PENILAIAN KINERJA GURU   (Teacher Performance Appraisal)KEMENTERIAN PENDIDIKAN NASIONAL BADAN PENGEMBANGAN SDMP DAN PMPPUS...
Semangat Permenegpan dan RBNo.16/2009   Peraturan baru yang terdiri dari 13 Bab dan    47 pasal, secara keseluruhan menga...
Semangat Permenegpan dan RB No.16/2009(2)   Peraturan ini terbit dalam rangka memberi    ruang dan mendukung pelaksanaan ...
Perubahan Mendasar yang Terkandung DalamPermenegpan dan RB No.16/2009 (1)   Penilaian Kinerja Guru yang sebelumnya lebih ...
Perubahan Mendasar yang Terkandung    Dalam Permenegpan dan RB No.16/2009    (2)   Guru dinilai kinerjanya secara teratur...
Perubahan Mendasar yang Terkandung Dalam        Permenegpan dan RB No.16/2009 (3)   Perolehan angka kredit dari PKG dan P...
Perubahan Mendasar yang Terkandung Dalam        Permenegpan dan RB No.16/2009 (4)   Penghargaan angka kredit adalah 125% ...
PERBEDAAN UTAMA      KEGIATAN PENGEMBANGAN PROFESI ANTARA      PERATURAN LAMA DENGAN YANG BARU                            ...
LANJUTAN…4   Jenis             (Tidak ada pada peraturan 1. diklat fungsional    Pengembangan      lama)                  ...
JENJANG JABATAN DAN PANGKAT  GURUPermen Menpan 84/1993                  Pernyempurnaan• Jabatan dan Pangkat melekat       ...
KEWAJIBAN MELAKSANAKAN    PENGEMBANGAN KEPROFESIAN    BERKELANJUTAN (PKB)PERMEN MENPAN 84/93                 PENYEMPURNAAN...
Penilaian Pembelajaran            PembimbinganPermen Menpan 84/93                     PenyempurnaanPenilaian PBM didasarka...
Kinerja GuruSecara umum ukuran kinerja dapat dilihat dari  lima hal, yaitu:  •   Quality of work - kualitas hasil kerja  •...
UU Guru dan Dosen No. 14/2005            Pasal 1Kinerja guru dibingkai dalam lingkup beban tugasdan tanggungjawabnya, yait...
TUJUAN PK-GURU   PKG menjamin bahwa guru melaksanakan    pekerjaannya secara profesional   PKG menjamin bahwa layanan pe...
HASIL PK Guru   Merupakan bahan evaluasi diri bagi guru untuk    mengembangkan potensi dan karirnya   Sebagai acuan bagi...
Unsur PK GURU• Penilaian kinerja guru adalah penilaian dari tiap  butir kegiatan tugas utama guru dalam rangka  pembinaan ...
PELAKSANAAN PKGuru                      DI SEKOLAH   Penilaian dilakukan oleh kepala sekolah atau wakil    kepala sekolah...
PELAKSANAAN PKGuru        DI SEKOLAH   Hasil penilaian formatif digunakan sebagai    dasar penyusunan profil dan perencan...
DOMAIN KOMPETENSI GURU dalam PK Guru        Pedagogi                        Pedagogi       7 kompetensi                   ...
KOMPONEN PK GURU TUGAS TAMBAHAN               •   Kepribadian dan Sosial                       1               •   Kepemim...
KOMPONEN PK GURU TUGAS TAMBAHAN              •   Merencanakan program perpustakaan              2              •   Melaksa...
KERANGKA PENILAIAN DAN       PENGEMBANGAN KINERJA GURU       Refleksi          Penilaian           Profil                 ...
Perangkat PK Guru      • Pedoman PK GURU mengatur tentang tata cara penilaian dan        norma-norma yang harus ditaati ol...
Mekanisme Penilaian              Pengamatan dan/atau PemantuanBerdasarkan hasil pengamatan dan/atau pemantuan memberikan s...
TAHAP PENILAIAN1. Persiapan penilaian2. Pelaksanaan penilaian   • Pertemuan sebelum masuk kelas   • Pengamatan/observasi d...
KUIS 2Pusat Pengembangan Profesi Pendidik
pertemuan           Setelah         pengamatan                                   Catatan hasil       Pemberian            ...
PERTEMUAN SEBELUM PENGAMATAN• Pertemuan dilakukan di tempat khusus yang  hanya dihadiri oleh guru penilai dan guru yang  d...
SELAMA PENGAMATAN DALAM KELAS• Pengamatan dilakukan pada saat guru yang dinilai  melaksanakan PBM di dalam kelas (2 jam pe...
PERTEMUAN SESUDAH PENGAMATAN• Penilai mengklarifikasi beberapa aspek yang  masih diragukan atau belum diperoleh selama  pe...
JUSTIFIKASI PEMBERIAN NILAI             PER KOMPETENSI                          MEMBANDINGKAN                             ...
SISTEM PELAPORAN                   • Hasil evaluasi diri berupa skor                     kompetensi dan sub kompetensi , d...
Kompetensi 4: Kegiatan Pembelajaran yang MendidikPernyataan kompetensi:Guru menyusun dan melaksanakan rancangan pembelajar...
Proses PenilaianSebelum Pengamatan:Mintalah RPP pada guru dan periksalah RPP tersebut.  1. Tanyakan tentang topik dan kegi...
Laporan dan Evaluasi untuk Kompetensi :....................................................................(Jika ada, lamp...
Selama PengamatanTanggalDokumen/Bahanyang diperiksaCatatan penilai terhadap aktivitas/kegiatan guruTindak lanjut yang dipe...
monitoringTanggalDokumen/Bahanyang diperiksaCatatan penilai terhadap aktivitas/kegiatan guru selama pemantauanTindak lanju...
Penilaian Kompetensi ; .............................................................................................      ...
Penilaian Kompetensi : Mengenal karakteristik peserta didik (Kompetensi 1)                                  Indikator     ...
Nilai per kompetensiNilai total yang diperoleh untuk kompetensi tersebut                                                  ...
NO                                 KOMPETENSI                                  NILAI *)A. Pedagogik  1. Menguasai karakter...
KONVERSI• Karena skala penilaian berbeda, maka diperlukan  konversi hasil penilaian kinerja di lapangan ke skala  penilaia...
KONVERSI NILAI KINERJA                                       Permennegpan & RB No.16/2009                                 ...
KONVERSI NILAI KINERJA  Nilai PKG   Nilai PKG                                           Permennegpan & RB No.16/2009Pembel...
KEBUTUHAN ANGKA KREDIT (Guru Pertama III/b ke Guru Muda III/c)                             Pendidikan                     ...
ANGKA KREDIT AKHIR TAHUN                dari Penilaian KinerjaBagi Guru Pertama Gol III/b dengan predikat:       Amat baik...
FORMAT PENGHITUNGAN ANGKA KREDIT PK GURUKonversi nilai PK GURU (Pembelajaran) ke dalam skala 0 – 100 sesuaiPermenneg PAN &...
Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “amat baik”a. Angka kredit pembelajaran...
Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “baik”a. Angka kredit pembelajaran dala...
Simulasi (untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “cukup”a. Angka kredit pembelajaran da...
Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “cukup”kemungkinan dapat naik pangkat d...
GURU DENGAN TUGAS TAMBAHAN   (Kasek, Wakasek. Ka. Lab, Ka. Perpus, Ka. Bengkel)• Angka kredit kinerja pembelajaran Hasil k...
ANGKA KREDIT          (guru dengan tugas tambahan)• Kepala sekolah = 25% X + 75% Y• Wakil kepala sekolah = 50% X + 50% Y• ...
S A N K S I(pelanggaran terhadap Permenneg PAN & RB No.16/20091. Guru yang tidak dapat memenuhi kewajibannya tugas   utama...
Pusat Pengembangan Profesi Pendidik
Upcoming SlideShare
Loading in...5
×

PK-GURU

2,713

Published on

Gambaran umum PK-Guru

Published in: Education
2 Comments
2 Likes
Statistics
Notes
No Downloads
Views
Total Views
2,713
On Slideshare
0
From Embeds
0
Number of Embeds
0
Actions
Shares
0
Downloads
353
Comments
2
Likes
2
Embeds 0
No embeds

No notes for slide
  • Padaperaturan lama,pengembanganprofesi guru hanyamenekankanpadakaryatulisdankaryainovatifsedangkanpadaperaturanbaruaspeknyaditambahdengankegiatanpengembangandiri.
  • Denganperaturanbaru ( apaperaturannya..?), mulaitahun 2013 guru wajibmembuatpublikasiilmiah/karyainnovatifapabila guru tersebutakannaikpangkatmulaidariIIIbkeIIIcdanjumlah minimal angkakreditdari PKB untukkenaikanpangkatdaritiapjenjangbervariasi (tidakselalusama)Sedangkanpadaperaturan lama, guru baruwajibmenulispublikasiilmih/ karyainovatifapabila guru tsbakanmaikpangkatmulaidari IV a-Ivbdanjumlah minimal angkakredit yang harusdikumpulkanadalah 12.
  • DalamPeraturanbaru, Jenjangjabatandanpangkat guru menjadilebihsederhana
  • - Dalamperaturanbaru, PKB wajibdilakukanmulaidariIIIbkeIIIcdenganjumlahangkakredit yang bervariasi. Makin tinggipangkatdangolongan, makintinggituntutanPKBnya.
  • - Mulaitahun 2013 diharapkansemua guru sudahberijazah SI/ D4- Nilai PK guru akansangatperpengaruhterhadappengembangankarier guru karenaakandikonversikankedalamprosentase yang ditentukan.
  • Dalam PK guru, ke lima ukurankinerjatadidijabarkanmenjadiempat domain (Kepribadian, sosial, pedagogisdanprofesional) dengankompetensi yang harusdikuasai guru (14 kompetensiuntuk guru bidangstudidan 17 kompetensiuntuk guru BK) dengan
  • Tugas guru adalahmerencanakan,melaksanakan, mengevaluasi, membimbingdanmelatihsiswa.Guru tertentujugadapatditugaskanuntukmelaksanakantugastambahanbaik yang konsekwensinyamengurangi jam mengajar (contoh: kepsek, wakasek, kepala lab, kepalaperpustakaandankepala program keahlian) maupun yang konsekwensinyatidakmengurangi jam mengajar (contoh: walikelas, membimbingekskul, dsb)
  • Apabila PK guru dilaksanakandengansemestinya, makaprofesionalisme guru akanmeningkatdansiswaakanmendapatkanpelayananmaksimal.
  • HasilPk guru bisadigunakanuntukketigahalsepertiterterapada slideHasil PK guru formatifdigunakanuntukmerencanakanpengembangan PKBHasil PK guru sumatifdigunakanuntukmenentukanangkakredit yang diperoleh guru dalamtahuntersebut.
  • Pelaksanaantugastambahan lain yang relevandenganfungsisekolahdinilaidenganmenggunakan instrument yangberbedadariinstrumen PK guru.
  • Kepalasekolah yang tidak lulus dalampelatihanpenilaiantidakberhakmelakukanpenilaiandalam PK guru. Kepalasekolahtsbhanyaberhakmenandatanganihasil PK guru disekolahnya
  • Dari PK guru formatifdiperolehinformasitentangkompetensi yang belumdansudahdikuasai guru. Berdasarkaninformasiini, koordinator PKB merencanakan program ‘bantuan’ PKB yang akandiberikanuntukmeningkatkankompetensi guru yang masihdibawahstandar.
  • Ada 4 domain kompetensi yang harusdikuasaiseorang guru. Tetapiada 14 kompetensi yang harusdikuasai guru bidangstudidan 17 kompetensi yangharusdikuasai guru BK.
  • Domainkompetensipedagogikterdiridari 7 kompetensi. Penjelasanuntuktiapkompetensibisadilihatpadainstrumen PK guruKompetensipedagogikadalahkemampuan guru dalammenggunakansemuailmupengetahuandanketerampilan yang dimilikiuntukmenyampaikanmaterikepadapesertadidik.
  • Domain kompetensikepribadianterdiridari 3 kompetensi. Penjelasanlebihrincitentangtiapkompetensidapatdilihatpada instrument PK guru (buku 2)Kompetensikepribadianadalahkompetensi yang dimilikiolehseorang guru sebagaiseorang yang berpendirianteguhdanberwibawa
  • Seorang guru memilikikompetensisosial yang baikapabila guru tsbdapatmenempatkandirisebagaiseorang guru dimanapundiaberadadandapatberkomunikasidenganseluruhwargasekolahmaupunmasyarakat.
  • Ada 5 tugastambahan guru yang dinilaidenganinstrumen yang berbedayaitu: Kepalasekolah, wakilkepalasekolah, kepala lab/bengkel, kepalaperpustakaandankepala program keahlian. Masing-masingtugastambahanmenghendakipemenuhankompetensi yang berbedakompetensisupervisihanyadituntutdariseorang guru dengantugastambahansebagaikepalasekolah
  • - Kelimatugastambahaninidiakuisebagaitugastambahan yang mengurangi jam wajibmengajar.- Kepalasekolahhanyawajibmengajar 6 jam- Wakasekdan 3 tugastambahan lain hanyawajibmengajar 12 jam- Tugastambahan lain tidakdapatdiakuisebagaipengurangan jam mengajartetapidihitungsebagaipenambahanangkakredit
  • FormatifUntuk ………………Sumatifuntuk ……………….Tahap Informal maksudnya……………Tahap Formal maksudnya …………………..Sanksi yang diberikankepada guru yang hasil PK gurunyaterusmenerusrendah (tidakmenunjukkankomitmentuntukberkembang) adalahdikurangi jam mengajarnyasehinggapadaakhirnyaberdampakpadahak guru untukmendapattunjanganprofesi
  • Perangkat PK guru adalahperangkat yang akandigunakandalamproses PK guru danharusdikuasaioleh guru penilai
  • Skormaksimaltiapkompetensiadalah 4
  • Padatahappersiapanpenilaian, guru yang akandinilaidan guru penilaiakanmenyepakatiwaktu yang akandigunakanuntukpelaksanaan PK guru.Pengamatan /observasidikelasbisadilaksanakansecaralangsungdalam 1 kali tatapmukaataulewat video (bilafasilitasmemungkinkanuntukkeperluanverifikasi)Untukmelengkapi data yang diperlukan (kompetensi yang tidakbisateramatidalam KBM), guru penilaidapatmengumpulkan data melaluiwawancaradengansiswa
  • Kegiatanpadapertemuansebelum, selama, dansesudahpengamatandilakukandenganmenggunakaninstrumen PK guru yang telahdisediakanInstrumen PK guru sudahdirancangsedemikianrupasehinggadapatmengumpulkan data yang diperlukanuntukmengukursetiapkompentensi gurunilai PK guru yang diberikanadalahnilai yang sudahmelaluitahappersetujuandari guru yang dinilaidenganmempertimbangkanbukti-bukti yang ada.
  • Berbagaihaldiantaranya ………………….. ?
  • - Selamapengamatandikelas guru penilaitidakdiperkenankanmenginterupsipembelajaran- Bukti yang dikumpulkanpenilaiantugastambahan guru dapatberupa:bukti yang teramati (dokumen, kondisisarpras, foto, produksiswa , dsb)bukti yang tidakteramati (sikapdanprilaku, budayadaniklimsekolah)
  • Aspek yang masihdiragukan (contoh: Apabila guru penilaimemerlukaninformasimengenaiapadanmengapa guru yang dinilaimelakukansesuatu yang tidaksesuaidengan RPP, makapenilaibisamenanyakanhaltsbpadapertemuansesudahmasukkelas)
  • - Guru penilaidiharapkandapatmengumpulkandanmencatatsemuabuktidan data yang diperlukan. - Apabilabukti yang dikumpulkandirasabelumcukup, maka guru penilaidapatmenambahbuktidengancaramengobservasipembelajaranberikutnyasetelahsebelumnyadidapatkesepakatandengan guru yang dinilai.
  • - Polasistempelaporan yang akandilakukanadalahmelaluisistem on line (jikasistemjaringansudahsiap) ataumelaui off line bagi yang belumsiap.Sistem on line diharapkandapatmembantupihakterkaituntukmengetahuipetakompetansi guru disuatusekolah, daerah, provinsi, ataunasional.kedepandiharapkanmelaluisistem on line guru dapatmengetahuitindakan PKB yang sesuaiuntukdirinya
  • kemampuan yang harusdimilikiolehseorang guru untuksetiapkompetensidijelaskandalampernyataankompetensi.Indikatoradalahpenjelasandaripernyataankompetensi yang digunakansebagaipenandabagi guru penilaiuntukmemberikannilaikompetensi
  • Dalaminstrumen PK guru terdapatlembarprosespenilaian yang mengarahkan guru penilaiuntukdapatmengumpulkanbukti yang dibutuhkandalammemberikannilaiuntuktiapkompetensi
  • Format yang digunakan guru penilaidalam PK guru (pertemuansebelumpengamatan)
  • - Format yang digunakanoleh guru penilaidalam PK guru padasaatdansetelahpengamatan.- Guru penilaidapatmenggunakanlembarobservasitambahanapabilalembar yang disediakandirasatidakcukup
  • Format yang digunakanuntukmengumpulkan data dalam monitoringFormat inidiisidenganinformasi, data, danbukti yang diperoleholeh guru penilaidalam monitoring
  • Pada slide inidijelaskanbahwa total skoradalah 3, skormaksimumadalah 4, prosentaseadalah (¾)x 100% = 75 % sehingganilai yang diperolehdarikompetensiiniadalah 3
  • Penjelasantambahandari slide sebelumnya
  • 0 %sampai 25 % = 126 % sampai 50 % = 251 % sampai 75 % = 376 % sampai 100 % = 4
  • Slide iniadalahcontohrekapitulasinilaitiapkompetensi yang diperoleholehseorang guruKompetensi yang masihdibawahstandaradalahkompetensi 2,3,6,9,10, dan 14
  • Nilaitertinggiuntuk PK guru pembelajaranadalah 4 x 14 = 56Nilaitertinggiuntuk guru BK adalah 4 x 17 = 68
  • - Jikanilai PK guru seorang guru pembelajaranadalah 38, makakonversinilaitsbmenurutpermeneg pan adalah (38/56) x 100 = 68 (adapadakolom 61-75) = cukup = 75 %
  • - Jikanilai PK guru seorang guru pembelajaranadalah 49, makadikonversikekolom (76-90) = baik =100% dsb- Jikanilai PK guru seorang guru BK adalah 49, makadikonversikekolom (61-75) = cukup =75% dsb
  • Jikaseorang guru akannaikpangkatdariIIIbkeIIIc,maka guru tsbharusmengumpulkanangkakreditkumulatif (AKK) sebanyak 50.
  • Apabilanilai PK guru tersebutcukup, makaangkakredityang diperolehpadatahuntersebutadalah 7,125.Tatapiapabilanilai PK guru tersebutkategorinyabaik, makaangka yang diperolehpadatahuntersebutadalah 9,50. Dan selanjutnya….
  • Iniadalah format akhirperhitunganangkakredit PK guru yang dilakukanoleh guru penilaisetelahmelaluiseluruhproses PK guru.
  • Contohsimulasiperhitunganangkakredituntukseorang guru yang berkinerjaamatbaik yang akannaikpangkatdariIIIbkeIIIc . Denganmelihathasilsimulasitersebut, makadiketahuibahwa guru tsbtidakbisanaikpangkatdalamwaktu 3 tahun. (masihkurang 3,1).
  • Contohsimulasiperhitunganangkakredituntukseorang guru yang berkinerjabaik yang akannaikpangkatdariIIIbkeIIIc . Denganmelihathasilsimulasitersebut, makadiketahuibahwa guru tsbbisanaikpangkatdalamwaktu 4 tahun. (apabilakinerjanyaterusbaikdanmemenuhiNilai PKB yang ditetapkan).
  • - Contohsimulasiperhitunganangkakredituntukseorang guru yang berkinerjacukup yang akannaikpangkatdariIIIbkeIIIc . Denganmelihathasilsimulasitersebut, makadiketahuibahwa guru tsbtidakdapatnaikpangkatdalamwaktum 4 tahun (guru masihharusmengumpulkan16,5 agar bisasampai 50)
  • Simulasipenghitunganangkakredituntuk guru yang berkinerjacukup yang akannaikpangkatdatiIIIbkeIIIc.Dari simulasitsbdiketahuibahwa guru tsbtidakbisanaikpangkatdalamwaktu 5 tahun
  • Gurudengantugastambahandinilaidenganmenggunakan 2 instrument penilaiankinerja (Contoh: guru dengantugastambahansebagaikepalasekolahdinilaidengan instrument PK guru pembelajarandan instrument penilaiankinerjasebagaikepalasekolah)
  • X = AngkakreditKinerjaPembelajaranY = AngkakreditKinerjaTugasTambahanAngkakredituntuk guru yang diberitugastambahansebagaikepalasekolahdiambil 25% daripembelajarandan 75% daritugastambahansebagaikepalasekolah
  • Sanksi yang diberikankepada guru terkaitpelaksanaan PK guru yang tidakstandar
  • PK-GURU

    1. 1. PENILAIAN KINERJA GURU (Teacher Performance Appraisal)KEMENTERIAN PENDIDIKAN NASIONAL BADAN PENGEMBANGAN SDMP DAN PMPPUSAT PENGEMBANGAN PROFESI PENDIDIK
    2. 2. Semangat Permenegpan dan RBNo.16/2009 Peraturan baru yang terdiri dari 13 Bab dan 47 pasal, secara keseluruhan mengandung semangat yang bertujuan untuk meningkatkan kompetensi dan profesionalisme guru yang selanjutnya akan menjadikan guru sebagai pekerjaan profesional yang dibingkai oleh kaidah- kaidah profesi yang standar.
    3. 3. Semangat Permenegpan dan RB No.16/2009(2) Peraturan ini terbit dalam rangka memberi ruang dan mendukung pelaksanaan tugas dan peran guru agar menjadi guru yang professional. Perubahan peraturan ini diharapkan berimplikasi terhadap peningkatan mutu, kreatifitas dan tentu saja kinerja guru.
    4. 4. Perubahan Mendasar yang Terkandung DalamPermenegpan dan RB No.16/2009 (1) Penilaian Kinerja Guru yang sebelumnya lebih bersifat administratif menjadi lebih berorientasi praktis, kuantitatif, dan kualitatif, sehingga diharapkan para guru akan lebih bersemangat untuk meningkatkan kinerja dan profesionalitasnya. Guru mempunyai empat jabatan fungsional (Guru Pertama, Guru Muda, Guru Madya, Guru Utama)
    5. 5. Perubahan Mendasar yang Terkandung Dalam Permenegpan dan RB No.16/2009 (2) Guru dinilai kinerjanya secara teratur (setiap tahun) melalui Penilaian Kinerja Guru (PK Guru) Guru wajib mengikuti Pengembangan Keprofesian Berkelanjutan (PKB) setiap tahun PKB harus dilaksanakan sejak III/a dengan melakukan pengembangan diri, dan sejak III/b guru wajib melakukan publikasi ilmiah dan/atau karya inovatif Untuk naik dari IV/c ke IV/d guru wajib melakukan presentasi ilmiah
    6. 6. Perubahan Mendasar yang Terkandung Dalam Permenegpan dan RB No.16/2009 (3) Perolehan angka kredit dari PKG dan PKB merupakan satu paket Perlu konversi hasil PKG dan PKB ke angka kredit Perolehan angka kredit setiap tahun ditetapkan oleh Tim Penilai Penghargaan angka kredit adalah 125% (amat baik), 100% (baik), 75% (cukup), 50% (sedang), dan 25%(kurang)
    7. 7. Perubahan Mendasar yang Terkandung Dalam Permenegpan dan RB No.16/2009 (4) Penghargaan angka kredit adalah 125% (amat baik), 100% (baik), 75% (cukup), 50% (sedang), dan 25%(kurang) Jumlah angka kredit diperoleh dari: • Unsur utama (Pendidikan, PK Guru, PKB) ≥ 90% • Unsur penunjang ≤10%
    8. 8. PERBEDAAN UTAMA KEGIATAN PENGEMBANGAN PROFESI ANTARA PERATURAN LAMA DENGAN YANG BARU Peraturan lama Peraturan baru1 Dasar Hukum Kepmenpan nomor : 84/1993 Kepmenegpan dan Reformasi tanggal 24 Desember 1993 Birokrasi Nomor 16 tahun 2009 tentang: Jabatan Fungsional tertanggal 10 Nopember 2009, Guru dan Angka Kreditnya tentang Jabatan Fungsional Guru dan Angka Kreditnya.2 Kegiatan yang dinilai A. Unsur dan Sub Unsur A. Unsur dan Sub Unsur Kegiatan Kegiatan 1. Pendidikan dan Pelatihan 1.Pendidikan dan Pelatihan pendidikan formal dan 2. Proses Belajar Mengajar fungsional 3. Pengembangan Profesi 2. Proses Belajar Mengajar 4. Penunjang 3. Pengembangan Keprofesian Berkelanjutan (PKB) 4. Penunjang (10%)3 Macam 1. Karya Tulis Ilmiah 1. Pengembangan Diri Pengembangan 2. Teknologi Tepatguna 2. Publikasi Ilmiah Profesi Guru 3. Alat Peraga 3. Karya Inovatif 4. Karya Seni Pusat Pengembangan Profesi Pendidik 5. Pengembangan Kurikulum
    9. 9. LANJUTAN…4 Jenis (Tidak ada pada peraturan 1. diklat fungsional Pengembangan lama) 2. kegiatan kolektif guru Diri5 Macam Publikasi 1. KTI hasil penelitian 1. presentasi di forum ilmiah Ilmiah 2. Tinjaun Ilmiah 2. hasil penelitian 3. Tulisan Ilmiah Popoler 3. tinjauan ilmiah 4. Prasaran Ilmiah 4. tulisan ilmiah populer 5. Buku/Modul 5. artikel ilmiah 6. Diktat 6. buku pelajaran 7. Karya Terjemahan 7. modul/diktat 8. buku dalam bidang pendidikan 9. karya terjemahan 10. Buku pedoman guru6 Macam Karya 1. Teknologi Tepatguna 1.menemukan teknologi tepat guna Inovatif 2. Alat Peraga 2.menemukan/menciptakan karya seni 3. Karya Seni 3.membuat/memodifikasi alat pelajaran 4. Pengembangan 4.mengikuti pengembangan Kurikulum penyusunan standar, pedoman, soal dan sejenisnya7 Prasayarat dalam Wajib sebagai syarat Wajib sebagai syarat kenaikan kenaikan kenaikan pangkat/golongan IIIb ke atas dengan golongan pangkat/golongan IVa ke minimal jumlah angka kredit yang atasPusat Pengembangan Profesi Pendidik berdasar jenjang dengan minimal bervariasi jumlah angka kredit 12. pangkat/golongannya.
    10. 10. JENJANG JABATAN DAN PANGKAT GURUPermen Menpan 84/1993 Pernyempurnaan• Jabatan dan Pangkat melekat • Jabatan dan Pangkat terpisah• Jabatan dan Pangkat ada 13, terdiri • Jabatan ada 4 jenjang dimulai dari:dari: • Pertama gol III/a dan III/b1. Guru Pratama, gol. II/a • Muda. gol III/c dan III/d2. Guru Pratama Tingkat I, gol. II/b • Madya gol IV/a, IV/b dan IV/c3. Guru Muda, gol. II/c • Utama, gol IV/d dan IV/e4. Guru Muda Tk I, gol. II/d5. Guru Madya, gol. III/a6. Guru Madya Tk I, gol. III/b7. Guru Dewasa, gol. III/c8. Guru Dewasa Tk I, gol. III/d9. Guru Pembina, gol. IV/a10. Guru Pembina Tk I, gol. IV/b11. Guru Utama Muda, gol. IV/c12. Guru Utama Madya, gol Pengembangan Profesi Pendidik Pusat IV/d13. Guru Utama, gol IV/e
    11. 11. KEWAJIBAN MELAKSANAKAN PENGEMBANGAN KEPROFESIAN BERKELANJUTAN (PKB)PERMEN MENPAN 84/93 PENYEMPURNAAN• gol II/a s.d. IV/a Selain KBM, guru wajib mengikuti kegiatan  Diklat pengembangan keprofesian berkelanjutan  KBM yang terdiri dari pengembangan diri (PD)  Penunjang dan Publikasi Ilmiah dan/atau Karya  Pengembangan Profesi (PP) Inovatif (PI dan/atau KI), dimulai dari: tidak wajib gol III/a PKB: PD = 3 AK• Pengembangan Profesi wajib III/b-c PKB: PD = 3 AK + PI dan/atau KI=4bagi: AK gol IV/a – b = pengembangan III/c-d PKB: PD = 3 AK + PI dan/atau KI=6 profesi 12 dari wajib AK gol IV/b – c = idem III/d-IV/a PKB: PD= 4 AK + PI dan/atau KI=8  gol IV/c – d = idem AK  gol IV/d – e = idem IV/a-b PKB: PD = 4 AK + PI dan/atau KI=12 Pusat Pengembangan Profesi Pendidik AK
    12. 12. Penilaian Pembelajaran PembimbinganPermen Menpan 84/93 PenyempurnaanPenilaian PBM didasarkan pada Penilaian pembelajaran didasarkanaspek kuantitas dengan “surat pada aspek kualitas, kuantitas, waktupernyataan” kepala sekolah telah dan biaya:melakukan PBM • Kriteria amat baik, mendapat angka kredit 125% dari angka kredit yang harus dicapai dalam kegiatan pembelajaran. • Kriteria baik, 100% • Kriteria cukup, 75% • Kriteria sedang, 50% • Kriteria kurang, 25% Ijasah paling rendah SPG /D-II  Ijasah paling rendah Sarjana (S-1)/ Pangkat paling rendah II/a Diploma (D-IV) (Pengatur Muda)  Pangkat paling rendah III/a (Jabatan Pusat Pengembangan Profesi Pendidik
    13. 13. Kinerja GuruSecara umum ukuran kinerja dapat dilihat dari lima hal, yaitu: • Quality of work - kualitas hasil kerja • Promptness - ketepatan waktu menyelesaikan pekerjaan • Initiative – prakarsa dalam menyelesaikan pekerjaan • Capability – kemampuan menyelesaikan pekerjaan • Communication – kemampuan membina kerjasama dengan pihak lain T.R.Mitchell (2008) Pusat Pengembangan Profesi Pendidik
    14. 14. UU Guru dan Dosen No. 14/2005 Pasal 1Kinerja guru dibingkai dalam lingkup beban tugasdan tanggungjawabnya, yaitu:• merencanakan pembelajaran,• melaksanakan pembelajaran• menilai hasil pembelajaran• membimbing dan melatih peserta didik, dan• melaksanakan tugas tambahan yang melekat pada kegiatan pokok sesuai dengan beban kerja Guru Pusat Pengembangan Profesi Pendidik
    15. 15. TUJUAN PK-GURU PKG menjamin bahwa guru melaksanakan pekerjaannya secara profesional PKG menjamin bahwa layanan pendidikan yang diberikan oleh guru adalah berkualitas Pusat Pengembangan Profesi Pendidik
    16. 16. HASIL PK Guru Merupakan bahan evaluasi diri bagi guru untuk mengembangkan potensi dan karirnya Sebagai acuan bagi sekolah untuk merencanakan Pengembangan Keprofesian Berkelanjutan (PKB) Merupakan dasar untuk memberikan nilai prestasi kerja guru dalam rangka pengembangan karir guru sesuai Permennegpan & RB No.16/2009 Pusat Pengembangan Profesi Pendidik
    17. 17. Unsur PK GURU• Penilaian kinerja guru adalah penilaian dari tiap butir kegiatan tugas utama guru dalam rangka pembinaan karier kepangkatan dan jabatannya• Unsur yang dinilai dalam PK Guru adalah – 14 (empat belas) kompetensi untuk guru mata pelajaran/guru kelas. – 17 (tujuh belas) untuk kompetensi guru BK/konselor – pelaksanaan tugas tambahan lain yang relevan dengan fungsi sekolah/madrasah Pusat Pengembangan Profesi Pendidik
    18. 18. PELAKSANAAN PKGuru DI SEKOLAH Penilaian dilakukan oleh kepala sekolah atau wakil kepala sekolah atau guru senior yang kompeten, yang ditunjuk oleh kepala sekolah (yang telah mengikuti pelatihan penilaian) Penilaian dilakukan 2 kali dalam satu tahun (penilaian formatif pada awal tahun dan penilaian sumatif pada akhir tahun) Pusat Pengembangan Profesi Pendidik
    19. 19. PELAKSANAAN PKGuru DI SEKOLAH Hasil penilaian formatif digunakan sebagai dasar penyusunan profil dan perencanaan program PKB/PKR tahunan bagi guru Hasil penilaian sumatif digunakan untuk memberikan nilai prestasi kerja guru (menghitung perolehan angka kredit guru pada tahun tersebut) Pusat Pengembangan Profesi Pendidik
    20. 20. DOMAIN KOMPETENSI GURU dalam PK Guru Pedagogi Pedagogi 7 kompetensi 3 kompetensi Kepribadian Kepribadian 3 kompetensi 4 kompetensi Sosial Sosial 2 kompetensi 3 kompetensi Profesional Profesional 2 kompetensi 7 kompetensi 14 kompetensi 17 kompetensi Guru Pembelajaran Guru BK/Konselor Pusat Pengembangan Profesi Pendidik
    21. 21. KOMPONEN PK GURU TUGAS TAMBAHAN • Kepribadian dan Sosial 1 • Kepemimpinan Kepala • Pengembangan Sekolah/Madrasah Sekolah • Pengelolaan Sumber Daya • Kewirausahaan • Supervisi • Kepribadian dan Sosial Wakil • Kepemimpinan Kepala • Pengembangan Sekolah/Madrasah Sekolah • Kewirausahaan • Bidang Tugas • Kepribadian • Pengelolaan Lingkungan dan P3 Kepala • Sosial laboratori- • Pengorganisasian Guru/Laboran/Teknisium/Bengkel • Pengelolaan dan Administrasi • Pengelolaan Pemantauan dan Evaluasi • Pengembangan dan Inovasi Pusat Pengembangan Profesi Pendidik
    22. 22. KOMPONEN PK GURU TUGAS TAMBAHAN • Merencanakan program perpustakaan 2 • Melaksanakan program perpustakaan • Mengevaluasi program perpustakaan • Kembangkan koleksi perpustakaan • Mengorganisasi layanan jasa informasi perpustakaan Kepala • Menerapkan teknologi informasi dan komunikasiPerpustakan • Mempromosikan perpustakaan & literasi informasi • Mengembangkan kegiatan perpustakaan sebagai sumber belajar kependidikan • Memiliki integritas dan etos kerja • Mengembangkan profesionalitas kepustakawanan • Kepribadian • Sosial • Perencanaan Kepala • Pengelolaan Pembelajaran Program • Pengelolaan Sumber Daya Manusia Keahlian • Pengelolaan Sarama Prasarana • Pengelolaan Keuangan • Evaluasi dan Pelaporan Pendidik Pusat Pengembangan Profesi
    23. 23. KERANGKA PENILAIAN DAN PENGEMBANGAN KINERJA GURU Refleksi Penilaian Profil Rencana dan Formatif Kinerja – penilaian Awal 14 Kompe- PKB per- PKB diri Tahun tensi tahun Berhak Peningkatan untuk kinerja Tahap promosi Informal dan Tahap Formal Berhak (kebutuhan Penilaian Nilai untuk guru) Sumatif Kinerja naikPKB Akhir & Angka pangkat Pengembangan Tahun Kredit Kinerja (Kebutuhan Sanksi sekolah) Pusat Pengembangan Profesi Pendidik
    24. 24. Perangkat PK Guru • Pedoman PK GURU mengatur tentang tata cara penilaian dan norma-norma yang harus ditaati oleh penilai, guru yang dinilai, 1 serta unsur lain yang terlibat dalam proses penilaian • Instrumen penilaian kinerja yang relevan dengan tugas guru (Pembelajaran, Pembimbingan, dan Tugas Tambahan yang relevan dengan fungsi sekolah/madrasah). Instrumen terdiri dari: 2 • (1) Lembar cara menilai, pernyataan kompetensi, & indikator • (2) Format laporan dan evaluasi per kompetensi. • (3) Format rekap hasil PK GURU • (4) Format penghitungan angka kredit PK GURU • Format laporan kendali kinerja guru. Hasil PK Guru untuk masing- masing individu guru (guru pembelajaran, pendampingan, maupun guru yang diberi tugas 3 tambahan yang relevan dengan fungsi sekolah) yang dinilai kemudian direkap dalam format laporan kendali kinerja guru Pusat Pengembangan Profesi Pendidik
    25. 25. Mekanisme Penilaian Pengamatan dan/atau PemantuanBerdasarkan hasil pengamatan dan/atau pemantuan memberikan skor 0, 1, 2 untuk setiap indikator pada kompetensi tertentu Menghitung perolehan total skor per kompetensi dan prosentasenya (total perolehan skor/skor maksimum) x 100 % Konversi prosentase skor ke nilai 1, 2, 3, 4 per kompetensi 0%<X≤25% = 1; 25%<X≤50% = 2; 50%<X≤75% = 3; 75%<X≤100% = 4 Konversi nilai PKG ke skala nilai menurut Permennegpan & RB No.16/2009 Pusat Pengembangan Profesi Pendidik
    26. 26. TAHAP PENILAIAN1. Persiapan penilaian2. Pelaksanaan penilaian • Pertemuan sebelum masuk kelas • Pengamatan/observasi di kelas • Pertemuan setelah masuk kelas • Monitoring data administratif di sekolah, wawancara guru piket dan kepala sekolah3. Analisis hasil observasi/monitoring dengan pembandingan terhadap indikator standar4. Penetapan nilai untuk setiap indikator dalam kompetensi dan kompetensinya Pusat Pengembangan Profesi Pendidik
    27. 27. KUIS 2Pusat Pengembangan Profesi Pendidik
    28. 28. pertemuan Setelah pengamatan Catatan hasil Pemberian Pengamatan Skor 0, 1, 2 Monitoring dan/atau/ indikator selama (studi dokumen, monitoring kinerja Pengamatan wawancara kolega, di atau luar Siswa, orang tua kelas pertemuan sebelum pengamatan pemberian nilai 1,2,3, 4 per sub-kompetensi melalui konversi skor 0, 1, 2 Pedoman PK Guru Instrumen PK Guru Indikator kompetensi Nilai PK Guru Daftar pertanyaan (14 sub-kompetensi) Penilai Laporan/- guru dan penilaiPROSES PK GURU usulan Pusat Pengembangan Profesi Pendidik setuju
    29. 29. PERTEMUAN SEBELUM PENGAMATAN• Pertemuan dilakukan di tempat khusus yang hanya dihadiri oleh guru penilai dan guru yang dinilai (± 30 menit)• Penilai mengumpulkan dokumen pendukung• Penyepakatan waktu penilaian• Diskusi tentang berbagai hal yang tidak mungkin dilakukan pada saat pengamatan Pusat Pengembangan Profesi Pendidik
    30. 30. SELAMA PENGAMATAN DALAM KELAS• Pengamatan dilakukan pada saat guru yang dinilai melaksanakan PBM di dalam kelas (2 jam pelajaran)• Penilai mencatat semua kegiatan yang dilakukan guru dalam proses pembelajaran• Pencatatan dilakukan dalam format laporan dan evaluasi per kompetensi Pusat Pengembangan Profesi Pendidik
    31. 31. PERTEMUAN SESUDAH PENGAMATAN• Penilai mengklarifikasi beberapa aspek yang masih diragukan atau belum diperoleh selama pengamatan• Pertemuan dilakukan di ruang khusus dan hanya dihadiri oleh penilai dan guru yang dinilai (selama ± 30 menit) Pusat Pengembangan Profesi Pendidik
    32. 32. JUSTIFIKASI PEMBERIAN NILAI PER KOMPETENSI MEMBANDINGKAN (SKALA 1 s/d 4) MEMBERI NILAI Catatan hasil Standar kompetensi/observasi/monitoring Indikator kompetensi Nilai PKG (per kompetensi) Pusat Pengembangan Profesi Pendidik
    33. 33. SISTEM PELAPORAN • Hasil evaluasi diri berupa skor kompetensi dan sub kompetensi , dan saran rencanan pengembangan diri guru. • hasil pengamatan asesor berupa skor kompetensi dan perencanaan peningkatan • Pelaporan • hasil pengamatan kualitatif asesor dan skor kompetensi dalam bentuk bukti- bukti tertulis Pusat Pengembangan Profesi Pendidik
    34. 34. Kompetensi 4: Kegiatan Pembelajaran yang MendidikPernyataan kompetensi:Guru menyusun dan melaksanakan rancangan pembelajaran yang mendidiksecara lengkap. Guru melaksanakan kegiatan pembelajaran yang sesuaidengan kebutuhan peserta didik. Guru menyusun dan menggunakanberbagai mata pembelajaran dan sumber belajar sesuai dengan karakteristikpeserta didik. Jika relevan, guru memanfaatkan teknologi informasikomunikasi (TIK) untuk kepentingan pembelajaran. INDIKATOR1. Guru melaksanakan aktivitas pembelajaran sesuai dengan rancangan yang telah disusun secara lengkap dan pelaksanaan aktivitas tersebut mengindikasikan bahwa guru mengerti tentang tujuannya.2. Guru melaksanakan aktivitas pembelajaran yang bertujuan untuk membantu proses belajar peserta didik, bukan untuk menguji sehingga membuat peserta didik merasa tertekan.3. Guru mengkomunikasikan informasi baru (misalnya materi tambahan) sesuai dengan usia dan tingkat kemampuan belajar peserta didik.4. dsb.
    35. 35. Proses PenilaianSebelum Pengamatan:Mintalah RPP pada guru dan periksalah RPP tersebut. 1. Tanyakan tentang topik dan kegiatan pembelajaran yang akan dilakukan. Tanyakan apakah kemungkinan akan ada kesulitan dalam membahas topik tersebut untuk mencapai tujuan yang ditetapkan. 2. dsb.Selama Pengamatan:1. Amati apakah guru menyesuaikan kemampuan peserta untuk berkonsentrasi dalam menerima pelajaran sesuai dengan tingkat perkembangannya2. Amati apakah semua kegiatan yang dilaksanakan dalam pembelajaran dapat membantu peserta didik untuk mencapai tujuan pembelajaran3. dsb.Setelah pengamatan:Mintalah guru untuk menjelaskan seberapa jauh tingkat keberhasilan dalam pembelajaran yang dilaksanakan, dan mengidentifikasikan bagian apa yang perlu diperbaiki.Pemantauan: - Pusat Pengembangan Profesi Pendidik
    36. 36. Laporan dan Evaluasi untuk Kompetensi :....................................................................(Jika ada, lampirkan dokumen/bukti tambahan sebagai pendukung)Nama Guru :..............................................................................................................Nama Penilai :.............................................................................................................. Sebelum Pengamatan Tanggal Dokumen/Bahan yang diperiksa Catatan tanggapan penilai terhadap dokumen/bahan yang diperiksa dan tanggapan/jawaban guru terhadap pertanyaan penilai Tindak lanjut yang diperlukan Pusat Pengembangan Profesi Pendidik
    37. 37. Selama PengamatanTanggalDokumen/Bahanyang diperiksaCatatan penilai terhadap aktivitas/kegiatan guruTindak lanjut yang diperlukanSetelah PengamatanTanggalDokumen/Bahanyang diperiksaCatatan penilai terhadap dokumen/bahan yang diperiksa dan tanggapan/jawaban guru terhadap pertanyaanyang diajukan oleh penilaiTindak lanjut yang diperlukan Pusat Pengembangan Profesi Pendidik
    38. 38. monitoringTanggalDokumen/Bahanyang diperiksaCatatan penilai terhadap aktivitas/kegiatan guru selama pemantauanTindak lanjut yang diperlukan Pusat Pengembangan Profesi Pendidik
    39. 39. Penilaian Kompetensi ; ............................................................................................. Tidak Sebagian Seluruhny Indikator terpenuhi terpenuhi a terpenuhi1. Guru melaksanakan aktivitas pembelajaran sesuai dengan rancangan yang telah disusun secara lengkap dan pelaksanaan aktivitas tersebut 0 1 2 mengindikasikan bahwa guru mengerti tentang tujuannya.2. Guru melaksanakan aktivitas pembelajaran yang bertujuan untuk 0 1 2 membantu proses belajar peserta didik, bukan untuk menguji sehingga membuat peserta didik merasa tertekan.3. dsb.Total skorSkor Maksimum (banyaknya indikator x 2)Persentase (total skor/skor maksimum x100%)Nilai (0 % < X ≤ 25 % = 1; 25 % <XPengembangan Profesi Pendidik Pusat ≤ 50 % =
    40. 40. Penilaian Kompetensi : Mengenal karakteristik peserta didik (Kompetensi 1) Indikator Skor1. Guru dapat mengidentifikasi karakteristik belajar setiap peserta didik di 0 1 2 kelasnya.2. Guru memastikan bahwa semua peserta didik mendapatkan 0 1 2 kesempatan yang sama untuk berpartisipasi aktif dalam kegiatan pembelajaran.3. Guru dapat mengatur kelas untuk memberikan kesempatan belajar yang 0 1 2 sama pada semua peserta didik dengan kelainan fisik dan kemampuan belajar yang berbeda.4. Guru mencoba mengetahui penyebab penyimpangan perilaku peserta 0 1 2 didik untuk mencegah agar perilaku tersebut tidak merugikan peserta didik lainnya.5. Guru membantu mengembangkan potensi dan mengatasi kekurangan 0 1 2 peserta didik.6. Guru memperhatikan peserta didik dengan kelemahan fisik tertentu agar 0 1 2 dapat mengikuti aktivitas pembelajaran, sehingga peserta didik tersebut tidak termarginalkan (tersisihkan, diolok-olok, minder, dsb.).Total skor yang diperoleh 1+2+2+0+0+2=7Skor Maksimum Kompetensi =banyaknya indikator x skor tertinggi 6 x 2 = 12Prosentase skor kompetensi = total skor yang diperoleh dibagi dengan Skor 7/12 x 100% = 58.33%Maksimum Kompetensi dikalikan dengan 100%Konversi Nilai Kompetensi (0 % < X ≤ 25 % = 1; 25 % <X ≤ 50 % = 2; 58.33% berada pada range50 % < X ≤ 75 % = 3; dan 75 % < X ≤ 100 % = 4) 50 % < X ≤ 75 %, jadi Pusat Pengembangan Profesi Pendidik kompetensi 1 ini nilainya 3
    41. 41. Nilai per kompetensiNilai total yang diperoleh untuk kompetensi tersebut X 100% Nilai tertinggi untuk kompetensi tersebut 0% < X ≤ 25% = 1 25% <X ≤ 50% = 2 50% < X ≤ 75% = 3 75% < X ≤ 100% = 4 Pusat Pengembangan Profesi Pendidik
    42. 42. NO KOMPETENSI NILAI *)A. Pedagogik 1. Menguasai karakteristik peserta didik 3 2. Menguasai teori belajar dan prinsip-prinsip pembelajaran yang mendidik 2 3. Pengembangan kurikulum 2 4. Kegiatan pembelajaran yang mendidik 4 5. Pengembangan potensi peserta didik 3 6. Komunikasi dengan peserta didik 2 7. Penilaian dan evaluasi 3B. Kepribadian Bertindak sesuai dengan norma agama, hukum, sosial dan kebudayaan 8. 3 nasional 9. Menunjukkan pribadi yang dewasa dan teladan 2 10. Etos kerja, tanggung jawab yang tinggi, rasa bangga menjadi guru 1C. Sosial 11. Bersikap inklusif, bertindak obyektif, serta tidak diskriminatif 4 Komunikasi dengan sesama guru, tenaga kependidikan, orang tua, peserta 12. 3 didik, dan masyarakatD. Profesional Penguasaan materi, struktur, konsep dan pola pikir keilmuan yang 13. 4 mendukung mata pelajaran yang diampu 14. Mengembangkan keprofesionalan melalui tindakan yang reflektif 2Jumlah (Hasil penilaian kinerja guru) Pengembangan Profesi Pendidik Pusat 38
    43. 43. KONVERSI• Karena skala penilaian berbeda, maka diperlukan konversi hasil penilaian kinerja di lapangan ke skala penilaian menurut Permenegpan No.16/2009• Konversi PK Guru ke skala nilai 0-100 sesuai Permenegpan No16/2009 menggunakan formula matematika : Nilai PKG Nilai PKG (100) = ---------------------------- x 100 Nilai PKG Tertinggi - Nilai PKG tertinggi = 56 (guru pembelajaran) dan 68 (guru bimbingan) Pusat Pengembangan Profesi Pendidik
    44. 44. KONVERSI NILAI KINERJA Permennegpan & RB No.16/2009 Amat 91  100 125% baik 76  90 Baik 100%Untuk nilai PK =38,maka, 61  75 Cukup 75%Nilai PK (skala 100)= 38/56 x 100 = 68 51  60 Sedang 50% ≤50 Kurang 25% Pusat Pengembangan Profesi Pendidik dari jumlah angka kredit yang dibutuhkan per
    45. 45. KONVERSI NILAI KINERJA Nilai PKG Nilai PKG Permennegpan & RB No.16/2009Pembelajaran BK/Konselor Amat 51  56 62  68 91  100 125% baik 42  50 52  61 76  90 Baik 100% 34  41 41  51 61  75 Cukup 75% 28  33 34  40 51  60 Sedang 50% ≤27 ≤33 ≤50 Kurang 25% Pusat Pengembangan Profesi Pendidik dari jumlah angka kredit yang dibutuhkan per
    46. 46. KEBUTUHAN ANGKA KREDIT (Guru Pertama III/b ke Guru Muda III/c) Pendidikan Penilaian Kegiatan Pembelajaran 38 kinerja Unsur dan Tugas Tambahan utama 45 Publikasi/ ≥90% 450 karya inovatif PKB Wajib Pengembangan diri 3 Unsur penunjang 5 Optional ≤10% Pusat Pengembangan Profesi Pendidik
    47. 47. ANGKA KREDIT AKHIR TAHUN dari Penilaian KinerjaBagi Guru Pertama Gol III/b dengan predikat: Amat baik {38 (24/24) 125%}/4 11,675 Baik {38 (24/24) 100%}/4 9,5038 Cukup {38 (24/24) 75%}/4 7,125 Sedang {38 (24/24) 50%}/4 4,75 Kurang {38 (24/24) 25%}/4 2,375 Pusat Pengembangan Profesi Pendidik
    48. 48. FORMAT PENGHITUNGAN ANGKA KREDIT PK GURUKonversi nilai PK GURU (Pembelajaran) ke dalam skala 0 – 100 sesuaiPermenneg PAN & RB No. 16 Tahun 2009 dengan menggunakan rumus; Nilai PK GURU 68 Nilai PK GURU (100)   100 Nilai PK GURU tertinggiBerdasarkan hasil konversi ke dalam skala nilai sesuai dengan peraturantersebut, selanjutnya ditetapkan sebutan dan prosentase angka kreditnya CukupPerolehan angka kredit (pembelajaran) yang dihitung berdasarkan rumusAngka Kredit per tahun = (AKK – AKPKB – AKP) x (JM/JWM) x NPK 4 7,125 {38 (24/24) 75%}/4 ………………………………….., ……………….. Guru yang dinilai Penilai Kepala Sekolah (…………………………) (……………………………) (………………………………) Pusat Pengembangan Profesi Pendidik
    49. 49. Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “amat baik”a. Angka kredit pembelajaran dalam 3 tahun = 3 x 11,675 = 34,9b. Angka kredit dari publikasi/karya inovatif dalam 3 tahun = 4c. Angka kredit pengembangan diri dalam 3 tahun = 3d. Angka kredit dari unsur penunjang dalam 3 tahun = 5 Total angka kredit dalam 3 tahun = 34,9 + 4 + 3 + 5 = 46,9 Pusat Pengembangan Profesi Pendidik
    50. 50. Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “baik”a. Angka kredit pembelajaran dalam 4 tahun = 4 x 9,50 = 38b. Angka kredit dari publikasi/karya inovatif dalam 4 tahun = 4c. Angka kredit pengembangan diri dalam 4 tahun = 3d. Angka kredit dari unsur penunjang dalam 4 tahun = 5 Total angka kredit dalam 4 tahun = 38 + 4 + 3 + 5 = 50 Pusat Pengembangan Profesi Pendidik
    51. 51. Simulasi (untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “cukup”a. Angka kredit pembelajaran dalam 4 tahun = 4 x 7,125 = 28.5b. Angka kredit dari publikasi/karya inovatif dalam 4 tahun = 4c. Angka kredit pengembangan diri dalam 4 tahun = 3d. Angka kredit dari unsur penunjang = 5 Total angka kredit 4 tahun = 28,5 + 4 + 3 + 5 = 40,5 Pusat Pengembangan Profesi Pendidik
    52. 52. Simulasi(untuk kenaikan pangkat Guru Muda dari III/b ke III/c)Bila guru berkinerja “cukup”kemungkinan dapat naik pangkat dalam 5 tahuna. Angka kredit pembelajaran dalam 5 tahun = 5 x 7,125 = 35,615b. Angka kredit dari publikasi/karya inovatif dalam 5 tahun = 4c. Angka kredit pengembangan diri dalam 5 tahun = 3d. Angka kredit dari unsur penunjang dalam 5 tahun = 5 Total angka kredit 5 tahun = 35,615 + 4 + 3 + 5 = 47,615 Pusat Pengembangan Profesi Pendidik
    53. 53. GURU DENGAN TUGAS TAMBAHAN (Kasek, Wakasek. Ka. Lab, Ka. Perpus, Ka. Bengkel)• Angka kredit kinerja pembelajaran Hasil konversi kinerja pembelajaran ke angka kredit menurut skala Permenegpan & RB 16/2009 =X• Angka kredit kinerja tugas tambahan (dinilai dengan instrumen khusus) =Y Pusat Pengembangan Profesi Pendidik
    54. 54. ANGKA KREDIT (guru dengan tugas tambahan)• Kepala sekolah = 25% X + 75% Y• Wakil kepala sekolah = 50% X + 50% Y• Kepala laboratorium = 50% X + 50% Y• Kepala perpustakaan = 50% X + 50% Y• Kepala bengkel = 50% X + 50% Y Pusat Pengembangan Profesi Pendidik
    55. 55. S A N K S I(pelanggaran terhadap Permenneg PAN & RB No.16/20091. Guru yang tidak dapat memenuhi kewajibannya tugas utama, beban mengajar (24 – 40 jam tatap muka atau membimbing 150 – 250 konseli), dan tidak mendapat pengecualian dari Menteri Pendidikan Nasional, dihilangkan haknya untuk mendapat tunjangan profesi, tunjangan fungsional, dan maslahat tambahan.2. Guru yang terbukti memperoleh penetapan angka kredit (PAK) dengan cara melawan hukum diberhentikan sebagai Guru dan wajib mengembalikan seluruh tunjangan profesi, tunjangan fungsional, dan penghargaan sebagai Guru yang pernah diterima setelah yang bersangkutan memperoleh dan mempergunakan penetapan angka kredit (PAK) tersebut.3. Pengaturan sanksi lebih lanjut diatur dalam Peraturan Menteri PendidikanPusat Pengembangan Profesi Pendidik Nasional.
    56. 56. Pusat Pengembangan Profesi Pendidik
    1. A particular slide catching your eye?

      Clipping is a handy way to collect important slides you want to go back to later.

    ×