally appointed deputy by
the late Taliban commander
Mullah Mohammed Omar,
giving Baradar near-legendary
status within the movement.
And he is more far more
visible than the Taliban’s cur-
rent supreme leader, Maulawi
Hibatullah Akhunzada, who is
believed to be in hiding in
Pakistan and only releases
occasional statements.
On Tuesday, Baradar land-
ed in the southern Afghan city
of Kandahar, the birthplace of
the Taliban movement he
helped found in the mid-
1990s.
Ending 20 years of exile, he
was thronged by well-wishers
as he stepped off a Qatari
Government aircraft and drove
off in a convoy.
Baradar, who is in his early
50s, was born in the southern
Uruzgan province. Like others
who would eventually become
Taliban leaders, he joined the
ranks of the CIA-and Pakistan-
backed Mujahideen to fight
against the Soviet Union dur-
ing its decadelong occupation
of the country that ended in
1989.
In the 1990s, the country
slid into civil war, with rival
Mujahideen battling one
another and carving out fief-
doms. Warlords set up brutal
protection rackets and check-
points in which their forces
shook down travelers to fund
their military activities.
In 1994, Mullah Omar,
Baradar and others founded
the Taliban, which means reli-
gious students.
The group mainly con-
sisted of clerics and young,
pious men, many of whom had
been driven from their homes
and had known only war.
Their unsparing interpre-
tation of Islam unified their
ranks and set them apart from
the notoriously corrupt war-
lords. Baradar fought alongside
Mullah Omar as he led the
Taliban through its seizure of
power in 1996 and its return to
an insurgency following the
2001 US-led invasion.
Related reports on P8
?=BQ =4F34;78
Some unpalatable news for
the country’s nationwide
vaccination drive has surfaced.
The World Health
Organization (WHO) has iden-
tified counterfeit versions of
Covishield in India and
Uganda. As per a global news
agency report, the doses were
seized by authorities in India
and Uganda between July and
August. Even vaccine maker
Serum Institute of India has
confirmed to the WHO that
the vaccines were fake.
Now, the WHO has issued
a Medical Product Alert about
counterfeit Covishield vaccines
circulating in the two countries.
“The genuine manufactur-
er of Covishield (Serum
Institute of India Pvt. Ltd.) has
confirmed that the products
listed in this alert are falsified.
These falsified products have
been reported at the patient
level in Uganda and India,” the
WHO said.
It said the products were
confirmed as falsified on the
basis that they
deliberately/fraudulently mis-
represent their identity, com-
position or source.
The counterfeit Covishield
vial detected in Uganda was a
5 ml dosage form containing 10
doses. It had a batch number
4121Z040 and the falsified
expiry date of August 10.
The fake one detected in
India was 2 ml — 4 doses vial.
The SII doesn’t produce such
vials.
The WHO’s Global
Surveillance and Monitoring
System for Substandard and
Falsified Medical Products has
unearthed these counterfeit
vaccines.
This is not the first time
that counterfeit Covi-19 vac-
cines have been detected. The
WHO earlier identified coun-
terfeit Pfizer-BioNTech Covid-
19 circulating in the USA.
?=BQ =4F34;78
In a landmark ruling, the
Supreme Court on
Wednesday allowed women
candidates to appear for the
upcoming entrance examina-
tion of the National Defence
Academy (NDA). It will be for
the first time that women can-
didates will do so in the histo-
ry of the NDA, which ws
founded in 1954.
The interim order marks a
significant step towards ensur-
ing greater participation of
women in the armed forces as
the NDA is known as the cra-
dle for grooming officers for
the three Services, including
the Army, Navy and the IAF.
The court also pulled up the
Army for not changing its
“mindset”, even during the per-
manent commission judge-
ment to women sometime
back.
So far, women candidates
appear and qualify for courses
in the Officers Training
Academy (OTA) of the Army
and similar institutions of the
IAF and the Navy. Moreover,
they join these institutions
after securing the basic gradu-
ation degree.
In the case of the NDA,
candidates are eligible for the
examination conducted by the
UPSC after clearing the plus
two stage of the school. The
selected candidates then under-
go rigorous training for four
years before branching out to
the specialised institutions of
the Army, IAF and the Navy.
The apex court in its order
on Wednesday said women are
eligible for the NDA examina-
tion to be held on September
5. The court, however said the
result of the examination will
be subject to final adjudication
of the
petition.
The bench of Justices
Sanjay Kishan Kaul and
Hrishikesh Roy passed the
interim order on a plea filed by
one Kush Kalra, which has
sought a direction to the
authorities concerned to allow
eligible female candidates to
appear in the NDA and Naval
Academy Examination and
train at the NDA.
The bench also directed
the UPSC to take out an appro-
priate notification in view of its
order and give due publicity to
it. During the hearing, senior
advocate Chinmoy Pradip
Sharma, appearing for Kalra,
said they have received the
Centre’s counter affidavit on
Tuesday in which the
Government has stated that it
is purely a policy decision and
court should not interfere with
it.
The bench told Additional
Solicitor General Aishwarya
Bhati that why is the
Government continuing in this
direction after the verdicts of
this court related to extending
permanent commission in the
Army and Navy to women.
“This is unfounded now.
We are finding it absurd. Will
the Army act on after the
judicial orders are passed? We
will then pass an order, if that
is what you want. I have this
impression right from the High
Court that till an order is
passed, the Army does not
believe in doing anything vol-
untarily,” the bench said.
When Bhati said women
can join services through the
Indian Military Academy
(IMA) and OTA, the court
said, “Why is it not through
NDA. Is co-education a prob-
lem?”
Bhati said that this is a pol-
icy decision that women are
not allowed in NDA. The top
court told Bhati this policy
decision is based on gender
discrimination.
On March 10, the court
had sought responses from
the Centre and others on a plea
which has raised the issue of
exclusion of eligible and will-
ing female candidates from
joining the NDA solely on the
ground of sex that it is a vio-
lation of fundamental right to
equality.
RckRZSc`Vcd8`geW`c^ReZ`_UVR]
([3UH]PHHWV+DTTDQLOHDGHUVLQKRSHRISDFWZLWK7DOLEDQFRPPDQGHU%DUDGDU
8]cWXbWP]S^dc_W^c^VaP_WaT[TPbTSQhcWTCP[XQP]U^aTa0UVWP]?aTbXST]c7PXS:PaiPXRT]cTa[TUcbT]X^a7P``P]XVa^d_
[TPSTa0]Pb7P``P]XaXVWcTTcX]:PQd[0UVWP]XbcP]^]FTS]TbSPh 0?
0?Q :01D;
The Taliban violently broke
up a protest in eastern
Afghanistan on Wednesday,
killing at least one person as
they quashed a rare public
show of dissent.
The Taliban’s every action
in their sudden sweep to power
is being watched closely.
They insist they have
changed and won’t impose the
same draconian restrictions
they did when they last ruled
Afghanistan, all but eliminat-
ing women’s rights, carrying
out public executions and har-
boring al-Qaida in the years
before the 9/11 attacks.
But many Afghans remain
deeply skeptical, and the violent
response to Wednesday’s
protest could only fuel their
fears.
Thousands are racing to
the airport and borders to flee
the country. Many others are
hiding inside their homes, fear-
ful after prisons and armories
were emptied during the insur-
gents’ blitz across the country.
Dozens of people gathered
in the eastern city of Jalalabad
to raise the national flag a day
before Afghanistan’s
Independence Day, which
commemorates the end of
British rule in 1919.
They lowered the Taliban
flag — a white banner with an
Islamic inscription — that the
militants have raised in the
areas they captured.
Video footage later showed
the Taliban firing into the air
and attacking people with
batons to disperse the crowd.
Babrak Amirzada, a reporter
for a local news agency, said he
and a TV cameraman from
another agency were beaten by
the Taliban as they tried to
cover the unrest.
A local health official said
at least one person was killed
and six wounded. The official
was not authorised to speak to
media and so he spoke on the
condition of anonymity.
dY`eU`h_,
_`eRVcdW`c
eYVZcZ_T]fdZgV
8`geac`^ZdV
CP[XQP]³bX[T]RT´aPaTe^XRT^USXbbT]c
CP[XQP]UXVWcTab_Pca^[cWTFPiXa0ZQPa:WP]]TXVWQ^aW^^SX]cWTRXch^U:PQd[^]
FTS]TbSPh 0?
:+2LGHQWLILHV
IDNHRYLVKLHOG
LQ,QGLD8JDQGD
7RVU`dVd
dVZkVUSj:_UZR
SVehVV_;f]j
R_U2fXfde
:RPHQFDQWDNH1'$H[DPH[FOXVLRQJHQGHUELDV6
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !!%
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=C7DAB30H0D6DBC (!! *?064B !C!
DA@CE#
4=6A420;;0;0=
5AA3C4BC
m
m
@?6J*
63?C6AF1H!8=@
4BC80C4B82A0
CDB9F976?B
@5B653D9?*
B1F55B
! F9F139DI
@A:?:@?'
58ABCC4AAA0CC02:
F0B8=:0A10;0

2. ]PcX^]!
347A03D=kC7DAB30H k0D6DBC (!!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 70;3F0=8
Two elephants including a
calf were killed after being
hit by the Ramnagar-Agra Fort
train in the Tera central forest
division early in the morning
on Wednesday. The train was
sent back to SIIDCUL halt
and about 64 passengers were
sent by special buses to their
destinations.
A number of trains in the
Kashipur Kasganj section were
cancelled following the mishap.
The forest conservator of the
western circle, Rahul Kumar
said that various steps will be
taken to prevent such mishaps
in the future. In the meanwhile,
considering the seriousness of
the incident, the locomotive
pilot has been booked under
various sections of the Wildlife
Protection Act.
According to sources the
mishap occurred when a herd
of elephants was crossing the
railway track in the Peepal
Padav range.
Forest department person-
nel who reached the site had to
fire rounds in the air to disperse
the remaining elephants
towards the jungle.
Eh`[f^S`dZ]]VU
Z_ecRZ_^ZdYRa
=8B7D07090=Q
270=3860A7
History repeats itself so
quickly…Everything is still
difficult to comprehend. I am
concerned about my family
members who are absolutely
petrified with the Taliban's
rapid return to power in
Afghanistan,” says 24-year-old
Parwana Hussaini.
Parwana, a postgraduate
student at D.A.V College here
belongs to Afghanistan’s
Bamyan province. She says,
“Life in Afghanistan has
become extremely risky for
the citizens, especially women.
The Taliban can’t be trusted
despite their vows to honour
women's rights within Islamic
law. We have not forgotten the
previous Taliban rule, when
women suffered extensive
human rights violations.”
“Over the last couple of
days, the entire world has seen
photographs and videos of
Kabul airport where Afghans
are desperately trying to escape
another Taliban regime. The
disturbing pictures of people
falling from departing aircraft
from Kabul says it all,” she says.
The extraordinary images
of thousands of Afghans flood-
ing the Kabul airport, people
clinging on to a US military air-
craft about to take off and
Afghan nationals falling to
death from the sky have now
become powerful summations
of fear and panic of being
trapped in the bleak future that
awaits the war-torn country.
As Taliban insurgents
swept through Afghanistan
without facing any resistance,
returning to power after near-
ly two decades, millions of
Afghan women are now fear-
ful of a return of an oppressive
regime, under which they lived
from 1996 to 2001.
Parwana tells, “She is wor-
ried about her younger sister
and brother who lives in Kabul
and other family members
who live in Bamyan. I was able
to contact them on Tuesday
after about a week. They are liv-
ing under a constant state of
fear and have not stepped out
of home yet.”
“I came to India in 2016
and went to Afghanistan in
March this year after four
years. The situation became
tense in April itself when the
USA had announced to with-
draw all American troops from
Afghanistan. I had planned to
go back and serve my country
after completing my post-grad-
uation here. But the future
seems very uncertain now. My
family has told me not to
return,” says Parwana while
sharing her agony.
Voicing concern over the
fear of return of “dark days” for
Afghan women, she urges that
the United Nations, the USA,
India and other countries
should come forward to ensure
that the hard-won rights of
women are protected.
Her fears are echoed by
many students of Afghan-ori-
gin who are studying here on
scholarship from ICCR (Indian
Council for Cultural Relations).
Many of them have not been
able to connect with their fam-
ilies in the far-off homeland
that fell to the Taliban on
August 15.
Another female student
from Afghanistan who spoke to
The Pioneer on condition of
anonymity for fear of reprisals
says, “Whatever we achieved in
the last 20 years was lost in a
blink of an eye. Taliban’s rule
will bring doom to Afghans,
especially women.”
This 24-year-old student,
who has recently completed her
post-graduation in
Chandigarh, tells her family
lives in Kabul. She has three
unmarried younger sisters and
one elder sister, who is married.
Sharing her concerns about
her sisters, she says, “There
have been reports of women
being forced to marry Taliban
fighters in various parts of
Afghanistan. This remains a
major concern for us. I have
talked to my family members.
They are too afraid to leave
home now and wondering
what the future will bring… I
am really concerned about my
sisters’ education and safety.
She also fears that she may
bring harm to her family and
has stopped posting anything
on social media against the
Taliban.
Asserting that that the
gains made by Afghan women
in education and employment
over the past 20 years are
under grave threat today, she
says, “Afghans have earlier lived
under Taliban’s brutal regime
where women were subjected
to persistent human rights vio-
lations, denied education and
employment, publicly flogged
and were forced to follow a
dress code.”
“I am sad as well as angry
over how the helpless Afghan
women are now facing a grim
future under Taliban rule. The
international community failed
the people of Afghanistan,”
she further adds.
Many Afghan-origin stu-
dents who had come to India
with a dream of completing
their education and returning
to their homeland to work for
its upliftment, are also staring
at a bleak future. These stu-
dents, who were too young
during the previous ruthless
regime of Taliban in late 90s
have frightening memories of
this fundamentalist Islamic
force.
Ali Nazar Nabizada (27),
who is also from Kabul recalls,
“During my childhood, I have
seen elders and women being
brutally beaten by Taliban
insurgents. I remember how
women were not allowed to
leave home without being
accompanied by a male rela-
tive. During their previous
rule, they (Taliban) imple-
mented their strict interpreta-
tion of Sharia law, under which
public executions and flog-
gings were common. How can
people live under such a
regime again?”
Ali, a postgraduate stu-
dent in DAV College says, “I
am worried about my family
back home. My two brothers
live in Kabul with their fami-
lies and they are very scared
since the Taliban has taken
over.”
Troubled with the way
things have turned out, he
says, “We feel
betrayed…Afghanistan is fac-
ing a humanitarian crisis while
the world stands as a mute
spectator.”
Another Afghan-origin
student, who is a Ph.D schol-
ar at Panjab University, tells he
wanted to go back to his coun-
try and work in the govern-
ment sector. I am studying
political science and had devel-
oped many contacts over a
period of time in my homeland
with a hope to work there. But
now, the future looks uncer-
tain, he says.
This 30-year-old student
requesting anonymity says few
of my family members are in
India while others are in Kabul.
All my dreams of working in
my country are shattered as
even if I return to Afghanistan,
I don’t think the Taliban would
allow me to work… For them,
educated people are a threat.
They claim to be more mod-
erate this time and are engag-
ing in image-building exercis-
es but once they take full con-
trol, we will see the rise of
extremism again,” he says while
pausing for a few seconds and
again requesting not to reveal
his identity.
$IJKDQVWXGHQWVLQKDQGLJDUKIDFHXQFHUWDLQIXWXUH
?=BQ 270=3860A7
Riding on a motorcycle, the
Shiromani Akali Dal (SAD)
president Sukhbir Singh Badal
on Wednesday kick-started his
100-day yatra to expose “cor-
ruption” by the Congress-led
Punjab Government and take
feedback from the people about
theirexpectationiftheSAD-BSP
alliance comes to power in the
state after 2022 polls.
However, Sukhbir has to
face strong protest by the agi-
tating farmers who waved
black flags on his convoy in
the Zira area of Ferozepur
district. A group of farmers,
including both men and
women, staged protests by
holding black flags in their
hands, as the police tried to
control the crowd.
Notably, thousands of
farmers from across the
country have been agitating
atthe Delhi, Haryana, Punjab
borders against the Centre’s
three farm laws that they
claim will do away with the
minimum support price
(MSP) system, leaving them
at the mercy of big corpo-
rates. Over 10 rounds of
talks with the Central
Government,whichhasbeen
projecting the laws as major
agricultural reforms, have
failed to break the deadlock
between the two sides. A day
before, Sukhbir had unveiled
his plan to visit 100 assem-
bly constituencies during the
yatra and expose the ruling
party. “SAD will implement its
13-point programme in the
manner in which it had imple-
mented earlier commitments,”
declared Sukhbir on
Wednesday while addressing a
gathering during his yatra.
Earlier this month, the
SAD had launched the 13-
point programme, promising
free power up to 400 units per
month for all households, slash-
ing diesel price by Rs 10 a litre
for agriculture sector, reserving
75 percent jobs for Punjabi
youth in the private sector,
among other things. “Our cred-
ibility is our biggest strength,”
said SAD president, addressing
the people before the start of a
motorcycle rally, which culmi-
nated at a gurdwara where he
addressed his first public meet-
ing.Sukhbir, who addressed 12
public gatherings during his
tour of the constituency, said
that the SAD-BSP alliance is
committed to giving relief to
farmers and decided to make
diesel cheaper by Rs 10 per litre
for agricultural purposes. “We
will also give free power up to
400 units per month to all
domestic consumers,”' he said,
adding that there will be 33 per-
cent reservation for rural stu-
dents in professional colleges
and the government will pay
their fee if they are voted to
power.
1XUQT_V1ccU]Ri`_c
Ce[XRYb2QTQRUWY^c!
TQiiQdbQVb_]JYbQ

3. dccPaPZWP]S
347A03D=kC7DAB30H k0D6DBC (!!
?=BQ 347A03D=
The Municipal Corporation
of Dehradun (MCD) has
delayed the decision of launch-
ing the anti-plastic campaign in
the city once again due to the
ongoing anti-dengue campaign
and monsoon. In the past two
years, the consumption of sin-
gle-use plastic has increased
drastically in Dehradun after
the State government lifted the
ban due to the Covid-19 pan-
demic to provide necessary
supplies to the needy. Though
the ban was reinstated by the
government earlier this year,
there is no considerable decline
in the use of single-use plastics,
especially by vegetable and
fruits street vendors and local
shopkeepers. The MCD had
started a campaign in April
against the use of single-use
plastic by imposing penalties
on local vendors and con-
sumers but it was hindered due
to the Covid curfew in the
State. The MCD officials had
stated last month that they will
start the anti-plastic campaign
from August but now, they
have decided to postpone it.
According to the chief munic-
ipal health officer, Dr Kailash
Joshi, the MCD is currently
focusing on the anti-dengue
campaign and tackling issues
like waterlogging during mon-
soon. He informed that the
sanitation team of MCD has
surveyed over one lakh hous-
es and destroyed mosquito lar-
vae in over 8,000 houses so far
in association with district
administration. The teams are
also spreading awareness
among locals and fogging all
the wards as a part of the cam-
paign, informed Joshi. He said
that a few dengue patients
have been found in the district
and MCD is working to min-
imise the risk of dengue disease
here. Joshi said that MCD is
planning to restrict the use of
single-use plastics and will
possibly commence the cam-
paign next month.
0'GHIHUVDQWLSODVWLF
FDPSDLJQDJDLQ
?=BQ =4FC47A8
Former ideologue of the
Rashtriya Swayamsevak
Sangh (RSS), KN
Govindacharya will now
embark on save Yamuna cam-
paign. Govindacharya has
announced that he will begin
Save Yamuna Yatra from
August 28 from Janaki Chatti
a small hamlet near Yamunotri
under the banner of Rahtriya
Swabhiman Yatra. The march
will conclude at Prayagraj on
September 14. He will interact
with the stakeholders in the
towns and cities along the river
Yamuna on the way to discuss
the environmental friendly
developmental model that can
be taken up to save the Yamuna
river.
Govindacharya said that
the Covid pandemic has con-
veyed to the whole world the
fact that nature-centric devel-
opment is the right model of
development. The real strength
of India is nature and environ-
ment and ignoring this is invit-
ing natural calamities. He also
said that the large dams on
river Yamuna would harm the
environment. The campaign
media coordinator Vivek Tyagi
said that during the yatra he
will interact with people from
different fields working con-
structively on nature-based
development model and com-
pile all the findings to be
brought up in public domain
later.
It will be recalled that in the
past, Govindacharya had par-
ticipated actively in 2006 and
2008 in the campaign to keep
the Ganga river free and flow-
ing. He undertook a yatra to
the sites on the banks of Ganga
River from September 1 to
October 2 during 2010 to
Gangasagar.
6^eX]SPRWPahPc^
d]STacPZTBPeT
HPd]PHPcaP
?=BQ 347A03D=
The Bharatiya Janata Party
has completed all prepara-
tions for the two-day visit of its
National President Jagat
Prakash Nadda starting on
August 20 with his arrival in
Dehradun. Nadda will partic-
ipate in a total of 11 meetings
with leaders and office bearers
of the party apart from inter-
acting with ex-servicemen and
members of the religious fra-
ternity.
The BJP state media in-
charge Manveer Singh
Chauhan informed the media
that the party’s national presi-
dent will arrive at the
Dehradun airport on Friday.
He will be received by the
chief minister Pushkar Singh
Dhami, ministers and state
general secretaries of the party
here. He will then be wel-
comed by the party workers at
Bhaniawala, Chidderwala,
Nepali Farm, Raiwala and
other locations. On the first
day, Nadda will hold meeting
with the party’s state office
bearers, district heads, state
heads of the cells and general
secretaries from 2 PM to 3:30
PM. After this meeting, the BJP
national president will hold a
two-hour meeting with all the
MPs and MLAs. This will be
followed by a meeting with all
the ministers and various com-
mittees.
Chauhan further informed
that on August 21, the BJP
national president will interact
with ex-servicemen and attend
a Sainik Samman programme.
This programme will be held at
a resort in Raiwala. After this
event, Nadda will hold a meet-
ing with the party’s elected dis-
trict Panchayat heads, block
Pramukhs and chairpersons
of municipal councils, Nagar
Panchayats and block devel-
opment committees. A meeting
of the party’s core group will be
held after this. The final session
of the day will comprise a pro-
gramme to be held to honour
members of the religious fra-
ternity.
2:@WUdcbUQTi
V_bQTTQµc
TQiCdQdUfYcYd
?=BQ 347A03D=
The Chief Minister Pushkar
Singh Dhami announced a
relief package of Rs 118.35
crore for the women self help
groups ( SHGs) and those
associated with self employ-
ment schemes of the state gov-
ernment on Wednesday. The
CM declared this package
which would help 7,54,984
people in a virtual interaction
with women SHGs associated
with the Uttarakhand state
rural livelihood mission.
Speaking on the occasion,
the CM said that the different
SHGs are engaged in appre-
ciable work and they have a
positive impact on the econo-
my of the State. He said that the
pandemic of Covid-19 has
adversely affected the activities
of these groups. The CM said
that in these SHGs the women
of the state work and they are
the backbone of the economy
of the mountainous areas. He
said that the package would
provide relief for these women.
Under the rural livelihood
mission, a one-time grant of Rs
five lakh would be given to
each of 159 Cluster Level
Foundation (CLF) in the state.
Similarly financial help would
be granted to active SHGs for
next six months. Under it a
sum of Rs 2,000 per month
would be given to 42,989
groups. The loan account hold-
ers of Mukhyamantri solar self
employment scheme would be
provided compensation for the
interest incurred during the
period.
The Yuvak Mangal Dal of
Prantiya Vikas Dal and Youth
welfare would be given finan-
cial assistance of Rs 2,000 per
month for six months.
Dhami said that
Uttarakhand has received full
support of Prime Minister
Narendra Modi in the last
seven years and the state has
received central assistance in
many welfare schemes in the
sectors of health, education,
drinking water and others.
The rural development
minister Swami Yetiswaranand
said that the platform should be
provided to the SHGs for sale
of their products. He said that
the officers should visit these
groups and solve their prob-
lems.
In the interaction the
members of the women SHGs
shared their experiences.
The Cabinet Minister
Ganesh Joshi, MLAs Khajan
Das, Rajesh Shukla, Pranav
Singh 'Champion', additional
chief secretaries Manisha
Panwar, Anand Bardhan and
others were present on the
occasion.
'KDPLGHFODUHV
SDFNDJHRICFU
IRUZRPHQ6+*V
?=BQ 347A03D=
The Bageshwar district
became the second district
in the country and first in
Uttarakhand to achieve the
unique distinction of 100 per
cent vaccination on
Wednesday. The Wayanad dis-
trict of Kerala holds the record
for being the first district in the
country to achieve 100 per cent
vaccination.
The Chief Minister
Pushkar Singh Dhami himself
declared the unique feat of the
Bageshwar district while inter-
acting with the media persons
at the State Secretariat on
Wednesday. He praised the
State Health Department, dis-
trict administration and team
of the district health depart-
ment of Bageshwar for the stu-
pendous achievement. The CM
said that the district would
inspire others and become a
role model. He said that the
Khirsu block of Pauri has also
achieved 100 per cent vaccina-
tion target of the adult popu-
lation. He informed that
1,76,776 beneficiaries have
received the first dose of vac-
cine in Bageshwar district while
37,789 have got the first dose
in Khirsu block of Pauri. The
CM said that the state has
received 17 lakh doses of vac-
cine in this month and it is
receiving full support of the
union government and assert-
ed that the 100 per cent vacci-
nation target would be
achieved in the next four
months. Dhami informed that
necessary steps are being taken
at state, district and block lev-
els to give an impetus to the
vaccination drive in
the state. He said
that 83 per cent of
the population
above 45 years of
age in the state has
received the first
dose while 48 per
cent of them have
received both doses.
Dhami added that
61 per cent of the 18
to 44 years age pop-
ulation has received
the first dose while
4 per cent have
received both doses.
In the State a total of
56,61,943 people
have received the
first dose which is
73 per cent of the
total adult population.
The CM congratulated the
District Magistrate (DM) of
Bageshwar Vineet Kumar
Meena, chief medical officer
(CMO) Dr Sunita Tamta, dis-
trict immunisation officer Dr
P S Jangpangi for the achieve-
ment.
?=BQ 347A03D=
The meetings of the busi-
ness advisory committee of
the house and parliamentary
board of both Congress and
BJP would be conducted on
Thursday for the upcoming
Monsoon session of the
Uttarakhand assembly. The
five day session is commencing
from August 23.
The speaker Prem Chand
Agarwal said that the meeting
of the leaders of parliamentary
parties is convened at 3.30 pm
while the meeting of the busi-
ness advisory committee is
scheduled at 4 pm on
Thursday. He said that discus-
sion on smooth conduct of the
assembly and legislative work
would be held in these meet-
ings. Agarwal said that in the
meeting the support of both the
ruling party and opposition
would be sought for smooth
conduction of the house dur-
ing the five day session. The
government is expected to
table many important bills dur-
ing the session and it would
also seek approval of the house
for the supplementary budget
of Rs 5,300 crore.
F8;;A08B48BBD4B5
?D1;828=C4A4BC2=6
The deputy leader of
Congress legislature party,
Karan Mahra said that the
Congress party would corner
the government on its failures
on all fronts during the mon-
soon session.
He told The Pioneer that
the issues such as failure of the
government to bring down the
rising prices and provide
employment to the young-
sters. He said that the state
government is trying to
deceive the people of the state
by making committees on var-
ious issues so that things are
kept in limbo. The Congress
leader said that the village
watchmen who get a paltry
stipend of Rs 1,200 per month
have not received their stipend
from last one year similarly the
government has not paid the
promised incentive to the
Asha workers.
Mahra said that the
Congress party would raise its
voice against the amendments
made in the land laws and
would demand roll back of the
Uttarakhand Chardham
Devasthanam Management
board in the house. “We will
also ask as to why the BJP
changed two chief ministers in
four months and pushed the
state into political uncertain-
ty,’’ he said.
?=BQ 347A03D=
The members of the UPNL
employees union warned of
protest against the State
Government if their issues are
not discussed in the upcoming
Cabinet meeting. The president
of the union, Kushagra Joshi
said that Cabinet Minister
Ganesh Joshi had promised the
protesting outsourced employ-
ees of Uttarakhand Purva
Sainik Kalyan Nigam Limited
(UPNL) in April that their
demand of equal pay for equal
work among others will be
presented in the cabinet meet-
ing but nothing has been done
so far. “We even protested
outside Joshi’s residence on
Tuesday but he did not meet
us. On Wednesday, we protest-
ed outside the residence of
state minister Harak Singh
Rawat but his personal secre-
tary informed us that Rawat is
in Delhi and he has assured us
that our matter will be pre-
sented in the next cabinet
meeting,” stated the union
president. He said that if the
minister does not keep his
word, they will start a state-
wide protest. “We will stage
protests in each and every
district.
The association will also
gherao Vidhan Sabha during
the upcoming monsoon ses-
sion if our matter is not raised
in the cabinet,” asserted Joshi.
831/RXWVRXUFHGHPSORHHV
ZDUQRISURWHVWDJDLQVW6WDWH*RYW
3RXVdYhRcWZcdeUZdecZTee`RTYZVgV!!gRTTZ_VeRcXVe
?=BQ 347A03D=
The State Health depart-
ment reported only 16 new
cases of the novel Coronavirus
(Covid-19) and 29 recoveries
from the disease in
Uttarakhand on Wednesday.
Death of one patient of the dis-
ease was reported in the State
on the day.
The cumulative count of
Covid-19 patients in the state
is now at 3,42,668 while a total
of 3,28,914 patients have recov-
ered from the disease so far. In
the state 7374 people have lost
their lives to Covid -19 till date.
The recovery percentage from
the disease is at 95.99 while the
sample positivity rate on
Wednesday was 0.08 per cent.
The State Health depart-
ment reported six new patients
of Covid -19 from Bageshwar,
five from Dehradun and one
each from Champawat,
Nainital, Rudraprayag, Udham
Singh Nagar and Uttarkashi on
Wednesday. No new patient
was found in the remaining six
districts of the state on the day.
The State now has 331
active cases of Covid-19.
Dehradun with 103 cases is at
the top of the table of active
cases while Chamoli has 42
active cases. Almora has seven
while Haridwar and Nainital
have six active cases each.
The State reported no new
case of Mucormycosis (Black
fungus) and death of one
patient on the day. A total of
574 patients of the disease
have so far been reported.
In the ongoing vaccination
drive 71,402 people were vac-
cinated in 712 sessions in the
state on Wednesday.
RYLG2QOQHZ
FDVHVUHSRUWHGLQ8¶NKDQG
?=BQ 347A03D=
The leader of opposition
(LoP) in Uttarakhand
assembly Pritam Singh has
demanded that the govern-
ment should undertake efforts
at international level for safe
homecoming of the Indians
stranded in Afghanistan. In a
statement he said that the con-
dition in Afghanistan is dete-
riorating with each passing
day and other nations have
started evacuating their nation-
als from there but there is no
official information about the
efforts of the Indian
Government in this regard.
Singh said that the family
members of the Indians stuck
in Afghanistan are very wor-
ried. He opined that everyone
should rise above politics and
think on the issue. The LoP
said that newspaper reports
suggest that about 114
Uttarakhandis are stranded in
Afghanistan and their rela-
tives and family members have
pinned their hopes on the
efforts of the government for
their safe return.
?DA=8018B7CQ 347A03D=
While illicit drugs like
opium, cannabis and
smack are considered danger-
ous by a large part of society, the
social acceptance for intoxi-
cants like alcohol and tobacco
has made the general public
ignore the damaging effects of
these substances. The authori-
ties in Uttarakhand have been
claiming to bust various drug
smugglers on a regular basis but
nothing concrete is being done
to check the consumption of
intoxicants like tobacco and
alcohol which are easily avail-
able across the State. Many
teenagers, especially in slum
areas, can be seen consuming
alcohol and gutkha besides
smoking cigarettes and beedis
which are bound to harm them
physically and mentally. Some
experts opined that famous
celebrities endorsing alcohol
and tobacco also influence peo-
ple to try out these intoxicants.
Clinical psychologist Dr Mukul
Sharma said that people have
associated consumption of alco-
hol with various things like
lifestyle status, celebration and
commiseration in their daily life.
Many consume alcohol for its
taste and how it makes them feel
physically and mentally, said
Sharma.Healsostatedthatalco-
hol and tobacco are often used
together by many which put
themat highriskof health issues
like lung damage, liver disease
and cardiovascular disease
among others. Sharma said that
according to a survey conduct-
ed a few months ago in
Uttarakhand among people
aged 15 to 30 years, 87 per cent
of youth consume tobacco and
alcohol besides some other
drugs. Out of these 87 per cent
people, 13 per cent were women
and teenage girls, informed
Sharma. He said that regular
consumption of these intoxi-
cants, especially at a young age,
can cause various physical and
mental disorders, anxiety,
depression, liver and kidney
damage and heart-related issues.
He also stressed that parents
should stay more connected to
their children and educate them
about intoxicants from an early
age.
Peer pressure is also the
main cause due to which most
people start indulging in con-
suming such drugs as many
associate their consumption
with a high standard lifestyle.
Parents can assist children in
such situations if they regular-
ly communicate with children
and educate them, asserted
Sharma.
Dehradun based psy-
chotherapist, Aditi Arora also
stated that alcohol and tobacco
consumption has major poten-
tial to cause physical, psycho-
logical and social harm. She said
that consumption of such
socially accepted drugs is most-
ly a stepping stone for many
who later indulge in the addic-
tion to hard drugs like smack,
opium, heroin etc as they grad-
ually get immune to the easily
available intoxicants. According
to Arora, such intoxicants affect
families and often become a
major cause of domestic vio-
lence against women and chil-
dren.Thecuriositytofigureout
these intoxicants is a major
factor that attracts and compels
many to use them. The author-
ities should run campaigns to
educate people about intoxi-
cants and the consequences of
their regular consumption. Such
education and awareness should
be made compulsory in schools
too and the authorities must
monitor the progress made by
the school management. This
will make children capable of
understanding these drugs from
a very young age restricting
their curiosity about trying
them,” stated Arora.
B^RXP[PRRT_cP]RT^UX]c^gXRP]cbRP]RPdbT_WhbXRP[_bhRW^[^VXRP[b^RXP[WPa
?=BQ 347A03D=
The Chief Secretary of
Uttarakhand Sukhbir Singh
Sandhu has said telemedicine
service is an important scheme
to save the lives of the people
residing in the mountainous
areas of the state because it is
very difficult for the patients to
reach a hospital equipped with
facilities on time. He was pre-
siding over a review meeting on
the Telemedicine service at the
state secretariat here on
Wednesday.
In the meeting, the CS
directed the officers of health
department and district admin-
istrations of all the districts to
provide better connectivity and
set up required infrastructur-
al facilities for the telemedicine
service in the State. He direct-
ed the secretary, health to set up
a dedicated team for the service
and said that at least three IT
experts should be deployed to
ensure better connectivity. He
said that an effective plan
should be made in the districts
based on the feedback of the
doctors and IT experts so that
the hindrances in smooth exe-
cution of the service are
removed. On a terse note,
Sandhu told the director gen-
eral (DG) of health services to
ensure that all doctors deployed
in telemedicine service pre-
scribe generic medicines only.
The CS highlighted the need
for better training of the staff
deployed for the service and
opined that an effective imple-
mentation of telemedicine ser-
vice would help in preventing
migration from mountainous
areas of the state.
The meeting was attended
by secretary, health, Amit Negi,
additional secretary Sonika
and senior officers of the state
health services. The district
magistrates and other district
level officers also attended the
meeting via video conferenc-
ing.
?=BQ 347A03D=
The State meteorological
centre has issued an alert
regarding the possibility of
heavy to very heavy rainfall
with intense spells at isolated
places in districts of Kumaon
region and adjoining districts
of Garhwal region on
Thursday. Thunderstorms
accompanied with lightning
are also likely to occur at iso-
lated places in the mountainous
parts of the state. Apart from
this, light to moderate
rain/thundershowers are like-
ly to occur at most places in
districts of Kumaon region
and at many places in districts
of Garhwal region today. In the
provisional state capital
Dehradun, one or two spells of
light to moderate rain/thun-
dershowers are likely to occur
in some areas. The maximum
and minimum temperatures
are likely to be about 34 degrees
Celsius and 24 degrees Celsius
respectively on Thursday.
^]b^^]bTbbX^]B_TPZTa0VPafP[c^
R^]eT]TX_^acP]cTTcX]Vbc^SPh
FTf^d[SR^a]Ta
cWT6^eTa]T]c^]
XcbUPX[daTbSdaX]V
cWTbTbbX^])PWaP
?aXcPSTP]Sb
TUU^acbU^abPUT
aTcda]^UbcaP]STS
8]SXP]bUa^0U
CT[TTSXRX]TX_^acP]c
c^^[U^abPeX]V[XeTbX]
^d]cPX]^dbPaTPb)BP]SWd
8UQfibQY^VQQUbd
YcceUTV_bd_TQi
CWd]STabc^ab
PRR^_P]XTSfXcW
[XVWc]X]VPaTP[b^[XZT[h
c^^RRdaPcXb^[PcTS
_[PRTbX]cWT
^d]cPX]^db_Pacb^U
cWTbcPcT

4. ]PcX^]#
347A03D=kC7DAB30H k0D6DBC (!!
?=BQ =4F34;78
The Union Cabinet on
Wednesday approved the
National Mission on Edible
Oils —Oil Palm (NMEO-OP),
a new centrally sponsored
scheme, with a financial outlay
of C11,040 crore to promote the
domestic cultivation of oil palm
in the next five years, and
reduce the country’s depen-
dence on edible oil imports.
The decision comes after
Prime Minister Narendra Modi
announced the new central
scheme on August 15 during
his Independence Day speech
at Red Fort. The Cabinet
Committee on Economic
Affairs (CCEA) on Wednesday
approved a C77.45 crore pack-
age for the revival of state-run
North Eastern Regional
Agricultural Marketing
Corporation Ltd.
“A financial outlay of
C11,040 crore has been made
for the scheme, out of which
C8,844 crore is the Government
of India share and C2,196 crore
is State share and this includes
the viability gap funding also.
Under this scheme, it is pro-
posed to cover an additional
area of 6.5 lakh hectare (ha.) for
oil palm till the year 2025-26
and thereby reaching the target
of 10 lakh hectares ultimately.
The production of Crude Palm
Oil (CPO) is expected to go
upto 11.20 lakh tonnes by
2025-26 and upto 28 lakh
tonnes by 2029-30,” Union
Agriculture Minister Narendra
Singh Tomar said while
addressing a press conference
after the Cabinet meeting.
“Due to the heavy depen-
dence on imports for edible
oils, it is important to make
efforts for increasing the
domestic production of edible
oils in which increasing area
and productivity of oil palm
plays an important part,”
Tomar said.
Regarding farmers’ fear of
price fluctuation, he said that
the Centre will fix the cost of
raw materials needed for palm
oil production. “Like MSP
(minimum support price) …
we will fix the price of this raw
material (cultivated by farm-
ers)… This will motivate the
farmers, and in case prices of
the raw material crops drop, the
Government will pay the dif-
ferential amount to farmers
through DBT (direct bank
transfer),” he said.
The centrally-backed
scheme will also help to
increase the capital investment
in the oil-producing ecosystem
in India. Along with that, it will
also generate employment and
increase income of farmers.
To address the issue of
shortage of planting material in
the country, seed gardens will
be provided assistance up to
C80 lakhs for 15 hectare in rest
of India and C100 lakhs for 15
hectare in North-East and
Andaman regions.
C!%!Tc`cV@¶Ue`
S``deaR]^`Z]ac`UfTeZ`_
?=BQ =4F34;78
After breaching the
value of one in
the first week of
August, the R num-
ber—which reflects
how rapidly the coro-
navirus pandemic is
spreading—has been
steadily decreasing in the
country including in Kerala
and some northeastern States,
according to researchers.
The R-value between
August 14-16, calculated by the
researchers, now stands at
0.89.
If R is less than one, it
means the number of newly
infected people is lower than
the number of infected people
in the preceding period and
the disease incidence is going
down.
India’s R has fallen to
around 0.9, Sitbara Sinha of the
Indian Institute of
Mathematical Science, who is
leading the research, told a
news agency, citing their data.
The R-value of Kerala,
which has the highest number
of active cases in the country,
is now below one, signalling a
relief to authorities who have
been struggling to bring down
the infection levels in the state.
Earlier this week, Union
Health Minister Mansukh
Mandaviya, visited Kerala with
a central team to review the
COVID-19 situation in the
state.
The Minister said the
Centre has allocated C267.35
crore to the state to strength-
en its health infrastructure
and will also provide 1.11
crore vaccines in August and
September.
There are currently
4,98,630 people under sur-
veillance in various districts of
the State. Of these, 4,70,771 are
in home or institutional quar-
antine and 27,859 in hospitals,
according to the state health
department.
Kerala, which recorded
the first COVID-19 case in the
country, received accolades
for effectively handling the
first wave, but the State
Government has been under
criticism after the second wave.
?=BQ =4F34;78
The Congress on Wednesday
hit out at the Government
over the hike in prices of LPG
cylinders, accusing it of being
insensitive and distorting the
budget of every household.
The party also displayed empty
LPG cylinders and ‘chulhas’ at
the AICC press conference to
highlight the issue of steep
LPG prices.
Congress general secretary
Priyanka Gandhi Vadra
charged that the Government’s
“collection scheme” is flour-
ishing by increasing prices of
LPG every month. “On July 1,
Modi ji’s Government
increased the price of LPG by
C25 and on August 17 again
increased it by C25. By show-
ing the dream of Ujjwala, the
‘collection scheme’ of the BJP
Government is flourishing by
increasing the prices of LPG
every month,” Priyanka said in
a tweet.
Congress spokesperson
Supriya Shrinate urged the
Government to bring down
prices of LPG cylinders to
provide relief to the common
people in the country. She
said the Government has ini-
tiated the very steep hike on
LPG cylinders by raising it by
C25 per cylinder, which is now
being sold at C860 per cylinder
in Delhi and is touching almost
C 1,000 in various parts of the
country.
“Our one and only
demand is please bring some
respite to people, think about
the plight of people and bring
down prices of LPG cylin-
ders. This is anti-women and
anti-people and due to high
prices people are forced to go
back to using cow dung and
firewood,” she said at AICC
briefing.
“We do hope that an
insensitive government intox-
icated on power will pay some
attention and bring some
respite to people. This is
absolutely immoral and there
is no word to describe this,”
she said.
Shrinate said as per Saudi
Aramco, which decides on
prices of gas, the price actual-
ly comes to C600 but why are
we paying C260 more. In the
last eight or nine months
alone, prices of LPG cylinders
have gone up by C265, which
is almost 44 percent, she said.
She also alleged that the
government is not paying any
subsidy on LPG cylinders and
there is no difference between
the market and controlled
prices.
On the much-touted
Ujjwala Yojna, she said the
reality is that beneficiaries of
the scheme cannot afford a
cylinder at C800 at a time
when 97 per cent of people are
earning less than what they
were three years back and 23
crore people have gone below
the poverty line.
“At what stage will the
Government realise that dur-
ing the economic crisis, when
people have lost jobs and their
wages have gone down and
when people are looking for
employment opportunities,
they should not distort their
home budgets,” she said.
RQJUDSVHQWUHIRUKLNH
LQSULFHVRI/3*FOLQGHUV
RYLG¶V5QXPEHU
RQGRZQZDUGWUHQG
DFURVVFRXQWU
0_^[XRT^UUXRTacaXTbWXbWP]S^]P]TffTP_^]Pc0bXP´bQXVVTbcX]cTa]PcX^]P[?^[XRT4G?!! X]=Tf3T[WX^]FTS]TbSPh
AP]YP]3XaXk?X^]TTa
?=BQ =4F34;78
The three ITBP K9 dogs—
Roobi, Maya and Bobby—
along with about troops who
were airlifted by an IAF C-17
aircraft from Kabul to the
Air Force Station Jamnagar in
Gujarat and subsequently to
Hindon airbase have now
reached Chhawla Camp of
the paramilitary here.
While Roobi is a Malinois,
Maya is a Labrador and Bobby
is a Doberman.
The three canines were
deployed at the Indian
embassy in Kabul and avert-
ed many tragedies by helping
the ITBP in timely detection
of IEDs.
The trio served the Indian
Embassy at Kabul for three
years with commendable
bravery, professional compe-
tence and fierce loyalty to the
ITBP troops, officials said.
“The trained canines had
detected many IEDs and pro-
tected the lives and limbs of
not only the Indian diplomats
but also the local Afghan
civilians engaged with the
embassy,” a senior official
said.
Deputy Inspector General
(Veterinary) of ITBP,
Sudhakar Natarajan expressed
his unalloyed pride in the
“superb professionally sound
performance of the brave dar-
lings, Maya, Roobi and Bobby
along with the troops of the
ITBP K9 wing, who have
worked with zero error to
sniff terror and secure Indian
assets in Kabul, during their
deployment.”
“Head Constables Kishan
Kumar and Bijender Singh,
and Constable Atul Kumar
were the handlers of these
hero K9s and have done an
outstanding job in securing
the Embassy. They report that
all three brave darlings are
extremely happy to touch
Indian soil and come back to
familiar sights, smells and
sounds of our nation.’
Natarajan said.
These three canines had
been trained at National
Training Centre for Dogs
(NTCD) at Bhanu, the elite
dog training school in
Panchkula district of Haryana.
Inspector General Ishwar
Singh Duhan has sent his
congratulations to the K9
handlers and their three brave
and loyal canines for “the
excellent account given in
keeping with the rich ethos
and traditions of ITBP.”
8C1?RP]X]TbbTaeX]VX]
0UaTPRW2WWPf[PRP_
New Delhi: Chief Justice of
India NV Ramana on
Wednesdaytermed“veryunfor-
tunate” certain “speculation and
reports” in the media about
Collegium meeting regarding
appointment of judges’ in the
Supreme Court.
CJIRamana,whilespeaking
intheceremonialfunctiontobid
farewell to Justice Navin Sinha
who is retiring, said the process
of appointment of judges is
sacrosanct and has dignity
attached to it and the media
must understand and recog-
nise its sanctity.
“On this occasion I want to
take the liberty to express my
concern about certain specula-
tions and reports in the media.
You are all aware we need to
appointjudgestothiscourt.The
processisongoing.Meetingswill
be held and decisions will be
taken. The process of appoint-
ment of judges is sacrosanct and
hascertaindignityattachedtoit.
My media friends must under-
stand and recognise the sancti-
ty of this process,” he said.
The CJI said that as an
institution, the apex court holds
the freedom of media and the
rights of individuals in high
esteem and today’s reflections in
some sections of the media,
pendingtheprocess,evenbefore
formalising the resolution is
counter-productive.
“There were instances of
deserving career progression of
bright talents getting marred
because of such irresponsible
reporting and speculation. This
is very unfortunate and I am
extremely upset about it,” he
said.
The CJI also lauded the
tremendous amount of maturi-
ty and responsibility displayed
by majority of senior journalists
and media houses in showing
restraint and not speculating on
such a serious matter.
“Such professional journal-
istsandethicalmediaarethereal
strength of the Supreme Court
in particular and democracy in
general. You are part of our sys-
tem. I expect all the stakehold-
ers to uphold the integrity and
dignity of this institution,” he
said. PTI
?a^RTbb^U
P__^X]cT]c^U
YdSVTbbPRa^bP]Rc
bPhb298
?=BQ =4F34;78
The India Meteorological
Department (IMD) on
Wednesday said the southwest
monsoon is set to revive in
north India from August 19
after a two-week break.
“Central and adjoining
peninsular India will experi-
ence enhanced rainfall activi-
ties during the next 2-3 days”,
the IMD said in its forecast.
There will be fairly widespread
rainfall in Gujarat,
Maharashtra, Odisha,
Jharkhand and Gangetic
West Bengal on Wednesday
and Thursday, the IMD further
said.
The IMD has issued an
orange alert for moderate rain
in Delhi.
The precipitation is expect-
ed to bring the maximum tem-
perature down to 32 degrees
Celsius in three to four days, it
said.
Meteorological experts said
“good rainfall” in the last 10
days of the month is expected
to cover the precipitation deficit
in the national capital.
The Northeast India,
meanwhile, will continue to
receive widespread rainfall
activity for the next two days,
after which the IMD has pre-
dicted a decrease in
intensity.
The IMD said the current
rainfall spell over
Gujarat, Maharashtra, Odisha,
Jharkhand, Gangetic
West Bengal, Madhya Pradesh,
northeast India and
sub-Himalayan West Bengal,
Sikkim will continue till August
19.
It said fairly widespread to
widespread rainfall activity
with isolated heavy falls are
very likely over
Gujarat, Maharashtra, Odisha,
Jharkhand, Gangetic West
Bengal on August 18 and 19;
over Madhya Pradesh from
August 18 to 20; and over
Telangana and Chhattisgarh
on August 18.
?C8Q =4F34;78
The Supreme Court on
Wednesday dismissed a
plea of former Maharashtra
home minister Anil Deshmukh
seeking to quash the FIR
lodged against him by the CBI
in the corruption case.
A bench of Justices DY
Chandrachud and M R Shah
dismissed the appeal of
Deshmukh against July 22
order of the Bombay High
Court saying “no case for inter-
ference with the high court ver-
dict is made out”.
The bench said that there
is “no error in the judgement”
of the high court.
On July 22, the High Court
had refused to quash an
FIR registered against
Deshmukh by the CBI, saying
the central agency’’s probe was
ongoing.
B2Yd]Zb3TbWdZW³b_[TP
TcT^a^[^VXRP[
Tg_TacbbPXS³V^^S
aPX]UP[[´X]cWT[Pbc
SPhb^UcWT
^]cWXbTg_TRcTS
c^R^eTacWT
_aTRX_XcPcX^]
STUXRXcX]cWT
]PcX^]P[RP_XcP[
B^dcWfTbc^]b^^]c^aTeXeTX]]^acW8]SXPUa^0dV (
?=BQ =4F34;78
As India chalks out big
plans for seaweed cultiva-
tion on its long coastline to
ensure employment and food
security, a team of researchers
has suggested that establishing
such nutrition-rich marine
plants’ farms near river estu-
aries can also help combat
marine pollution as it signifi-
cantly reduce nitrogen con-
centrations in the river and
prevent environmental nui-
sance in streams and oceans.
The study by researchers of
Tel Aviv University and
Berkeley University is pub-
lished in Communications
Biology. The study hold
importance for India which is
aiming to increase seaweed
production in the country to
11.5 lakh tonnes from the
current production levels of
2,500 tonnes in the next five
years under its flagship
Pradhan Mantri Matsya
Sampada Yojana (PMMSY).
The global researchers
arrived at such a conclusion
after they built a model for
growing Mediterranean stalk
kelp near the Alexander River
estuary, in Israel, hundreds of
metres from the open sea. The
river was chosen because it
discharges polluting nitrogen
from nearby upstream fields
and settlements into the
Mediterranean. Data for the
model were collected over
two years from controlled cul-
tivation studies.
According to experts,
nitrogen is a necessary fer-
tiliser for agriculture, but once
it reaches the ocean, it dis-
perses randomly, damaging
various ecosystems.
For its part, India is
already eyeing to cash in on
the huge potential of seaweed
farming and has launched
various seaweed cultivation
plans in several coastal states,
aiming to provide employ-
ment to 6-7 lakh people, par-
ticularly women.
“Recognizing the poten-
tial of the sector, the govern-
ment has developed a
roadmap to establish a sea-
weed processing industry and
matching seaweed cultiva-
tion,” Parshottam Rupala,
Union Minister of Fisheries,
Animal Husbandry and
Dairying said here after releas-
ing a booklet providing
glimpse of the challenges and
opportunities in the ‘Seaweed
Farming Entrepreneurship by
Cooperatives’ as highlighted
by a global webinar on
“Seaweed Business by
Cooperatives” held early this
year as a part of government’s
efforts to create awareness
and sensitize the sector.
Sundeep K Nayak,
Managing Director, National
Co-operative Development
Corporation (NCDC), said
that the Government is very
serious about the promotion
of seaweed cultivation as it
holds tremendous business
potential, particularly for
cooperatives. Known as ‘mir-
acle plants of sea’, seaweeds
can be used for medicine, fer-
tiliser, animal feed and food
and in many other sectors, he
added.
8]SXP´bQXV_[P]U^abTPfTTSUPaX]V
c^VT]TaPcTY^QbRdcPaX]T_^[[dcX^]
2WXSPQPaPP[[TVTb
B6´bbcPcTT]cX]B2 ^]
?TVPbdbPR^]UTbbX^]
?=BQ =4F34;78
Former Union Minister P
Chidambaram on
Wednesday said the solicitor
general telling the Supreme
Court that the Government
has information which he
cannot divulge in public by
way of an affidavit is a “con-
fession” that software-spy-
ware was used, and sought to
know if it was Pegasus and
for what purpose it was used.
The Centre on
Tuesday told the Supreme
Court that divulging infor-
mation on whether the coun-
try uses spyware like Pegasus
or not would involve the
n a t i o n a l
security aspect as enemies of
the nation or those indulging
in terror activities would
change or modulate their
software.
Reacting to the develop-
ment, Chidambaram said,
“SG tells SC that the gov-
ernment has information
which he cannot divulge in
public by way of affidavit.
That is a confession that
software-spyware was used.
For what, we do not know.”
CWT2T]caT^]
CdTbSPhc^[ScWT
Bd_aTT2^daccWPc
SXed[VX]VX]U^aPcX^]
^]fWTcWTacWT
R^d]cahdbTbb_hfPaT
[XZT?TVPbdb^a]^c
f^d[SX]e^[eTcWT
]PcX^]P[
bTRdaXchPb_TRc
2T]caT_dbWTS
=^acWTPbcX]c^
RWP^bbPhb2^]V
?=BQ =4F34;78
Alleging the Government
has pushed the entire
Northeast into chaos and there
was a complete breakdown of
constitutional machinery, the
Congress on Wednesday
accused Prime Minister
Narendra Modi and Home
Minister Amit Shah of com-
promising the country’s inter-
nal security and territorial
integrity.
Congress chief spokesper-
son Randeep Surjewala at a
press conference questioned
the silence of the PM, saying
the responsibility lies at his
doorstep and he must answer
the nation. He asked where the
Modi Government is
when there are war-like hos-
tilities between States ruled by
the BJP-NDA and miscreants
attacking the convoy of
Meghalaya Governor and mil-
itants firing through the streets.
“The PM and the Home
Minister are guilty of criminal
culpability on compromise of
internal security and India’s ter-
ritorial integrity,” Surjewala
said.
He cited examples of vio-
lence in States like Assam and
Mizoram, Meghalaya,
Nagaland and Arunachal
Pradesh and alleged thatuncer-
tainty, conflict, violent clashes
and unchecked lawlessness
have marred large parts of the
Northeast.
The situation is alarming,
he said and demanded answer
from the PM and the Home
Minister. Surjewala said with
the media preoccupied with
Afghanistan events, “The
Government is pushing a divi-
sive Hindu-Muslim narrative
andtheentireNortheastisboil-
ing. There is an alarming situ-
ation developing there.”
“Shockingly and sadly, the
Modi Government and Home
Minister Amit Shah remain
oblivious to the goings on in
Northeast. This completely
indifferent, criminally aloof
‘hands-off-approach’ of BJP
Government also emanates
from its illegal and often divi-
sive usurpation of power in
many Northeastern States and
a blind lust to latch on to ille-
gitimately formed
Governments, bereft of
consequences for the country,”
he said.

5. ]PcX^]$
347A03D=kC7DAB30H k0D6DBC (!!
:D0A274;;0??0=Q 274==08)
Acountrywide festival with
half a pint of milk,
described Hari S Kartha, vet-
eran economist and financial
journalist, after assessing the
first 100 days' performance of
the M K Stalin led Tamil Nadu
Government.
Despite financial con-
straints, the Tamil Nadu
Government has executed cent
per cent of what the DMK chief
M K Stalin had promised the
people during the election
campaign what he would do in
the first 100 days of office . A
reduction of Rs 3 for every liter
of petrol and milk sold in the
State has been widely appreci-
ated and demands are being
heard in Kerala and Karnataka
for the same concession.
“The cut in price of petrol
would benefit more than two
crore two-wheeler drivers in
the State and would make a lot
of impact in Tamil Nadu’s
economy,” said Finance
Minister Palanivel Thiagarajan
while addressing the legislative
assembly.
“Chief Minister Stalin is
trying to kick start the econo-
my by making liquid cash
available in the hands of the
people. This is a step in the
right direction as it would help
revive the economy crippled by
the pandemic,” said Kartha.
“A glance through the
progress card released by the
DMK Government in connec-
tion with its first 100 days in
office, is promising and there is
an all round good feeling in the
State,” said C D Meyyappan,
senior Congress leader who
enjoys good rapport with the
chief minister.
He pointed out that despite
the findings in the White Paper
on Tamil Nadu’s economy, the
Government has implemented
the promise of free bus rides for
ladies, transgenders and the
senior citizens. “The first 100
days of this Government saw
realization of investments
worth Rs 28,508 crore worth
investment which would gen-
erate more than 83,000 works.
I give A+ to this government
based on its activities till date,”
said Meyyappan, himself an
industrialist.
In yet another develop-
ment, the Tamil Nadu
Government declared on
Tuesday that Prof Sultan
Ahmed Ismail has been
appointed as the chairman of
the seven-member high power
committee which would have
the final say on the exploration
and extraction of hydrocarbon
projects. Prof Ismail would
have the final say in exploration
and extraction of hydrocarbon
from areas outside Protected
Agricultural Zones which have
been welcomed by farmers
and environmentalists alike.
A revolutionary step in
public health care “Health at
the Doorsteps”, the first of its
kind in India, became opera-
tional in Tamil Nadu. A multi-
specialty hospital would come
up soon in the campus of
Chennai’s Kings Institute at a
cost of Rs 250 crore, said Ma
Subramaniam, Tamil Nadu’s
Minister for Health.
80=BQ 060AC0;0
TheTripuraHighCourtonWednesdayreject-
edapetitionfiledbytheTrinamoolCongress
seeking a stay order on the probe against the
party's national General Secretary Abhishek
Banerjee,BengalEducationMinisterBratyaBasu
and four others, and directed the police to con-
tinuewiththeirprobeagainsttheTrinamoollead-
ers for allegedly obstructing the police fromper-
forming their duties, court officials said.
However, Trinamool leader Subal
Bhowmik, who had filed the petition, claimed
that the high court's order was like a victory
for them as the court has asked the police not
to add any other sections to the case or sub-
mit their report without the permission of the
court.
Tripura police had on August 10 registered
a suo-moto case against six Trinamool leaders
for allegedly obstructing official duties and
misbehaving with the force at the Khowai
police station in western Tripura on August 8.
Besides Banerjee and Basu, Trinamool's
Rajya Sabha Member Dola Sen, its chief
spokesman Kunal Ghosh, Subal Bhowmik and
ex-Tripura minister Prakash Das were also
booked by the police.
80=BQ 274==08
FugitivegodmanNithyananda,
whohasbeeneludingIndian
authorities after facing several
charges of rape and other com-
plaintsfromhisformerdisciples
and devotees, has created a
major controversy by declaring
on social media that he has
assumed charge as the 293rd
pontiffofMaduraiAadheenam.
The incumbent pontiff,
A r u n a g i r i n a t h a
Gnanasambantha Desika
ParamacharyaSwamigal,passed
away at a private hospital in
MaduraionAugust13duetores-
piratoryillness.Hehadbeenthe
pontiff of Madurai Aadheenam
for four decades.
After his mortal remains
were laid to rest on August 14,
Harihara Desika
G n a n a s a m b a n t h a
Paramacharaya,whowasnamed
as the junior pontiff by
Arunagirinatha Swamigal in
2019,wasannouncedashissuc-
cessor. Mutt authorities told
IANS that he would be coro-
nated soon. However to the sur-
prise of devotees and followers
of the Madurai Aadheenam as
well as common people,
Nithyananda announced on
social media on Tuesday that he
hasassumedchargeasthe293rd
pontiff of Madurai Aadhenam.
All the spiritual, dharmic,
traditional rituals as per the cos-
mic laws of Kailasa and official
succession formalities as the
293rd pontiff of Madurai
Aadheenam is completed, he
said in his post.
Chennai: The Madras High
Courthasissuedaseriesofdirec-
tionstotheCentralGovernment
for releasing the caged parrot,
or ensuring autonomy to the
Central Bureau of Investigation
(CBI).
Hearing a Public Interest
Litigation to transfer a case of
cheating by a finance compa-
ny probed by Tamil Nadu
Police to the central agency, the
court's Madurai Bench on
Tuesday said: Only when the
CBI is given a statutory status,
(would) the autonomy of CBI
would be ensured. Secondly it
should have a dedicated cadre
of officers on its own without
getting the officials on deputa-
tion.
The CBI should have an
autonomy as that of
Comptroller and Auditor
General of India, who is only
accountable to Parliament.
The court also said that the
CBI Director should be vested
with ex-officio powers of the
Secretary to the Government of
India, reporting directly to the
Ministry without having to go
through the Department of
Personnel and Training (DoPT).
Pointing out that the
Supreme Court and the High
Courts entrust the CBI with
investigation of cases without
the consent of the states, the
court ordered that the Centre
consider and take a decision for
enactment of a separate Act giv-
ing statutory status with more
powers and jurisdiction to the
CBI at the earliest.
It also sought that the CBI
shall be made more indepen-
dent like the Election
Commission and the
Comptroller and Auditor
General of India, and a separate
budgetary allocation shall be
made for the agency.
The CBI Director shall be
given powers as that of the
Secretary to the Government
and shall directly report to the
Minister/Prime Minister. IANS
Mysuru, (Karnataka): The
Opposition parties have
slammed Union Minister of
State for Agriculture and
Farmers Welfare Shobha
Karandlaje for calling protesting
farmers as brokers and middle-
men.
Farmers are protesting
against the three farm laws for
nearly nine months at the bor-
ders of Delhi.
Karandlaje has dubbed pro-
testers as 'brokers' and 'middle-
men'. We can convince the
genuine famers not the fake
ones, she had commented.
Former minister and JD(S)
leader Sa Ra Mahesh on
Wednesday urged the Shobha
Karandlaje to take back her
statement on protesting farmers
and apologize. If the new laws on
agriculture are in the interest of
the farmers, it has to be com-
municated to the agitating farm-
ers and they have to be con-
vinced about them. Dubbing
agitating farmers as brokers is
not acceptable, he added.
Kuruburu Shantakumar,
State Farmers Organisation
Federation President chided
Shobha Karandlaje and said that
she gave the statement for cheap
publicity. She has spoken very
lightly about farmers, he men-
tioned.
Karnataka Sugarcane
Growers Association members
also staged a protest and ques-
tioned Shobha Karandlaje on her
comments on agitating
farmers.
Shobha Karandlaje on
Tuesday had said that the gov-
ernment has held 11 rounds of
meetings with agitating farmers
and Prime Minister is trying to
remove the shackles of farmers
through these new sets of
laws. IANS
?=BQ ;D2:=F
With an aim to crack a
whip on terror and relat-
ed activities in Uttar Pradesh,
Chief Minister Yogi Adityanath
on Wednesday recommended
the establishment of 12 units of
ATS (Anti-Terrorist Squad)
simultaneously. A proposal to
further strengthen the ATS
was also proposed for the elite
force to be equipped with more
state-of-the-art resources as
well as increasing the number
of employees and officers.
ATS units will be estab-
lished in 10 sensitive dis-
tricts. In these, ATS units or
commando training centres
will be set up at Meerut,
Aligarh, Shravasti, Bahraich,
Greater Noida (Jewar
Airport), Azamgarh (nearby
airport), Kanpur, Sonbhadra,
Mirzapur and Deoband in
Saharanpur. Land has been
allotted in the respective dis-
tricts for setting up the units
and process is going on for
the construction of build-
ings. Apart from this, land is
likely to be allotted soon for
setting up ATS units in
Varanasi and Jhansi.
According to the instruc-
tions of the Government, to
make ATS more effective, new
field units of ATS have been
established at Bahraich and
Shravasti on the Indo-Nepal
border. The ATS arrested 69
terrorists belonging to various
terrorist organisations such as
ISIS, Hizbul Mujahideen, Jaish-
e-Mohammed, JMB,
ABT/Bangladesh, Babbar
Khalsa. They also tracked ISI
spies, Naxals, terror funding
and those circulating fake
Indian currencies and arrested
216 people accused of various
offences.
Many accused people have
been arrested while busting the
syndicate that lured deaf stu-
dents and people from the
weaker income groups to con-
vert them with the lure of
money, job and marriage.
On January 16, the ATS
arrested and sent 18 accused,
including three Chinese
nationals, to jail for activating
fake mobile SIM cards based on
coded forms. This case is relat-
ed to scams as well as anti-
national activities, which are
being investigated deeply.
?=BQ ;D2:=F
The tremors of the cross-border
event, the takeover of Kabul by
Taliban in Afghanistan are being felt in
poll-bound Uttar Pradesh. Within 48
hours of Taliban taking over Kabul, the
Yogi Adityanath Government
announced setting up of an Anti-
Terrorism Squad (ATS) in Deoband, a
town known for its Islamic seminary
Darul Uloom Deoband.
There is a palpable sense of outrage
among the clerics of Deoband over the
setting up of an ATS commando train-
ing centre in their town. Though there
was no public display of jubilation in
Deoband after the takeover of Kabul by
Taliban, a sense of accomplishment was
obvious as the Islamic seminary in
Deoband is the alma mater of the
Taliban. The clerics of Darul Uloom
Deoband are unwilling to speak on
record. They, however, maintain that
the government decision to set up ATS
in Deoband is a deliberate attempt to
equate terror with Deoband and malign
the image of the seminary.
Maulana Sami ul-Haq, known as
the Father of Taliban in Pakistan, who
set up Darul Uloom Haqqania in
Peshawar where the Talibans were
trained, was a student of Darul Uloom
Deoband. He was also a member of
Pakistan senate and was assassinated in
2018 in Rawalpindi.
The reverberations of the fall of
Afghanistan to Taliban forces are being
felt in the poll-bound State, especially
western UP and the small dusty town
of Deoband in the Saharanpur district.
While UP has nearly 20 per cent
Muslim population, the concentration
is the highest in the western region at
26-46 per cent.
It was Chief Minister Adityanath’s
media advisor Shalabh Mani Tripathi,
who linked the decision to the Taliban's
return to Afghanistan. He tweeted in
Hindi on August 17: “Amid the
Taliban’s savagery, here is a piece of
news from UP. Yogi ji has decided to
open a commando training centre in
Deoband. Over half-a-dozen ATS offi-
cers selected from across the state
would be deputed there,” he said,
adding that the decision was “causing
pain” to “those protecting terrorists”.
Opposition parties in UP have crit-
icised the decision. Samajwadi Party
leader Ram Govind Chaudhary alleged
it was to “instill fear” among the
Muslims of the region. The Sambhal MP
of SP, ShafiqurRahman Barq,went astep
further and defended the Taliban
takeover, equating it with India's free-
dom struggle. He said in Sambhal on
August 17, that the Taliban did not allow
Russia or the United States to establish
themselves in Afghanistan, “and now
they want to run their own country”. He
was promptly slapped with a case under
Section 124A of the Indian Penal Code
for sedition by the UP police.
C=A067D=0C70Q D108
In a prize catch, the Maharashtra Anti
Terrorist Squad (ATS) on Wednesday
arrested Niranjan Shah, a former aide
of late scamster Big Bull Harshad
Mehta, from Delhi, for his alleged role
in a narcotics case involving an inter-
national drug syndicate.
The ATS brought off Niranjan
Shah’s arrest after six month-long
investigations that took its personnel six
States across the country. The investi-
gators financially traced Shah to Delhi
where they arrested him.
Sixty-five-year-old Shah - a former
partner of stock market big bull
Harshad Mehta who masterminded the
1992 Indian securities scam and died
at the age of 47 on December 31 2001
-was produced before a designated
court which sent him to ATS custody
till August 25.
Shah’s name had figured in the
investigations into a major case involv-
ing the arrest of one Sohel Yusuf
Memon and subsequent seizure of
5.65 kilogram of Mephedrone worth
around Rs. 2.53-crore. During the
interrogation, Memon had told the ATS
that Shah had supplied the contraband,
but had absconded after that.
Subsequently, ATS’ State Additional
DGP Vineet Kumar Agarwal, DIG
Shivdeep Lande, SP Sohail Sharma
formed a special team of ATS Juhu and
set them on a mission to arrest Shah.
By then, Shah had already sneaked
out of Mumbai and was moving around
in disguises across the country with his
trail found in state like Karnataka,
Telangana, Madhya Pradesh,
Rajasthan, Uttar Pradesh and finally
Delhi, said the officials.
“Shah was also constantly on the
move in disguises. It had become a
challenge for ujs to trace and arrest
him,” an ATS official said.
After prolonged investigations that
saw them visit six states, ATS sleuths
finally tracked him to Munirka village
in Delhi, where he was living as an ordi-
nary, poor man, in a single-room
hired in somebody else’ name and
nabbed him in a covert operation yes-
terday.
Apart from the Juhu ATS, Shah is
wanted by several agencies like the
Anti-Narcotics Cell and Economic
Offences Wing, Mumbai, the Narcotics
Control Bureau and Directorate of
Revenue Intelligence, New Delhi, and
several police stations in both the
cities.
Shah had earlier been arrested by
the DRI in New Delhi in 2011 and by
the NCB Mumbai in 2014, but was
released on bail. The investigators said
his links were found with dubious ped-
dlers engaged in smuggling large quan-
tities of drugs both into and outside the
country.
?=BQ 90D
The Jammu Kashmir Police on
Wednesday claimed that some
Hurriyat leaders, who were hand in
glove with few educational consul-
tancies, were selling Pakistan-based
MBBS seats and other courses to fund
terrorism in Kashmir valley.
So far the police claimed to have
arrested four separatist leaders while
looking for others in connection with
the case. The FIR in the case was ear-
lier registered in July 2020.
Those arrested by the Counter
Intelligence Kashmir in Srinagar have
been identified as Mohammad Akbar
Bhat alias Zaffar Bhat, self-styled
chairman of Salvation Movement,
Fatima Shah, Mohammad Abdullah
Shah and Sabzar Ahmad Sheikh.
Police are also looking for Bhat”s
brother,AltafAhmadBhat,andShah”s
brother, Manzoor Ahmad Shah, and
othersinconnectionwiththecase.The
two named accused had exfiltrated to
Pakistan during early 1990s for illegal
arms and ammunition training and
settled down on the other side.
They played a key role on behalf
of ISI in facilitating matters pertain-
ing to admissions under this catego-
ry for this set of Hurriyat linked per-
sons in India as part of a nefarious
design of pumping money into mili-
tancy and other terrorist related activ-
ities, the police spokesman added.
According to a police spokesman,
the information on the basis of
which criminal investigation had
been started into the matter also sug-
gested that the money collected
from the parents of the aspiring or
potential students was used, at least
partly, to support and fund terrorism
and separatism in different ways.
The police spokesman said while
investigating the case vide FIR num-
ber 05/2020 under section 13, 17,
22A, 40 Unlawful Activities
Prevention Act read with section 4 of
Prevention of Money Laundering
Act, many significant facts emerged
and came to be established.
During the course of investiga-
tion, it surfaced that MBBS and
other professional degree related
seats in many cases were preferen-
tially given to those students who
were close family members or rela-
tives of killed terrorists.
There were also cases where the
quota allotted to individual Hurriyat
leaders were sold to anxious parents
who desired their children to have
MBBS and other professional degrees
in one way or the other.
Morethan80caseswerestudiedin
which either the students or their par-
entswereexaminedforacademicyears
between2014-18.Searcheswereunder-
takeninaboutadozenpremisesinthe
valleytolookforevidenceofcollection
of money and its further usage.
The analysis of digital records and
paper receipts as well as records per-
taining to bank transactions revealed
that a sizable portion of the money
was kept aside for personal use.
“Evidence also came on record to
show that money was put into chan-
nels that ended up supporting pro-
grammesandprojectspertainingtoter-
rorism and separatism. For example,
payment for organising stone pelting
also could also be traced and brought
on record,” the spokesperson said.
3DNEDVHG0%%6VHDWVXVHGWRIXQG
WHUURULVPLQ.DVKPLUVDSROLFH
B0D60AB4=6D?C0Q :;:0C0
Bengal Chief Minister on
Wednesday reposed faith in
the Ministry of External Affairs
about its deaings with the
Afghanistan crisis urging upon
the Central Government to
safely evacuate the Indian
nationals including those from
Bengal stranded in the strife-
torn nation.
When asked to comment
on what she thought about the
Afghan crisis and what her
opinion was about the Centre’s
dealing with it she said “it is a
complex international isue and
need not be comment on …
the Ministry of External Affairs
is taking care of the situation …
they have evacuated some
Indians and I will urge them
evacuate all the Indians strand-
ed in that country including
those from our State.”
The State would be writing
a letter to the Centre in this
regard, she said. Banerjee said
a little more than a couple of
hundred people from Bengal
were currently stranded in
Afghanistan.
“So far we have been able
to trace more than 200 people
who are stranded in different
parts of Afghanistan. Some
are stranded in Kabul and
some are in the other parts of
the country. The Chief
Secretary is writing a letter to
the MEA requesting it to bring
back the citizens as quickly as
possible, she told the media
adding most of those who
were stuck up in that country
are from Darjeeling,
Kalimpong and Terai region.
“We are trying to find out
whether there are more people,”
she said.
However, sources in the
Home Department said more
people from Bengal could be
stranded in that State. “We have
got some unconfirmed inputs
from other districts like Nadia
and elsewhere who are still in
that country … we are trying
to confirm this,” an official said
adding “as we have to gather
information in short span of
time we could not gather the
entire information.”
The District Magistrates
had been asked to “inform the
top echelons of the adminis-
tration directly if anyone comes
and informs them that their rel-
atives are stuck” in Afghanistan
the official said adding “the
names, addresses, their where-
abouts in Afghanistan and
phone numbers and other
details have also been asked
for… as soon as we collect these
information we will immedi-
ately pass it on to Delhi.”
Apart from the
Afghanistan issue the Chief
Minister also dwelt on a host of
other things saying she had
requested the Prime Minister to
send more vaccines to Bengal.
“The Prime Minister is telling
that his Government has vac-
cinated 50 crore people but
here in Bengal we have got only
3 crore vaccines … w ereas we
require 14 crore doses.”
On the resuming of the
local train services she said
“only after 75 percent of
Kolkatans and 80 percent of the
people living in Howrah have
been vaccinated we will start
vaccinating the villagers and
after 50 percent of them have
been vaccinated we will start
the local train service.”
The Chief Minister said
that she was sending a team of
ministers and MPs to the Niti
Ayog in Delhi to get clearance
for three “master plans” for
Sunderbans, coastal tourist
town Digha and Ghatal in
order to save them from recur-
rent floods in the face of chang-
ing global climate.
F_Z`_Z_UfSdWRc^Vcd¶ac`eVde
RdSc`Vcd¶decfXX]VWRTVdW]R
7fXZeZgVX`U^R_?ZeYjR_R_UR
_R^VdYZ^dV]WRdRUfcRZ
2RUYVV_R^d#*$cUa`_eZWW
³AT[TPbTRPVTS_Paa^c)
PSaPb72bPhb
218]TTSbbcPcdc^ah
bcPcdb[XZT42
6WDOLQKDVNHSWKLV
SROOSURPLVHV
VDVHFRQRPLVW
3RUQFDVH5DM.XQGUDJHWVLQWHULP
UHOLHIIURPDUUHVWWLOO$XJXVW
C=A067D=0C70Q D108
In a relief to Bollywood actress Shilpa
Shetty’s businessman-husband Raj
Kundra, the Bombay High Court on
Wednesday granted him interim pro-
tection from arrest till August 25 in the
case registered in 2020 by the Mumbai
Police in the porn film racket case.
After hearing both sides in a petition
seeking an anticipatory bail in the First
Information Report (FIR) lodged by
Mumbai Police Cyber Crime Cell for his
alleged involvement in porn racket case,
Justice Sandeep K Shinde of the high
court passed an interim order protect-
ing Kundra from arrest till the next hear-
ing date scheduled for August 25.
After the hearing began in the case,
Kundra’s lawyer Prashant Patil argued
that the other co-accused in the case were
already out on bail and the offences
against Kundra attracted a punishment
of less than seven years and there he
deserved protection from the arrest.
Opposing the anticipatory bail,
Additional Public Prosecutor Prajakta
Shinde told the high court that Kundra’s
role was different from that of the other
accused in the case. She sought time to
take more instructions on the merits of
the application.
Justice Shinde granted time to the
Prosecution,whilepassinganinterimorder
protecting Kundra from arrest till August
25 when his case will be heard again.
Kundra, who was arrested on the
night of July 19 in connection with a sim-
ilar complaint registered by the Crime
Branch in 2021, had earlier told the court
that there was no evidence to link him
against the HotShot App and was being
made a ‘scapegoat’.
Kundra,wholivesinMumbaiwithhis
wife Shilpa Shetty and two children, has
beenbookedunderSections292,293(sale
of obscene material) under the Indian
Penal Code, Sections 66E, 67, 67A (trans-
mission of sexually explicit material)
undertheInformationTechnologyActand
provisions of the Indecent Representation
of Women (Prohibition) Act.
Kundra had submitted to the court
that he had been falsely implicated in the
case while the Cyber Cell was making an
attempt to connect him with the crime.
Last week, after a lower court had
rejected his anticipatory bail plea, he had
moved the Bombay high court which has
granted him interim relief against arrest
for a week.
A day after Kundra was arrested in
connection with the alleged racket involv-
ing the making of pornographic content,
the Mumbai crime branch sleuths had on
July 20 named him as a “key conspira-
tor” and Bakshi as co-conspirator involv-
ing the creation and publication of
pornographic films through some Apps.
62eRZ_XTRcV`W2WdZefReZ`_+R^ReR
7ULSXUD+UHIXVHV
WRVWDSROLFHSUREH
DJDLQVW70OHDGHUV
FAe`VdeRS]ZdY#f_Zed
`W2EDdZ^f]eR_V`fd]j
OHULFVVODP*RYWIRU
GHFLVLRQWRRSHQ$76
FHQWUHLQ'HREDQG
3adVZX]V_X]U^aTaPXST^U
7PabWPSTWcPWT[SU^aa^[TX]
Pd[cXRa^aT]PaR^cXRbRPbT

6. guise of Islam. Husain was
known throughout the Arab
land for his wisdom, compas-
sion and piety. Had he encoun-
tered no opposition, Islam was
bound to get acclimatised to
the paralysing atonality from
Yazid’s degenerated symphony.
Husain was mercilessly
assassinated in the desert of
Karbala along with 71 family
members and companions on
the 10th of Muharram, 61 of
Hijri era (October 10, 680
AD), after being kept hungry
and thirsty for three days.
Among the martyrs was
Husain’s six-month-old son
Ali Asghar, the buoyancy of
whose innocent blood refloat-
ed the sinking ship of Islam.
Imam Husain declared: “Do
not submit to exploitation of
any kind, maintain a tenacious
grip on veracity; better die with
honour than live in shame.”
The modern-day scenario
of revival of terrorism can best
be explained in the words of
British historian Charles
Allen who, in his book ‘God’s
Terrorists — The Wahhabi
Cult and the Hidden Roots of
Modern Jihad’, writes:
“Wahhabi is the guiding ide-
ology behind modern Islamist
terrorism. In the late 18th
century, a violently intolerant
re-interpretation of Islam
took root in the Arabian
desert. Its followers became
known after their founder,
Sheikh Najdi ibn Abd-al-
Wahhab, as Wahhabis. The
creed was then exported to
India and its north-west fron-
tier Afghanistan.” So
Wahhabism is nothing but
pseudo- Islam with the sole
object to acquire political
power through terrorism and
by misusing the name of
Islam for getting mass support
of gullible Muslims across
the globe.
However, when opposi-
tion mounted against his
satanic ideology for ulterior
motives, Sheikh Najdi was
shrewd enough to find a
patron in Ibn-e-Saud, a
Bedouin tribal chief, who
made use of his vitriolic ver-
sion of Islam for illicit power.
Saud was the ancestor of pre-
sent-day Saudi rulers, who
actually belonged to the
Zionist tribe of Anza Ben
Wael. Thereafter, the ideolo-
gy was of Sheikh Najdi and
the sword was of Saud. A
dynastic government was
established as a result of this
partnership, which is still
continuing in the name of
Saudi Arabia.
Charles Allen further
writes Wahhabi or Salafi ide-
ology is enshrined in Kitab-al-
Twahid (book of unity), which
prescribes the forceful conver-
sion of Muslims from other
sects as well as others to the
Wahhabi ideology, wherein he
manifestly says: “Follow my
ideology, else get ready to be
killed.” Charles Allen also
pointed out that all terrorist
organisations (such as ISIS, al-
Qaeda and Taliban) follow the
Wahhabi ideology.
Following the Wahhabi
ideology on the pattern of
accursed Yazid ibn Muaviya,
Taliban have recently complet-
ed the sweep of Afghanistan.
They’re in full control of
Afghanistan in a lightning
offensive, and Kabul was
knocked down in one fell
swoop by the Taliban earlier
this week. They are carrying
out unprovoked attacks on
civilians and executing the
captured soldiers. The Wall
Street Journal reported that
the Taliban have asked com-
munities to turn over their
unmarried women to become
“wives” of the terrorists.
Not only in Afghanistan,
the virus of terrorism may
spread to other parts of the
world; hence it is necessary to
eliminate the morbid ideolo-
gy of Wahhabism alongside
eliminating the terrorists. All
sects of Muslims and their reli-
gious heads must come for-
ward to prevent this disease.
(The writer is a legal jour-
nalist and author. The views
expressed are personal.)
3??;9771CB1D5C89;541719
Sir — Enough is enough. The price of the
Liquefied Petroleum Gas (LPG) for
domestic cooking was on Wednesday
again increased by C25 per cylinder; the
second straight month of increase in the
rates. Subsidised LPG now costs C859 per
14.2kg cylinder as per the price notifi-
cation by the oil companies. On July 1,
non-subsidised LPG cylinder rates were
increased by the same proportion, and
now the subsidised cooking gas prices
have been raised.
There is hardly any difference in the
rates of subsidised and non-subsidised
cooking gas. The latest increase in the
subsidised LPG price has now taken the
cumulative rate hike since January 1 to
C165 per cylinder. The Government
eliminated subsidies on LPG by raising
rates every month. The price of domes-
tic cooking gas has more than doubled
in the last seven years. The retail selling
price of domestic gas was C410.5 per
14.2kg cylinder on March 1, 2014. In
Mumbai, a 14.2kg LPG cylinder now
costs C859.50 while, in Kolkata, it is
priced at C886. In Chennai, an LPG
cylinder will now cost C875.50, up from
C850.50. With this, the increased LPG
price is hitting every householder who
is already struggling for survival.
Bhagwan Thadani | Mumbai
7?FD=ECD3?=5351?@571CEC
Sir — Solicitor General (SG) Tushar
Mehta telling the Supreme Court that the
Government has information which he
cannot divulge in public is a confession
that the software spyware Pegasus was
used. But what national security implica-
tion could there be in disclosing why the
phones of Rahul Gandhi, Prasant Kishor,
Ashok Lavasa and three phone numbers
belonging to the Supreme Court staffer
who accused former CJI Ranjan Gogoi of
sexual harassment in 2019 were selected
as potential targets for surveillance.
Actually, the general public agrees
with senior lawyer Kapil Sibal that “our
intention is to not to have the security
details, but SG Mehta must reply whether
Pegasus as a technology was used or not”.
If the Modi Government replies in ‘yes’
or ‘no’, both the sides could have an
informed discussion on this issue. But the
Government’s adamant attitude washed
away the entire monsoon session and now
it blames the Opposition with no reason.
It would only be fair if the SC orders
an inquiry by experts and unbiased
independent persons. But Sibal firmly
rejected the proposal: “As far as I am con-
cerned, the issue is simple. If the
Government says they have used Pegasus,
there is no need for a committee. If the
Government says they have not used
Pegasus, then too there is no need for a
committee.”
Bidyut Kumar Chatterjee | Faridabad
94913B93;5D5BC?1B?
Sir — Once again, Team India has proved
thatithasthefirepowertoconsistentlywin
matches even on foreign soil. If the team
had breached Fortress Gabba in January
this year, it lorded over England at Lord’s
to win the second Test in a dramatic fash-
ion to go one up in the five-match series
(‘India conquer Lord’s’, August 17).
Adisplayofgritandmentaltoughness
by Shami and Bumrah with the bat and a
seam bowling attack by Team India’s pace
quartet ensured that the visitors notched
up a thumping 151-run win against a
befuddled England side that went from
hopetohumiliationinafatuousandinane
battingdisplayinafewfrenziedhours.Call
it fortuitousness or happenstance, 75
years have rolled by since the nation was
freed from the colonial British Raj. Team
India conquered England in an emphat-
ic fashion at Lord’s just a day after our
nation celebrated the Independence Day.
Ranganathan Sivakumar | Chennai
A 2 A 6 C H : E 9 A 2 D D : @ ?
gggTQYi`Y_^UUbS_]
UPRTQ^^ZR^SPX[h_X^]TTak /CWT3PX[h?X^]TTak X]bcPVaPR^SPX[h_X^]TTa
347A03D=kC7DAB30H k0D6DBC (!!
%
BT]Sh
h^daU
UTTSQPRZc
c^)
[TccTabc^_X^]TTa/VPX[R^
9dbc$hTPabPUcTacWTSTXbT^U?a^_WTc^WPPSX]%!03cTaa^aXbcb
bcPacTSfTPaX]VcWTR[^PZ^U8b[Pc^WXSTcWTXaQTbcXP[XchP]SX^aP[Xch
807DB08=F0B
0BB0BB8=0C438=
C7434B4AC5
:0A10;00;=6
F8C7 508;H
414AB0=3
2?0=8=B=
C74 C75
D70AA005C4A
148=6:4?C
7D=6AHC78ABCH
5AC7A4430HB
0=6C74
0ACHABF0B
807DB08=³B
B8G=C7;3
B=0;80B670A
;4CC4AB CC
C74438CA
81C1:7DAB783
C
WTCP[XQP]WPeTSTR[PaTSP]°P]Tbch±
PRa^bb0UVWP]XbcP]P]SdaVTScWT]PcX^]³b
f^T]c^Y^X]cWTXa°6^eTa]T]c±CWTh
e^fTS c^ aTb_TRc f^T]³b aXVWcb U^aVXeT
cW^bT fW^ U^dVWc cWT P]S T]bdaT cWPc
0UVWP]XbcP]S^Tb]^cQTR^TPWPeT]U^acTa
a^aXbcbQeX^db[hcWTCP[XQP]WPeTb^dVWcc^
_^acaPhcWTbT[eTbPb^aT^STaPcTcWP]
cWTXabcaXRcU^a^U8b[PXRad[TUa^ ((%c^
! 8]b_XcT^UP[[cWTbTPbbdaP]RTbQhcWT
CP[XQP]P]h0UVWP]bP]SP[PaVT]dQTa
^U_T^_[TX]VT]TaP[PaTbZT_cXRP[
3daX]VcWTCP[XQP]³b_aTeX^dbaTVXTcWTh
R^]UX]TSf^T]c^cWTXaW^TbQP]]TScT[T
eXbX^]P]SdbXRP]SWT[S_dQ[XRTgTRdcX^]b
F^T]R^d[S]^cf^aZVXa[bfTaT]^cP[[^fTS
c^PccT]SbRW^^[P]Sf^T]WPSc^R^eTacWTXa
UPRTbP]SQTPRR^_P]XTSQhPP[TaT[PcXeT
8UcWTCP[XQP]QT[XTeTcWPccWThPaT]^ccWT
bPTCP[XQP]^U!hTPabQPRZcWThdbc
ST^]bcaPcTcWPc_dQ[XR[hFWX[TcWTCP[XQP]
[TPSTabWX_XbbdTbbcPcTT]cbPQ^dcbPUTVdPaS
X]V f^T]³b aXVWcb cWT bXcdPcX^] ^] cWT
Va^d]SRaTPcTbP]^__^bXcTX_aTbbX^]8]^]T
_[PRT cWT W^dbTb ^U UTP[T ?Pa[XPT]c
TQTabfTaTbTPaRWTSP]ScWTXaRPabfTaT
cPZT]PfPh2^]bXSTaX]VcWT[XXcb^U_^[XcX
RP[fX[[^UcWTX]cTa]PcX^]P[R^d]XchcWTaT
XbR^]bXSTaPQ[Td]RTacPX]chPQ^dcfWPcbcT_b
^cWTa R^d]caXTb fX[[ cPZT c^ T]bdaT cWPc
f^T]³baXVWcbPaT_a^cTRcTSX]0UVWP]XbcP]
4eT]cWTR^d]caXTbcWPcQ^PbcPQ^dcWPeX]V
PUTX]XbcU^aTXV]_^[XRhWPeTQTT]bX[T]cPQ^dc
cWTaXVWcb^Uf^T]X]0UVWP]XbcP]
CWTX]cTa]PcX^]P[R^d]XchdbcfPZT
d_c^cWTaTP[Xch^UcWTbXcdPcX^]bcP]SQhcWT
f^T]X]0UVWP]XbcP]P]SUX]Sc^^[bc^_aTb
bdaTcWTCP[XQP]P]SbW^fcWT_^[XcXRP[fX[[c^
S^b^CWXbXbcWT[TPbccWTX]cTa]PcX^]P[R^
d]XchR^d[SS^
ET]d6B| :^[[P
DQYRQ^]ecdgQ[dXUdQ[
)LUVWWHUURUDWWDFN
ZDVLQ.DUEDOD
I
slam prohibits violence and
promotes peace and justice.
The Quran says “Prophet
Hazrat Mohammad was sent
to the world as a mercy to
mankind” (21:107). It states cat-
egorically: “Allah abhors any dis-
turbance of peace” (2:205). Since
there’s no provision of violence in
Islam, why is terrorism across the
globe is carried out in the name
of religion and who are these ter-
rorists wearing the cloak of Islam?
The answer is that just 50
years after the demise of Prophet
Mohammad in 632 AD, the true
essence of Islam had started yield-
ing to criminal groups of virulent
political power-wielders, who
proclaimed themselves as caliphs
by severely terrorising gullible
Muslims through the might of the
sword. For gaining mass support,
these terrorists have been associ-
ating themselves as head of the
religion and commander of the
faithful, calling themselves
“caliphs”. (Yazid’s model of false
caliph was recently copied by ter-
rorist Abubakar Baghdadi of the
ISIS). The true teachings of the
Holy Prophet were sidelined and
a pseudo Islam was projected by
these terror groups to run paral-
lel with the real Islam.
As such, the history of terror-
ists wearing the cloak of Islam is
almost 1400 years old, the
founder of which was one hard-
core terrorist, the accursed Yazid
ibn Muaviya, a self-proclaimed
caliph who mischievously
usurped the Caliphate of Islam
by brutally killing the real succes-
sor of Caliphate, Hazrat Imam
Husain, the grandson of Prophet
Hazrat Mohammad, in the desert
of Karbala (Iraq).
When Yazid usurped the
Caliphate of Islam, he demand-
ed allegiance from Hazrat Imam
Husain. He refused to subscribe
to Yazid ibn Muaviya as the
caliph of Islam as Yazid was a
hardcore terrorist, a brute and
a libertine. He was immoral to
the extent that a bare mention
of his evil deeds is taboo in
civilised society.
When Yazid bargained hard
for Husain to choose between
allegiance or death, the latter
knew that recognition of Yazid’s
immorality will permanently dis-
figure the true faith and a pseu-
do religion will emerge in the
SOUNDBITE
FTYdSVTbPaT^UcT]
RPdVWcX]cWTSX[TP
^U^aP[XcheTabdb
[TVP[XchX]^da`dTbc
c^ST[XeTaYdbcXRT
2WXTU9dbcXRT^U8]SXP
¯=EAPP]P
2P]PSPWPb]^
_[P]bc^aTR^V]XbT
cWTCP[XQP]PbcWT
V^eTa]T]c^U
0UVWP]XbcP]da
U^RdbaXVWc]^fXb^]VTccX]V
_T^_[T^dc
2P]PSXP]?aXTX]XbcTa
¯ 9dbcX]CadSTPd
8c³bP[fPhbb_TRXP[
bW^^cX]VX];TW
;PSPZWP]S8³eTQTT]
cWTaT^UcT]CWT[^RP[b
X]U^aTSdbcWPccWXb
fPbcWTWPaSTbccXT^UcWThTPa
BX]VTa[haXRXbc
¯9dQX]=PdcXhP[
8]^daYdbcXRTbhbcT
cWT_a^RTbbXb^UcT]
_d]XbWT]c1dcYdb
cXRTWPbQTT]S^]T
fX[[P[[^fcWTUPX[h
c^^da]Bd]P]SPX]_TPRT
2^]VaTbb;^ZBPQWP?
¯BWPbWXCWPa^^a
8b]³cEXaPc:^W[X
cWT^bcU^d[
^dcWTSX]SXeXS
dP[.8³[[]TeTaU^a
VTccWTQPaaPVT^U
PQdbT8aTRTXeTSX]! !fWT]
cWTbfTPaX]Vbcd]]TST
5^aTa4]V[P]SQPcbP]
¯=XRZ2^_c^]
7
KHQRQVXFFHVVRIWKH,QGLDQ6SDFH5HVHDUFK2UJDQLVDWLRQ·V$XJXVWODXQFK
RIWKH*6/9)*HR6QFKURQRXV6DWHOOLWH/DXQFK9HKLFOH

7. ZLWKDQ(DUWK2EVHUYDWLRQ
6DWHOOLWH(26