This study examined the mechanisms by which HIV-1 clade C escapes neutralization by broadly neutralizing antibodies targeting the N332 glycan site in the envelope protein. The researchers found plasma from an Indian patient that broadly neutralized a panel of HIV strains, and mapped the specificity of these antibodies to the N332 site. When they tested envelope proteins from autologous viruses from the same patient, they found resistance to neutralization despite intact N332 sites. They identified three distinct mechanisms of escape - a mutation replacing N332, longer variable loop 1 lengths hindering antibody access, and additional protective glycans. This highlights how HIV can evolve to evade antibodies targeting a key vulnerability like the N332 site.
Deshpande S et al RETROVIROLOGY_b 2016SHILPA PATIL
1) The study examined the basis for resistance of HIV-1 clade C envelopes (Envs) from an Indian individual to broadly cross-neutralizing autologous plasma antibodies and monoclonal antibodies (mAbs) like PGT121 and PGT128 that target the N332 glycan site.
2) While one Env was resistant due to a N332S mutation, resistance of other Envs was associated with a longer V1 loop length and additional glycans that hindered antibody access to the N332 site.
3) The results show that HIV-1 clade C can escape broadly neutralizing antibodies through distinct mechanisms including mutation, longer variable loops, and added glycans.
This document discusses the development of vaccines for SARS-CoV. It notes that while an inactivated SARS-CoV vaccine may be first available, safety is a major concern. The spike protein of SARS-CoV induces neutralizing antibodies and the receptor-binding domain contains neutralizing epitopes, suggesting vaccines based on these could be safe and effective. Current vaccine approaches discussed include inactivated SARS-CoV vaccines, vaccines using the full-length spike protein, and those using fragments of the spike protein containing neutralizing epitopes.
This study investigated the role of the luxS gene in Borrelia burgdorferi, the bacterium that causes Lyme disease. The researchers found that:
1) B. burgdorferi expresses the luxS gene at comparable levels both in vitro and when infecting rats, but did not detect autoinducer-2 activity, which is produced by the luxS gene product.
2) A luxS mutant strain of B. burgdorferi was still able to infect mice at the same level as the wild type strain when inoculated via needle, indicating luxS is not required for infectivity.
3) These findings challenge the idea that B. burgdorferi uses a
This document summarizes research into developing an anti-HIV vaccine using nucleoside-modified mRNA encoding envelope proteins. Key points:
- Researchers developed mRNA vaccines optimized for protein expression by incorporating modified nucleosides, UTRs, caps, and tails to generate HIV envelope proteins.
- Mice were primed with intradermal mRNA followed by an intramuscular protein boost to achieve strong T cell and B cell responses.
- The mRNA vaccine induced high levels of IFN-γ, TNF-α, IL-2 in antigen-specific T cells and antibody titers, demonstrating the potential of nucleoside-modified mRNA vaccines for infectious diseases like HIV.
This study investigated an outbreak of neonatal sepsis in a neonatal intensive care unit attributed to coagulase-negative staphylococci (CoNS). The aims were to assess the association between intravenous catheters and CoNS sepsis, identify persistent CoNS strains, and determine antibiotic resistance patterns. Random amplified polymorphic DNA (RAPD) analysis identified two main clusters of CoNS isolates, with some strains showing similarity over 88%, suggesting persistence. Staphylococcus capitis was the most prevalent pathogen, infecting 80% of patients and showing multi-drug resistance. The results support that CoNS are a significant cause of neonatal intensive care unit sepsis, can infect via intravenous catheters, and persistent strains may cir
This study used computer-based immunoinformatic analysis and the 3D structure of the SARS-CoV-2 spike protein to predict potential B-cell and T-cell epitopes for vaccine design. Nine conserved linear B-cell epitopes and multiple discontinuous B-cell epitopes composed of 69 surface residues were predicted. 62 T-cell epitopes were also predicted. Two mutations in a critical neutralizing epitope of SARS-CoV-2 may enable immune evasion. These predicted epitopes could inform peptide-driven vaccine design and serological diagnosis against COVID-19.
This study examined the mechanisms by which HIV-1 clade C escapes neutralization by broadly neutralizing antibodies targeting the N332 glycan site in the envelope protein. The researchers found plasma from an Indian patient that broadly neutralized a panel of HIV strains, and mapped the specificity of these antibodies to the N332 site. When they tested envelope proteins from autologous viruses from the same patient, they found resistance to neutralization despite intact N332 sites. They identified three distinct mechanisms of escape - a mutation replacing N332, longer variable loop 1 lengths hindering antibody access, and additional protective glycans. This highlights how HIV can evolve to evade antibodies targeting a key vulnerability like the N332 site.
Deshpande S et al RETROVIROLOGY_b 2016SHILPA PATIL
1) The study examined the basis for resistance of HIV-1 clade C envelopes (Envs) from an Indian individual to broadly cross-neutralizing autologous plasma antibodies and monoclonal antibodies (mAbs) like PGT121 and PGT128 that target the N332 glycan site.
2) While one Env was resistant due to a N332S mutation, resistance of other Envs was associated with a longer V1 loop length and additional glycans that hindered antibody access to the N332 site.
3) The results show that HIV-1 clade C can escape broadly neutralizing antibodies through distinct mechanisms including mutation, longer variable loops, and added glycans.
This document discusses the development of vaccines for SARS-CoV. It notes that while an inactivated SARS-CoV vaccine may be first available, safety is a major concern. The spike protein of SARS-CoV induces neutralizing antibodies and the receptor-binding domain contains neutralizing epitopes, suggesting vaccines based on these could be safe and effective. Current vaccine approaches discussed include inactivated SARS-CoV vaccines, vaccines using the full-length spike protein, and those using fragments of the spike protein containing neutralizing epitopes.
This study investigated the role of the luxS gene in Borrelia burgdorferi, the bacterium that causes Lyme disease. The researchers found that:
1) B. burgdorferi expresses the luxS gene at comparable levels both in vitro and when infecting rats, but did not detect autoinducer-2 activity, which is produced by the luxS gene product.
2) A luxS mutant strain of B. burgdorferi was still able to infect mice at the same level as the wild type strain when inoculated via needle, indicating luxS is not required for infectivity.
3) These findings challenge the idea that B. burgdorferi uses a
This document summarizes research into developing an anti-HIV vaccine using nucleoside-modified mRNA encoding envelope proteins. Key points:
- Researchers developed mRNA vaccines optimized for protein expression by incorporating modified nucleosides, UTRs, caps, and tails to generate HIV envelope proteins.
- Mice were primed with intradermal mRNA followed by an intramuscular protein boost to achieve strong T cell and B cell responses.
- The mRNA vaccine induced high levels of IFN-γ, TNF-α, IL-2 in antigen-specific T cells and antibody titers, demonstrating the potential of nucleoside-modified mRNA vaccines for infectious diseases like HIV.
This study investigated an outbreak of neonatal sepsis in a neonatal intensive care unit attributed to coagulase-negative staphylococci (CoNS). The aims were to assess the association between intravenous catheters and CoNS sepsis, identify persistent CoNS strains, and determine antibiotic resistance patterns. Random amplified polymorphic DNA (RAPD) analysis identified two main clusters of CoNS isolates, with some strains showing similarity over 88%, suggesting persistence. Staphylococcus capitis was the most prevalent pathogen, infecting 80% of patients and showing multi-drug resistance. The results support that CoNS are a significant cause of neonatal intensive care unit sepsis, can infect via intravenous catheters, and persistent strains may cir
This study used computer-based immunoinformatic analysis and the 3D structure of the SARS-CoV-2 spike protein to predict potential B-cell and T-cell epitopes for vaccine design. Nine conserved linear B-cell epitopes and multiple discontinuous B-cell epitopes composed of 69 surface residues were predicted. 62 T-cell epitopes were also predicted. Two mutations in a critical neutralizing epitope of SARS-CoV-2 may enable immune evasion. These predicted epitopes could inform peptide-driven vaccine design and serological diagnosis against COVID-19.
This study aimed to investigate the bactericidal potential of Mycobacterium tuberculosis targets under various in vivo simulated in vitro conditions and in vivo in mice. Using antisense RNA to inhibit five target genes, the study evaluated target cidality under six physiological conditions in vitro and in vivo. It identified aroK, which encodes shikimate kinase, as an in vivo bactericidal target based on correlations between in vitro and in vivo cidality data. The study suggests that the low pH in vitro model best predicts in vivo cidality and identifies targets with potential for anti-tuberculosis drug development.
El ARN del SARS-CoV-2 de transcripción inversa puede integrarse en el genoma de células humanas cultivadas y puede ser expresado en tejidos derivados del paciente
Proceedings of National Academy of SciencesPNAS is a partner of CHORUS, COPE, CrossRef, ORCID, and Research4Life.
This document describes research on developing an improved inhibitor for the main protease (Mpro) of SARS-CoV-2, the virus that causes COVID-19. Key points:
- Researchers determined the crystal structure of SARS-CoV-2 Mpro and its complex with an α-ketoamide inhibitor derived from a previous broad-spectrum inhibitor.
- They modified the inhibitor by incorporating the P3-P2 amide bond into a pyridone ring to increase its half-life in plasma. Testing showed this improved solubility and pharmacokinetic properties.
- Further modification replacing the P2 group led to a more potent inhibitor of SARS-CoV-2 Mpro. X-ray crystal structures
T cell recall response of two hypothetical proteins (Rv2251 and Rv2721c) from...Santhi Devasundaram
The demonstrated variable efficacy of the only licensed TB vaccine Mycobacterium
bovis bacillus CalmetteeGue´rin (M. bovis BCG) encourages the need for new vaccine candidates
against TB. Antigen specific cellular immune response is often considered imperative
during Mycobacterium tuberculosis (M. tuberculosis) infection and antigens that are strongly
associated with the latent phase of infection are drawing increasing attention for anti-TB vaccine
development. Here, we investigated the phenotypic and functional profiles of two novel
mycobacterial antigens Rv2251 and Rv2721c during T cell recall response via multi-color flow
cytometry.
Evolutionary origins of the SARS-CoV-2 sarbecovirus lineage responsible for t...Guy Boulianne
This document analyzes the evolutionary history of SARS-CoV-2, the virus that causes COVID-19, using genomic data from related sarbecoviruses found in bats. The key points are:
- Sarbecoviruses undergo frequent recombination, exhibiting spatially structured genetic diversity in China. SARS-CoV-2 itself shows no evidence of being a recombinant of known sarbecoviruses.
- Bayesian analyses estimate the most recent common ancestor of SARS-CoV-2 and its closest known relative, RaTG13, existed between 1948-2009, indicating the lineage has been circulating unnoticed in bats for decades.
- While pangolins or other species may have facilitated transmission to
SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination I...Guy Boulianne
This document summarizes a research study that investigated how the SARS-CoV-2 spike protein affects DNA damage repair and adaptive immunity. The main findings are:
1) The SARS-CoV-2 spike protein significantly inhibited DNA damage repair in in vitro cell line experiments by impeding the recruitment of key DNA repair proteins like BRCA1 and 53BP1 to damage sites.
2) DNA damage repair is required for effective V(D)J recombination, which generates antibody diversity in B cells and T cell receptors in T cells. Inhibiting DNA damage repair could therefore impair adaptive immunity.
3) The spike protein was found to localize in the cell nucleus, where it could interfere with DNA repair
This document discusses serological approaches for detecting COVID-19 through immune-based detection of antibodies. It provides an overview of the SARS-CoV-2 virus, current diagnostic methods including RT-PCR and immunoassays, considerations around specificity and sensitivity of different viral targets for immunoassays, applications of immunoassays for surveillance and developing treatments, and the need for point-of-care tests. Moving forward, it emphasizes that collating immunoassay data and developing rapid decentralized tests can help address testing shortages, while ensuring rigorous evaluation of new tests.
Homeopathic Dilutions of Mercury Chloride as an Effective and Affordable Trea...semualkaira
A novel human coronavirus that is now named severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) (formerly called
HCoV-19) emerged in Wuhan,China, in late 2019 and is now causing a pandemic [1]. The epidemic of SARS-CoV wassuccessfully
contained through public health interventions, including case detection and isolation. Transmission of SARS-CoV occurred mainly
after days of illness
The COVID-19 pandemic is driving the need for rapid development of effective vaccines and therapies. Developing an effective vaccine requires an understanding of the adaptive immune response to SARS-CoV-2. An assay to measure circulating antibodies, specifically neutralizing antibodies (NAbs) that disrupt receptor-binding domain (RBD) and angiotensin-converting enzyme 2 (ACE2) binding to prevent SARS-COV-2 cell entry is an important research tool.
ImmunoRank is a high-throughput surrogate assay that semi-quantitative detects and ranks circulating SARS-CoV-2 neutralizing antibodies of all Ig classes (total antibody) in human plasma or serum. Highly correlated to FRNT or PRNT live virus tests, but is less laborious, takes only 80 minutes to complete, and does not require a BSL3 laboratory.
This document describes engineering Mycobacterium smegmatis to produce polyhydroxyalkanoate (PHA) beads displaying mycobacterial antigens for use as a tuberculosis vaccine. M. smegmatis was engineered to express three enzymes involved in PHA production and a fusion protein linking PHA synthase to the TB antigens Ag85A and ESAT-6. This resulted in PHA beads displaying the antigens on their surface. Mice were vaccinated with the engineered PHA beads and they induced a cellular immune response against the mycobacterial antigens, demonstrating their potential as a TB vaccine.
The Thiazolobenzimidazole TBZE-029 Inhibits Enterovirus Replication by Target...degarden
This document summarizes research identifying the viral target of the antiviral compound TBZE-029 against enteroviruses. Through selecting for drug-resistant coxsackievirus B3, the researchers identified three mutations in the nonstructural protein 2C clustered near motif C. Reintroducing the mutations, particularly at positions 227 and 229, conferred drug resistance, demonstrating 2C as the target. Viruses with the mutations also showed cross-resistance to other known 2C-targeting antivirals. The ATPase activity of 2C was unaffected by TBZE-029, suggesting it targets a different function of this essential replication protein.
This study validated the peroxisome targeting of two pathogen defense proteins in Arabidopsis thaliana, disease resistance protein 1 (DRP1) and nudix hydrolase homologue 15 (NUDT15), which were predicted to have peroxisome targeting signals (PTS). Experiments showed that an alternative splice variant of DRP1 (DRP1.2) localized to peroxisomes due to a functional PTS1 domain, while another variant (DRP1.1) remained cytosolic. Similarly, a splice variant of NUDT15 (NUDT15.2) was targeted to peroxisomes by its PTS1, but another variant (NUDT15.1) was
Immunobiology Abstract and Figure writing instructions.pdfstudy help
- The document provides instructions for two assignments related to a scientific paper on SARS-CoV-2 immunity. The first assignment is to write a description of the results presented in Figure 2 Panels A through D of the attached paper. The second assignment is to write an abstract summarizing the problem, methods, results, and conclusions of the attached paper. Links are provided to guide writing the abstract and results sections.
Immunobiology Abstract and Figure writing instructions.pdfstudy help
- The document provides instructions for two assignments related to a scientific paper on SARS-CoV-2 immunity. The first assignment is to write a description of the results presented in Figure 2 Panels A through D of the attached paper. The second assignment is to write an abstract summarizing the problem, methods, results, and conclusions of the attached paper. Links are provided to guide writing the abstract and results sections.
A SARS-like cluster of circulating bat coronaviruses shows potential for huma...Guy Boulianne
This study examines the potential risk of SARS-like viruses emerging from bat populations in China. Researchers generated a chimeric virus containing the spike protein of a bat coronavirus (SHC014-CoV) in a mouse-adapted SARS-CoV backbone. They found that this chimeric virus was able to efficiently infect human airway cells and cause disease in mice. Current SARS treatments like monoclonal antibodies were ineffective at neutralizing the chimeric virus. This suggests SARS-like viruses currently circulating in bats may pose a future risk of transmission to humans.
This document summarizes a study examining the genetic attributes associated with the exceptional sensitivity of an HIV-1 clade C envelope protein to autologous broadly neutralizing plasma antibodies. The researchers identified an envelope that was significantly more sensitive to neutralization by contemporaneous plasma than two other envelopes. Sequence analysis found mutations in the V3/C3 region of the sensitive envelope. Chimeric envelope experiments determined that replacing the V3/C3 region of a resistant envelope with the sensitive envelope conferred enhanced neutralization sensitivity, indicating this region plays a role in exposure of epitopes targeted by plasma antibodies. Fine mapping identified a proline to isoleucine substitution at position 326 in the V3 loop that modulated neutralization susceptibility.
This study examined the genetic attributes associated with the enhanced sensitivity of an HIV-1 clade C envelope protein (HVTR-PG80v2.eJ7) to autologous broadly neutralizing plasma antibodies from an elite neutralizer. The researchers found that mutations in the V3/C3 region of the envelope protein were associated with its increased sensitivity to neutralization by autologous plasma antibodies. Depletion experiments showed that these mutations altered the envelope conformation to better expose epitopes targeted by both neutralizing and non-neutralizing antibodies in the plasma. Therefore, distinct vulnerabilities associated with antibody evasion could be linked to mutations in the V3/C3 region of the HIV envelope.
This document summarizes the selection and characterization of recombinant clones from a Mycobacterium leprae expression library screened with sera from household contacts of leprosy patients. Twelve recombinant clones were selected that reacted with antibodies in the contact sera. These antigens recognized by contact sera differed from those recognized by monoclonal antibodies and were not identical to known M. leprae antigens. Two groups of antigens were identified: one recognized by all contact sera, and one recognized by only some contact sera. These antigens may be relevant to early immune responses during M. leprae infection.
This document describes a study comparing different recombinase systems and cis-acting elements for prolonging baculovirus-mediated transgene expression. The researchers developed a binary baculovirus system using Cre, FLPo, or C31o recombinase to excise the transgene and form extrachromosomal minicircles. Cre and FLPo achieved high recombination efficiencies of 90-95% compared to 40-75% for C31o. The addition of oriP/EBNA1 to maintain episomal minicircles prolonged transgene expression for 30 days without integration. This system enhanced and prolonged growth factor expression in human adipose-derived stem cells and improved their osteogenesis potential.
La empresa de estudios de mercado Ipsos lanzó su informe mensual “Preocupaciones del Mundo”, que estudia la percepción sobre los temas que generan mayor inquietud en la ciudadanía en más de 25 mil personas adultas de 29 países. Aquí podemos ver:
¿Cual es el tema que más inquieta a los chilenos?
¿Es el control de inmigración uno de los temas que más preocupa a los chilenos?
¿Va Chile por el buen camino?
La empresa de investigación de mercados Ipsos lanzó su más reciente informe “Claves Ipsos”, para lo que encuestaron a varias personas con el fin de identificar las principales opiniones y preocupaciones de los chilenos sobre sus prioridades desde la agenda ciudadana y la reforma de pensiones.
This study aimed to investigate the bactericidal potential of Mycobacterium tuberculosis targets under various in vivo simulated in vitro conditions and in vivo in mice. Using antisense RNA to inhibit five target genes, the study evaluated target cidality under six physiological conditions in vitro and in vivo. It identified aroK, which encodes shikimate kinase, as an in vivo bactericidal target based on correlations between in vitro and in vivo cidality data. The study suggests that the low pH in vitro model best predicts in vivo cidality and identifies targets with potential for anti-tuberculosis drug development.
El ARN del SARS-CoV-2 de transcripción inversa puede integrarse en el genoma de células humanas cultivadas y puede ser expresado en tejidos derivados del paciente
Proceedings of National Academy of SciencesPNAS is a partner of CHORUS, COPE, CrossRef, ORCID, and Research4Life.
This document describes research on developing an improved inhibitor for the main protease (Mpro) of SARS-CoV-2, the virus that causes COVID-19. Key points:
- Researchers determined the crystal structure of SARS-CoV-2 Mpro and its complex with an α-ketoamide inhibitor derived from a previous broad-spectrum inhibitor.
- They modified the inhibitor by incorporating the P3-P2 amide bond into a pyridone ring to increase its half-life in plasma. Testing showed this improved solubility and pharmacokinetic properties.
- Further modification replacing the P2 group led to a more potent inhibitor of SARS-CoV-2 Mpro. X-ray crystal structures
T cell recall response of two hypothetical proteins (Rv2251 and Rv2721c) from...Santhi Devasundaram
The demonstrated variable efficacy of the only licensed TB vaccine Mycobacterium
bovis bacillus CalmetteeGue´rin (M. bovis BCG) encourages the need for new vaccine candidates
against TB. Antigen specific cellular immune response is often considered imperative
during Mycobacterium tuberculosis (M. tuberculosis) infection and antigens that are strongly
associated with the latent phase of infection are drawing increasing attention for anti-TB vaccine
development. Here, we investigated the phenotypic and functional profiles of two novel
mycobacterial antigens Rv2251 and Rv2721c during T cell recall response via multi-color flow
cytometry.
Evolutionary origins of the SARS-CoV-2 sarbecovirus lineage responsible for t...Guy Boulianne
This document analyzes the evolutionary history of SARS-CoV-2, the virus that causes COVID-19, using genomic data from related sarbecoviruses found in bats. The key points are:
- Sarbecoviruses undergo frequent recombination, exhibiting spatially structured genetic diversity in China. SARS-CoV-2 itself shows no evidence of being a recombinant of known sarbecoviruses.
- Bayesian analyses estimate the most recent common ancestor of SARS-CoV-2 and its closest known relative, RaTG13, existed between 1948-2009, indicating the lineage has been circulating unnoticed in bats for decades.
- While pangolins or other species may have facilitated transmission to
SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination I...Guy Boulianne
This document summarizes a research study that investigated how the SARS-CoV-2 spike protein affects DNA damage repair and adaptive immunity. The main findings are:
1) The SARS-CoV-2 spike protein significantly inhibited DNA damage repair in in vitro cell line experiments by impeding the recruitment of key DNA repair proteins like BRCA1 and 53BP1 to damage sites.
2) DNA damage repair is required for effective V(D)J recombination, which generates antibody diversity in B cells and T cell receptors in T cells. Inhibiting DNA damage repair could therefore impair adaptive immunity.
3) The spike protein was found to localize in the cell nucleus, where it could interfere with DNA repair
This document discusses serological approaches for detecting COVID-19 through immune-based detection of antibodies. It provides an overview of the SARS-CoV-2 virus, current diagnostic methods including RT-PCR and immunoassays, considerations around specificity and sensitivity of different viral targets for immunoassays, applications of immunoassays for surveillance and developing treatments, and the need for point-of-care tests. Moving forward, it emphasizes that collating immunoassay data and developing rapid decentralized tests can help address testing shortages, while ensuring rigorous evaluation of new tests.
Homeopathic Dilutions of Mercury Chloride as an Effective and Affordable Trea...semualkaira
A novel human coronavirus that is now named severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) (formerly called
HCoV-19) emerged in Wuhan,China, in late 2019 and is now causing a pandemic [1]. The epidemic of SARS-CoV wassuccessfully
contained through public health interventions, including case detection and isolation. Transmission of SARS-CoV occurred mainly
after days of illness
The COVID-19 pandemic is driving the need for rapid development of effective vaccines and therapies. Developing an effective vaccine requires an understanding of the adaptive immune response to SARS-CoV-2. An assay to measure circulating antibodies, specifically neutralizing antibodies (NAbs) that disrupt receptor-binding domain (RBD) and angiotensin-converting enzyme 2 (ACE2) binding to prevent SARS-COV-2 cell entry is an important research tool.
ImmunoRank is a high-throughput surrogate assay that semi-quantitative detects and ranks circulating SARS-CoV-2 neutralizing antibodies of all Ig classes (total antibody) in human plasma or serum. Highly correlated to FRNT or PRNT live virus tests, but is less laborious, takes only 80 minutes to complete, and does not require a BSL3 laboratory.
This document describes engineering Mycobacterium smegmatis to produce polyhydroxyalkanoate (PHA) beads displaying mycobacterial antigens for use as a tuberculosis vaccine. M. smegmatis was engineered to express three enzymes involved in PHA production and a fusion protein linking PHA synthase to the TB antigens Ag85A and ESAT-6. This resulted in PHA beads displaying the antigens on their surface. Mice were vaccinated with the engineered PHA beads and they induced a cellular immune response against the mycobacterial antigens, demonstrating their potential as a TB vaccine.
The Thiazolobenzimidazole TBZE-029 Inhibits Enterovirus Replication by Target...degarden
This document summarizes research identifying the viral target of the antiviral compound TBZE-029 against enteroviruses. Through selecting for drug-resistant coxsackievirus B3, the researchers identified three mutations in the nonstructural protein 2C clustered near motif C. Reintroducing the mutations, particularly at positions 227 and 229, conferred drug resistance, demonstrating 2C as the target. Viruses with the mutations also showed cross-resistance to other known 2C-targeting antivirals. The ATPase activity of 2C was unaffected by TBZE-029, suggesting it targets a different function of this essential replication protein.
This study validated the peroxisome targeting of two pathogen defense proteins in Arabidopsis thaliana, disease resistance protein 1 (DRP1) and nudix hydrolase homologue 15 (NUDT15), which were predicted to have peroxisome targeting signals (PTS). Experiments showed that an alternative splice variant of DRP1 (DRP1.2) localized to peroxisomes due to a functional PTS1 domain, while another variant (DRP1.1) remained cytosolic. Similarly, a splice variant of NUDT15 (NUDT15.2) was targeted to peroxisomes by its PTS1, but another variant (NUDT15.1) was
Immunobiology Abstract and Figure writing instructions.pdfstudy help
- The document provides instructions for two assignments related to a scientific paper on SARS-CoV-2 immunity. The first assignment is to write a description of the results presented in Figure 2 Panels A through D of the attached paper. The second assignment is to write an abstract summarizing the problem, methods, results, and conclusions of the attached paper. Links are provided to guide writing the abstract and results sections.
Immunobiology Abstract and Figure writing instructions.pdfstudy help
- The document provides instructions for two assignments related to a scientific paper on SARS-CoV-2 immunity. The first assignment is to write a description of the results presented in Figure 2 Panels A through D of the attached paper. The second assignment is to write an abstract summarizing the problem, methods, results, and conclusions of the attached paper. Links are provided to guide writing the abstract and results sections.
A SARS-like cluster of circulating bat coronaviruses shows potential for huma...Guy Boulianne
This study examines the potential risk of SARS-like viruses emerging from bat populations in China. Researchers generated a chimeric virus containing the spike protein of a bat coronavirus (SHC014-CoV) in a mouse-adapted SARS-CoV backbone. They found that this chimeric virus was able to efficiently infect human airway cells and cause disease in mice. Current SARS treatments like monoclonal antibodies were ineffective at neutralizing the chimeric virus. This suggests SARS-like viruses currently circulating in bats may pose a future risk of transmission to humans.
This document summarizes a study examining the genetic attributes associated with the exceptional sensitivity of an HIV-1 clade C envelope protein to autologous broadly neutralizing plasma antibodies. The researchers identified an envelope that was significantly more sensitive to neutralization by contemporaneous plasma than two other envelopes. Sequence analysis found mutations in the V3/C3 region of the sensitive envelope. Chimeric envelope experiments determined that replacing the V3/C3 region of a resistant envelope with the sensitive envelope conferred enhanced neutralization sensitivity, indicating this region plays a role in exposure of epitopes targeted by plasma antibodies. Fine mapping identified a proline to isoleucine substitution at position 326 in the V3 loop that modulated neutralization susceptibility.
This study examined the genetic attributes associated with the enhanced sensitivity of an HIV-1 clade C envelope protein (HVTR-PG80v2.eJ7) to autologous broadly neutralizing plasma antibodies from an elite neutralizer. The researchers found that mutations in the V3/C3 region of the envelope protein were associated with its increased sensitivity to neutralization by autologous plasma antibodies. Depletion experiments showed that these mutations altered the envelope conformation to better expose epitopes targeted by both neutralizing and non-neutralizing antibodies in the plasma. Therefore, distinct vulnerabilities associated with antibody evasion could be linked to mutations in the V3/C3 region of the HIV envelope.
This document summarizes the selection and characterization of recombinant clones from a Mycobacterium leprae expression library screened with sera from household contacts of leprosy patients. Twelve recombinant clones were selected that reacted with antibodies in the contact sera. These antigens recognized by contact sera differed from those recognized by monoclonal antibodies and were not identical to known M. leprae antigens. Two groups of antigens were identified: one recognized by all contact sera, and one recognized by only some contact sera. These antigens may be relevant to early immune responses during M. leprae infection.
This document describes a study comparing different recombinase systems and cis-acting elements for prolonging baculovirus-mediated transgene expression. The researchers developed a binary baculovirus system using Cre, FLPo, or C31o recombinase to excise the transgene and form extrachromosomal minicircles. Cre and FLPo achieved high recombination efficiencies of 90-95% compared to 40-75% for C31o. The addition of oriP/EBNA1 to maintain episomal minicircles prolonged transgene expression for 30 days without integration. This system enhanced and prolonged growth factor expression in human adipose-derived stem cells and improved their osteogenesis potential.
La empresa de estudios de mercado Ipsos lanzó su informe mensual “Preocupaciones del Mundo”, que estudia la percepción sobre los temas que generan mayor inquietud en la ciudadanía en más de 25 mil personas adultas de 29 países. Aquí podemos ver:
¿Cual es el tema que más inquieta a los chilenos?
¿Es el control de inmigración uno de los temas que más preocupa a los chilenos?
¿Va Chile por el buen camino?
La empresa de investigación de mercados Ipsos lanzó su más reciente informe “Claves Ipsos”, para lo que encuestaron a varias personas con el fin de identificar las principales opiniones y preocupaciones de los chilenos sobre sus prioridades desde la agenda ciudadana y la reforma de pensiones.
De acuerdo con los resultados entregados por la Facultad de Economía y Gobierno de la Universidad San Sebastián (USS), a través de su Centro de Políticas Públicas, tras la reinstalación de la discusión sobre la reforma previsional solo un 28,4% de las personas prefiere la alternativa presentada por el Gobierno, de un 3% a cuentas individuales y un 3% a un fondo común. Además, un 71,4% de los encuestados prefiere que todo o la mayor parte de la cotización adicional del 6% se destine a sus cuentas individuales.
Informe What Worries the World_Resumen global - Octubre 2023.pdfAproximacionAlFuturo
La empresa de estudios de mercado Ipsos lanzó su informe mensual “Preocupaciones del Mundo”, que estudia la percepción sobre los temas que generan mayor inquietud en la ciudadanía en más de 25 mil personas adultas de 29 países. Aquí podemos ver:
¿Cual es el tema que más inquieta a los chilenos?
¿Es la corrupción uno de los temas que más preocupa a los chilenos?
¿Va Chile por el buen camino?
Common Beans as a Source of Amino Acids and Cofactors for Collagen Biosynthesis AproximacionAlFuturo
Common beans (Phaseolus vulgaris L.) are widely consumed in diets all over the world and have a significant impact on human health. Proteins, vitamins, minerals, phytochemicals, and other micro- and macronutrients are abundant in these legumes. On the other hand, collagens, the most important constituent of extracellular matrices, account for approximately 25–30 percent of the overall total protein composition within the human body. Hence, the presence of amino acids and other dietary components, including glycine, proline, and lysine, which are constituents of the primary structure of the protein, is required for collagen formation. In this particular context, protein quality is associated with the availability of macronutrients such as the essential amino acid lysine, which can be acquired from meals containing beans.
La consultora internacional Ipsos lanzó su estudio “Monitor Global de Salud”, que muestra la percepción de más de 23 mil personas en 31 países, incluido Chile, sobre los principales desafíos para la salud personal y de los sistemas de salud, incluyendo cómo los ciudadanos califican los servicios que tienen disponibles y qué piensan que debe mejorarse.
Identifying the Determinants of the Increase in Native Forests in Southern ChileAproximacionAlFuturo
The econometric results show that smaller farms and those located in Los Lagos presented less probability of increasing their native forests. In the same way, an increase in the share of forest plantations area decreases the probability. Conversely, the scrub area share is related to the recovery of native forests in the sample. No significant effects of the variables associated with the implementation of management plans and technical assistance were found.
World Bank Report - Wired: Digital Connectivity for Inclusion and GrowthAproximacionAlFuturo
El informe estima que el Producto Interno Bruto (PIB) regional crecerá un 2 por ciento en 2023, ligeramente por encima del 1,4 por ciento proyectado anteriormente, pero aún por debajo del de todas las demás regiones del mundo. Se esperan tasas de crecimiento del 2,3 por ciento y 2,6 por ciento para 2024 y 2025, respectivamente. Estas tasas, similares a las de la década de 2010, no son suficientes para lograr los avances tan necesarios en inclusión y reducción de la pobreza. Los países deben encontrar formas de promover la inclusión y el crecimiento, mejorar la gobernanza y generar consenso social. Las soluciones digitales pueden ser parte de la respuesta. La ampliación de la conectividad digital, combinada con políticas complementarias, ofrece la posibilidad de crear sociedades más dinámicas e inclusivas.
Encuesta Chile nos Habla, realizado por la Universidad San Sebastián, que arroja que 2 de 5 encuestados cree que reactivar la economía debe ser el objetivo para el Presupuesto 2024. Con relación a las principales áreas a las cuáles asignar la mayor cantidad de recursos, las tres primeras mayorías las obtiene salud, educación y seguridad, seguido por pensiones.
estudio de Digitalización de las Empresas en Chile - Entel DigitalAproximacionAlFuturo
El documento presenta los resultados de un estudio realizado por Entel Digital y Cadem sobre la digitalización de las empresas en Chile. El estudio encuestó a 628 dueños, gerentes y directores de empresas de todos los tamaños y sectores productivos. Los resultados muestran que la mayoría de las empresas están en una etapa transicional de digitalización, valorándola pero sin ejecutarla totalmente. La percepción de la digitalización es positiva, aunque las grandes empresas están más avanzadas. Transporte, construcción y agricultura son los sectores más rezagados.
Reportes Enadel 2022 sobre Comercio y Turismo en Region de OHigginsAproximacionAlFuturo
Así lo reveló la 5° Encuesta Nacional de Demanda Laboral ENADEL 2022, que en esta versión levantó información sobre estos dos sectores económicos, con el objetivo de caracterizar los requerimientos de capital humano de las empresas, para apoyar la toma de decisiones de los actores que participan en el sistema formativo laboral. Esto, con el fin de fortalecer las políticas orientadas a mejorar las trayectorias laborales de los trabajadores y la productividad de las empresas.
Este documento describe un centro de innovación dedicado al vino y la oliva ubicado en Marchigüe, Región de O'Higgins. El centro ofrece servicios de laboratorio para análisis físico-químicos y microbiológicos, así como insumos de laboratorio. Además, muestra diversos productos creados en el centro como vinos y aceites de oliva. El documento promueve los servicios del centro para quienes deseen desarrollar sus propios productos vitivinícolas y oleícolas.
Este documento presenta los resultados clave de una encuesta realizada por Ipsos en Chile sobre probidad y corrupción. Algunos hallazgos clave son: 1) La mayoría de las instituciones chilenas se asocian más a corrupción que a probidad, especialmente partidos políticos y el Congreso. 2) Hay altos niveles de desacuerdo con afirmaciones sobre el buen funcionamiento del Estado y las empresas privadas. 3) Se percibe corrupción en todos los niveles, y las prácticas más identificadas son el nepotismo, sobornos y
La empresa de investigación de mercados Ipsos lanzó su más reciente informe “Claves Ipsos”, en el que encuestó a 800 chilenos para describir las opiniones y los comportamientos de los ciudadanos respecto de temas de interés para el país. En esta edición se analizó la campaña de invierno para el combate contra las enfermedades respiratorias, medidas preventivas y vacunación.
Decreto del Ministerio del Interior y Seguridad Pública del 24 de junio de 2023AproximacionAlFuturo
Declara como zonas afectadas por catástrofe a las Regiones de Valparaíso, Metropolitana de Santiago, del Libertador General Bernardo OHiggins, del Maule, de Ñuble y del Biobío
Informe de la Comisión de Alto Nivel sobre Salud Mental y COVID-19 de la Orga...AproximacionAlFuturo
Una nueva agenda para la salud mental en las Américas. Informe de la Comisión de Alto Nivel sobre Salud Mental y COVID-19 de la Organización Panamericana de la Salud
Reporte ADP Personas y Trabajo 2023: una visión sobre el equipo humano global.AproximacionAlFuturo
Este documento resume las principales conclusiones de una encuesta realizada a más de 32,000 trabajadores de 17 países sobre sus actitudes hacia el lugar de trabajo actual y futuro. Algunos hallazgos clave son:
1. La mayoría de los trabajadores recibieron aumentos salariales en el último año, pero menos de la mitad cree que su salario es justo y la mayoría espera aumentos mayores en 2023 debido a la alta inflación.
2. Aunque la flexibilidad ha disminuido en importancia para los trabajadores, sigue siendo un factor
Encuesta Chile Nos Habla - Sistema Pensiones - Politicas Públicas USS.pdfAproximacionAlFuturo
El documento presenta los resultados de una encuesta sobre el sistema de pensiones chileno realizada en junio de 2023 a 1,170 personas de todo Chile. La mayoría apoya la Pensión Garantizada Universal propuesta y que los fondos se destinen a cuentas individuales. Sin embargo, existe división en igualar la edad de jubilación entre hombres y mujeres.
lanzamiento del ESTUDIO DE TRANSFORMACIÓN DIGITAL EN EMPRENDIMIENTOS DE LA REGIÓN DE ÑUBLE, el cual fue aplicado a 100 emprendimientos de la zona y tuvo como fin medir el estado tecnológico e innovativo de pequeñas y medianas empresas
English Drug and Alcohol Commissioners June 2024.pptxMatSouthwell1
Presentation made by Mat Southwell to the Harm Reduction Working Group of the English Drug and Alcohol Commissioners. Discuss stimulants, OAMT, NSP coverage and community-led approach to DCRs. Focussing on active drug user perspectives and interests
CHAPTER 1 SEMESTER V COMMUNICATION TECHNIQUES FOR CHILDREN.pdfSachin Sharma
Here are some key objectives of communication with children:
Build Trust and Security:
Establish a safe and supportive environment where children feel comfortable expressing themselves.
Encourage Expression:
Enable children to articulate their thoughts, feelings, and experiences.
Promote Emotional Understanding:
Help children identify and understand their own emotions and the emotions of others.
Enhance Listening Skills:
Develop children’s ability to listen attentively and respond appropriately.
Foster Positive Relationships:
Strengthen the bond between children and caregivers, peers, and other adults.
Support Learning and Development:
Aid cognitive and language development through engaging and meaningful conversations.
Teach Social Skills:
Encourage polite, respectful, and empathetic interactions with others.
Resolve Conflicts:
Provide tools and guidance for children to handle disagreements constructively.
Encourage Independence:
Support children in making decisions and solving problems on their own.
Provide Reassurance and Comfort:
Offer comfort and understanding during times of distress or uncertainty.
Reinforce Positive Behavior:
Acknowledge and encourage positive actions and behaviors.
Guide and Educate:
Offer clear instructions and explanations to help children understand expectations and learn new concepts.
By focusing on these objectives, communication with children can be both effective and nurturing, supporting their overall growth and well-being.
This particular slides consist of- what is Pneumothorax,what are it's causes and it's effect on body, risk factors, symptoms,complications, diagnosis and role of physiotherapy in it.
This slide is very helpful for physiotherapy students and also for other medical and healthcare students.
Here is a summary of Pneumothorax:
Pneumothorax, also known as a collapsed lung, is a condition that occurs when air leaks into the space between the lung and chest wall. This air buildup puts pressure on the lung, preventing it from expanding fully when you breathe. A pneumothorax can cause a complete or partial collapse of the lung.
R3 Stem Cell Therapy: A New Hope for Women with Ovarian FailureR3 Stem Cell
Discover the groundbreaking advancements in stem cell therapy by R3 Stem Cell, offering new hope for women with ovarian failure. This innovative treatment aims to restore ovarian function, improve fertility, and enhance overall well-being, revolutionizing reproductive health for women worldwide.
This particular slides consist of- what is hypotension,what are it's causes and it's effect on body, risk factors, symptoms,complications, diagnosis and role of physiotherapy in it.
This slide is very helpful for physiotherapy students and also for other medical and healthcare students.
Here is the summary of hypotension:
Hypotension, or low blood pressure, is when the pressure of blood circulating in the body is lower than normal or expected. It's only a problem if it negatively impacts the body and causes symptoms. Normal blood pressure is usually between 90/60 mmHg and 120/80 mmHg, but pressures below 90/60 are generally considered hypotensive.
The Importance of Black Women Understanding the Chemicals in Their Personal C...bkling
Certain chemicals, such as phthalates and parabens, can disrupt the body's hormones and have significant effects on health. According to data, hormone-related health issues such as uterine fibroids, infertility, early puberty and more aggressive forms of breast and endometrial cancers disproportionately affect Black women. Our guest speaker, Jasmine A. McDonald, PhD, an Assistant Professor in the Department of Epidemiology at Columbia University in New York City, discusses the scientific reasons why Black women should pay attention to specific chemicals in their personal care products, like hair care, and ways to minimize their exposure.
At Malayali Kerala Spa Ajman, Full Service includes individualized care for every client. We specifically design each massage session for the individual needs of the client. Our therapists are always willing to adjust the treatments based on the client's instruction and feedback. This guarantees that every client receives the treatment they expect.
By offering a variety of massage services, our Ajman Spa Massage Center can tackle physical, mental, and emotional illnesses. In addition, efficient identification of specific health conditions and designing treatment plans accordingly can significantly enhance the quality of massaging.
At Malayali Kerala Spa Ajman, we firmly believe that everyone should have the option to experience top-quality massage services regularly. To achieve that goal we offer cheap massage services in Ajman.
If you are interested in experiencing transformative massage treatment at Malayali Kerala Spa Ajman, you can use our Ajman Massage Center WhatsApp Number to schedule your next massage session.
Contact @ +971 529818279
Visit @ https://malayalikeralaspaajman.com/
Michigan HealthTech Market Map 2024. Includes 7 categories: Policy Makers, Academic Innovation Centers, Digital Health Providers, Healthcare Providers, Payers / Insurance, Device Companies, Life Science Companies, Innovation Accelerators. Developed by the Michigan-Israel Business Accelerator
At Apollo Hospital, Lucknow, U.P., we provide specialized care for children experiencing dehydration and other symptoms. We also offer NICU & PICU Ambulance Facility Services. Consult our expert today for the best pediatric emergency care.
For More Details:
Map: https://cutt.ly/BwCeflYo
Name: Apollo Hospital
Address: Singar Nagar, LDA Colony, Lucknow, Uttar Pradesh 226012
Phone: 08429021957
Opening Hours: 24X7
Pediatric Emergency Care for Children | Apollo Hospital
s41467-023-37290-6.pdf
1. Article https://doi.org/10.1038/s41467-023-37290-6
Intranasal trimeric sherpabody inhibits
SARS-CoV-2 including recent immunoevasive
Omicron subvariants
Anna R. Mäkelä1
, Hasan Uğurlu 1
, Liina Hannula2
, Ravi Kant 1,3
, Petja Salminen1
,
Riku Fagerlund1
, Sanna Mäki1
, Anu Haveri 4
, Tomas Strandin1
, Lauri Kareinen1,3
,
Jussi Hepojoki 1
, Suvi Kuivanen1
, Lev Levanov1
, Arja Pasternack 5
,
Rauno A. Naves5
, Olli Ritvos5
, Pamela Österlund 4
, Tarja Sironen 1,3
,
Olli Vapalahti 1,3,6
, Anja Kipar 3,7
, Juha T. Huiskonen 2
, Ilona Rissanen 2
&
Kalle Saksela 1,6
The emergence of increasingly immunoevasive SARS-CoV-2 variants
emphasizes the need for prophylactic strategies to complement vaccina-
tion in fighting the COVID-19 pandemic. Intranasal administration of neu-
tralizing antibodies has shown encouraging protective potential but there
remains a need for SARS-CoV-2 blocking agents that are less vulnerable to
mutational viral variation and more economical to produce in large scale.
Here we describe TriSb92, a highly manufacturable and stable trimeric
antibody-mimetic sherpabody targeted against a conserved region of the
viral spike glycoprotein. TriSb92 potently neutralizes SARS-CoV-2, includ-
ing the latest Omicron variants like BF.7, XBB, and BQ.1.1. In female Balb/c
mice intranasal administration of just 5 or 50 micrograms of TriSb92 as
early as 8 h before but also 4 h after SARS-CoV-2 challenge can protect from
infection. Cryo-EM and biochemical studies reveal triggering of a con-
formational shift in the spike trimer as the inhibitory mechanism of
TriSb92. The potency and robust biochemical properties of TriSb92 toge-
ther with its resistance against viral sequence evolution suggest that
TriSb92 could be useful as a nasal spray for protecting susceptible indivi-
duals from SARS-CoV-2 infection.
The success of the current vaccines in the fight against the SARS-CoV-2
pandemic is challenged by the emergence of viral variants of concern
(VOCs) that show strong resistance to neutralizing antibodies induced
by vaccinations or prior infection. Moreover, immune disorders or
other health conditions can preclude appropriate vaccine responses in
many individuals. In addition to pharmaceuticals for treating COVID-19
disease, new approaches for preventing transmission and spreading of
SARS-CoV-2 are therefore urgently needed.
Since the nasal epithelium of the respiratory tract is the first
dominant replication site of SARS-CoV-2 preceding virus transport into
the lung1
, intranasal administration of SARS-CoV-2 neutralizing agents
poses an attractive prophylactic concept. In animal models,
Received: 22 December 2022
Accepted: 10 March 2023
Check for updates
1
Department of Virology, University of Helsinki, Helsinki, Finland. 2
Institute of Biotechnology, Helsinki Institute of Life Science HiLIFE, University of Helsinki,
Helsinki, Finland. 3
Department of Basic Veterinary Sciences, University of Helsinki, Helsinki, Finland. 4
Finnish Institute for Health and Welfare, Helsinki, Finland.
5
Department of Physiology, University of Helsinki, Helsinki, Finland. 6
HUS Diagnostic Centre, HUSLAB, Clinical Microbiology, Helsinki University Hospital,
Helsinki, Finland. 7
Laboratory for Animal Model Pathology, Institute of Veterinary Pathology, Vetsuisse Faculty, University of Zurich, Zurich, Switzerland.
e-mail: kalle.saksela@helsinki.fi
Nature Communications| (2023)14:1637 1
1234567890():,;
1234567890():,;
2. monoclonal antibodies targeted against the spike envelope protein of
SARS-CoV-2 have shown to be effective for COVID-19 prophylaxis2–6
.
To avoid mutational escape from neutralization, such antibodies have
been used as cocktails and targeted against conserved regions of
spike7
. Markedly increased potency could also be achieved by con-
structing a pentameric IgM version of spike-targeted IgG antibodies4
.
To develop more economical and manufacturable anti-SARS-CoV-
2 reagents, many laboratories have moved from monoclonal anti-
bodies to smaller antibody fragments, including single variable
domain-based nanobodies. Several of these have shown promising
antiviral efficacy in cell culture or animal models, including utility as an
intranasal SARS-CoV-2 prophylaxis8–11
.
Compared to these, small antibody-mimetic scaffold proteins are
even more robust, versatile to engineer, and cheaper to produce for
diverse biological targeting purposes12
. Sherpabodies (SH3 Recombi-
nant Protein Affinity) are very small (< 60 aa) targeting modules that
constitute a recent addition to the toolbox of scaffold targeting pro-
teins and comprise of an improved SH3-domain fold derived from the
human ciliary adaptor protein nephrocystin13
. Here, we report engi-
neering of a sherpabody targeted against a highly conserved region in
the spike receptor binding domain (RBD) into a potent prophylactic
anti-SARS-CoV-2 agent.
Results
Development of sherpabody-based SARS-CoV-2 inhibitors
With the aim of developing inhibitory proteins that could be used for
neutralizing SARS-CoV-2, we screened a large antibody-mimetic phage
library displaying ~1011
unique sherpabodies (Fig. 1a, b) by using the
receptor binding domain (RBD) of the spike glycoprotein of the
Wuhan-Hu-1 strain as an affinity bait. Starting from the second round of
affinity selection and phage amplification (panning), a clear enrich-
ment of RBD-binding clones was observed. After three panning cycles,
192 individual sherpabody-displaying phage clones were isolated and
found to represent 15 different sequences. These 15 unique sherpa-
bodies were tested in phage-ELISA for binding to RBD-mFc, control
mFc, or a monoclonal antibody against the E-tag peptide used for
monitoring sherpabody display efficiency (see Fig. 1b). All 15 sherpa-
body clones mediated strong and apparently specific RBD binding
(Fig. 1c). Clone number 92 (Sb92; amino acid sequence: EEYIAVGDF
FSTDPADLTFKKGEILLVIERGTSAGDGWWIAKDAKGNEGLVPRTYLEPYS)
was among the strongest RBD binders and was chosen for further
development due to its ability to also bind to RBD of SARS-CoV-1 (see
later), suggesting a conserved target epitope that would be unlikely to
vary between different variants of SARS-CoV-2. Sb92 was produced as a
GST-fusion protein in bacteria and its RBD-binding affinity was eval-
uated using a semi-quantitative antigen capture-ELISA (Fig. 1d), which
indicated an affinity (KD) of 30 nM.
Neutralization of SARS-CoV-2 and SARS-CoV-1 by trimer-
ized Sb92
To enhance targeting of the trimeric cell surface spike protein we
constructed a multimerized derivative of Sb92 (TriSb92) containing
three tandem copies of Sb92 connected by flexible 15-mer Gly-Ser lin-
kers. To evaluate the potency of TriSb92 as a neutralizing agent we
incubated different viral isolates with serial dilutions of it before
infection of VeroE6-TMPRSS2-H10 cultures. When the original Wuhan
strain of SARS-CoV-2 was tested a dose-dependent decrease in the
number of infected cells was observed corresponding to an impressive
IC50 value of 0.24 nM (Fig. 2). When clinical SARS-CoV-2 isolates
representing the Beta (B.1.351), Delta (B.1.617.2), and Omicron (B.1.1.529)
BA.1 variants of concern were tested we observed an even more potent
neutralization by TriSb92, resulting in IC50 values of 0.11 nM (Beta),
0.18 nM (Delta), and 0.08 nM (BA.1). Finally, we tested also a more
recent viral isolate corresponding to the Omicron BA.5 variant that
carries several additional mutations in the RBD of its spike protein that
provide it with a problematic capacity for evading neutralizing antibody
responses. We noted that despite being slightly more resistant than the
older variants tested, Omicron BA.5 could also be efficiently neutralized
by TriSb92 with a subnanomolar IC50 value of 0.82 nM.
To extend these studies to a wider panel of viruses, we utilized a
pseudovirus model based on luciferase expressing lentiviral vectors
infecting ACE2-expressing HEK293T cells in a spike-dependent
manner14
. Testing of Wuhan, Beta, Delta, Omicron BA.1 and BA.5 spike
proteins in this model showed that pseudoviruses are slightly more
sensitive to neutralization by TriSb92, but gave results that correlated
well with our data on the corresponding authentic SARS-CoV-2 strains
(Fig. 2). The IC50 values derived from these experiments (0.06 nM for
Wuhan, 0.03 nM for Beta, 0.06 nM for Delta, 0.11 nM for Omicron BA.1,
and 0.35 nM for Omicron BA.5) thus both support our data from using
live viruses and help to validate this pseudovirus model for studying the
inhibitory potency of TriSb92 against additional virus strains.
Fig. 1 | Discovery ofRBD-targeting sherpabodies.a, b Six and three residues in the
RT- and n-Src-loops, respectively, of the human nephrocystin SH3 domain were
replaced with hexapeptides (in red) comprising random combinations of the 20
natural amino acids to create a large semisynthetic M13 phage library displaying ~1011
individual sherpabodies with unique binding surfaces formed by the 12 randomized
loop residues shown red in the illustration based on the structure pdb 1S1N (https://
www.ncbi.nlm.nih.gov/Structure/pdb/1S1N)13
. c Heat map showing relative binding in
an ELISA assay of fifteen affinity-selected sherpabody-displaying phage clones tar-
geted to RBD of SARS-CoV-2 spike protein (RBD-mFc), negative control (mFc), or an
antibody evenly recognizing all displayed clones (anti-E-tag). d Semi-quantitative
ELISA-based analysis of the RBD-binding affinity (30 nM) of the sherpabody clone
Sb92. The experiments were repeated independently three times with similar results.
A representative assay is shown. Source data are provided as a Source Data file.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 2
3. Recently several BA.5 subvariants with even higher immunoeva-
sive capacity and ability to escape from neutralization by the currently
available therapeutic antibodies have been reported to gain
prevalence15
. To test the potency of TriSb92 against such challenging
SARS-CoV-2 strains we generated pseudoviruses carrying spike pro-
teins from a panel of viruses that have emerged and caused concern
around the world in mid- and late-2022 (Fig. 2 and Fig. S1). All these
pseudoviruses could also be efficiently neutralized by TriSb92,
although the IC50 values had increased from the subnanomolar range
to 1–2 nM. Finally, we created a pseudovirus based on the spike gly-
coprotein of SARS-CoV-1, and found that it could also be readily neu-
tralized by TriSb92, albeit with a somewhat lower efficiency (IC50
5.65 nM) than the SARS-CoV-2 variants tested (Fig. 2).
Together, these data show that TriSb92 is a potent inhibitor of
SARS-CoV-2 infection, which targets a conserved site in the RBD of
spike in a manner that is not prevented by mutations found in the older
as well as the currently prevalent and emerging SARS-CoV-2 variants,
and provides TriSb92 with a capacity to neutralize a related sarbe-
covirus (SARS-CoV-1).
TriSb92 induces a conformational change in the S2 subunit of
the spike protein
To understand the mechanism behind the potent SARS-CoV-2 neu-
tralization by TriSb92 we examined whether it inhibited attachment of
spike-dependent pseudovirus particles to target cells. To this end,
these virions were either untreated or treated for 30 min with 100 ng/
ml of TriSb92 (a concentration sufficient to fully suppress infectivity)
or a high-titre COVID-19 convalescent serum before incubation with
ACE2-expressing HEK293 cells, followed by washing of unbound vir-
ions and Western blot analysis of lysates of these cells for the p24
pseudoviral capsid protein. We found that treatment with TriSb92 did
not affect target cell binding of the spike-pseudotyped virions,
whereas this was completely blocked by the convalescent serum used
as a control (Fig. 3a).
While this result ruled out displacement and shedding of the
S1 subunit from the spike complex as the principal mechanism of
action of TriSb92, it was still of interest to compare the relative
amounts of S1 and S2 subunits and uncleaved spike (S0) protein pre-
sent in TriSb92-treated and untreated virions. Concentrated virus
preparations were lysed in SDS-PAGE loading buffer and either
warmed to 37 °C or boiled under reducing conditions to help detecting
different types of epitopes in Western blots, which were probed with
polyclonal rabbit sera specific for S1 or S2, or with the human con-
valescent serum (Fig. 3c–e).
Both the rabbit anti-S1 and the human anti-spike sera were able to
detect S1 only if the samples had not been boiled. Use of these anti-
bodies clearly showed that the amount of virion-associated S1 was not
affected by TriSb92 treatment, thus further ruling out S1 shedding as
the inhibitory mechanism of TriSb92. The rabbit anti-S2 and the
human anti-spike sera readily detected S2 protein irrespective of the
preheating temperature, but stronger S2 signals were obtained after
boiling. In the case of the boiled samples TriSb92-treatment had no
effect on the amount of S2 detected by these antisera, as one would
expect for a membrane-anchored viral protein. However, whereas S2
was detected by both antisera in the unboiled control sample, it could
not be seen in the corresponding TriSb92-treated sample. A similarly
striking behaviour was observed for the intact spike protein (S0) where
the S2 subunit remains covalently connected to S1, as the rabbit anti-S1
and the human anti-spike sera could detect S0 only in the unboiled
control but not in the TriSb92-treated sample.
Based on these observations we conclude that regardless of the
proteolytic cleavage status of the spike protein binding of TriSb92 to
the RBD of its S1 subunit induces a conformational change in the
S2 subunit, which depending on the experimental condition can affect
detection of cleaved S2 and the uncleaved S0 precursor in Western
blotting.
Intranasally administered TriSb92 provides efficient prophy-
lactic pre- and post-exposure protection in mouse models of
SARS-CoV-2 infection and disease
To evaluate the prophylactic efficiency of TriSb92 in vivo, we used a
recently described animal model of COVID-19 where Balb/c mice are
IC50 (nM)
Authentic viruses
Wuhan
Beta
Delta
BA.1
BA.5
Pseudoviruses
Wuhan
Beta
Delta
BA.1
BA.3
BA.2
BA.2.13
BA.4/5
BA.2.3.20
BF.7
BQ.1.1
XBB
BU.1
SARS-CoV-1
0.24
0.11
0.18
0.08
0.83
0.06
0.03
0.06
0.11
0.03
0.25
0.19
0.35
0.08
0.18
1.74
1.19
0.82
5.65
±0.06
±0.04
±0.05
±0.01
±0.29
±0.02
±0.01
±0.04
±0.03
±0.01
±0.04
±0.10
±0.04
±0.01
±0.03
±0.30
±0.49
±0.03
±0.25
0%
10%
20%
30%
40%
50%
60%
70%
80%
90%
100%
110%
0 5 10 15 20 25 30
BA.5
Wuhan
Delta
Beta
BA.1
Relative
percentage
of
infected
cells
TriSb92 concentration (nM)
0 30
20
10 25
15
5
0
10
20
30
40
50
60
70
80
90
100
%
SARS-CoV-2 isolate: 100 µm
Fig. 2 | Neutralization of SARS-CoV-2 and SARS-CoV-1 by TriSb92. Half-maximal
inhibitory concentration (IC50) of TriSb92 against different authentic SARS-CoV-2
variants or pseudoviruses using the indicated spike proteins were established
based on automated counting of fluorescently labelled infected cells (see figure
insert) or luciferase reporter gene expression, respectively. Standard deviation for
the calculated IC50 values is shown. The pseudovirus neutralization experiments
were repeated independently three or more times with similar results. Average and
standard deviations of representative assays performed in duplicates is shown.
Neutralization of authentic viruses were repeated with similar results three times
for Wuhan, twice for Delta, BA.1, and BA.5 and once for Beta in experiments per-
formed in quintuplicate and involved counting of approximately 25,000 cells per
condition after immunostaining illustrated in the figure insert. The original data are
provided as a Source Data file. An alignment of RBD sequences of spike variants
used in this study is shown in Fig. S1.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 3
4. intranasally inoculated with the SARS-CoV-2 Beta (B.1.351) variant16
. At
different time points before the SARS-CoV-2 challenge mice received
intranasal administration of TriSb92. In the first experiment, mice
received 25 μg of TriSb92 per nostril and were challenged intranasally
one hour later with 2 × 105
PFU of SARS-CoV-2 B.1.351. This amount of
TriSb92 was chosen to represent a relatively modest dose, which is in
the range also referred as ultra-low in the SARS-CoV-2 antibody inhi-
bitor literature5
.
Animals were euthanized at 2 days post infection (dpi) and the
right lungs subjected to quantitative real-time PCR (RT-qPCR) for viral
RNA. In untreated control mice, the lungs exhibited abundant SARS-
CoV-2 subgenomic E RNA (median Cq value 18.45), whereas none could
be detected in the lungs of the mice that had received a prophylactic
dose of TriSb92 (Fig. 4a). The results were confirmed by histology and
immunohistology for the detection of SARS-CoV-2 nucleoprotein (NP)
in nasal mucosa, airways, and left lungs (Fig. 4b). In control animals,
viral antigen was present throughout the respiratory tract, in the nasal
cavity (respiratory and olfactory epithelial cells), in bronchiolar epi-
thelial cells and in pneumocytes in adjacent alveoli in association with a
mild acute bronchointerstitial pneumonia. Viral antigen was also
detected within individual macrophages in bronchiolar lymph nodes.
In contrast, treated animals were entirely free of viral antigen in nose,
lower airways, lungs, and bronchiolar lymph nodes and did not exhibit
any pathological changes (Fig. 4b).
In a second larger experiment, the protective effect of the pre-
viously used dose of TriSb92 was compared with a 10-fold lower dose
(2.5 µg per nostril) similarly administered 1 h before SARS-CoV-2 chal-
lenge. In addition, we tested the effect of the 25 µg per nostril
administered 4 h or 8 h before virus inoculation. As shown in Fig. 4a,
also the lower dose of TriSb92 efficiently protected the animals from
subsequent SARS-CoV-2 challenge 1 h later (no detectable sgE RNA in
lungs 3 days postinfection); however, in two of these animals viral
antigen was detected in a few patches of bronchiolar epithelial cells.
TriSb92 was very effective also when given 4 h before the viral chal-
lenge. None of these animals showed evidence of viral antigen
expression in the lung, and in only one of the four animals low but
detectable levels of sgE RNA were found. Likewise, when TriSb92 was
given 8 h before the challenge the lungs of 3 of the 4 mice were clean of
sgE RNA and viral antigen, whereas one animal did show substantial
albeit reduced viral RNA levels and also expressed viral antigen within
bronchiolar epithelial cells.
A third experiment was carried out to examine the early ther-
apeutic potency of TriSb92 when administered after SARS-CoV-2
infection of epithelial cells had already occurred. The same dosing of
25 µg of TriSb92 per nostril and a challenge with 2 × 105
PFU of SARS-
CoV-2 B.1.351 were again used. The results on the five unprotected
animals recapitulated our earlier data, showing abundant sgE RNA in
the lungs together with widespread viral antigen expression in the
bronchiolar and alveolar epithelium (Table S2), whereas no sgE RNA or
viral antigen could be detected in any of the five control mice that
received a prophylactic TriSb92 treatment 2 h before the challenge.
Strikingly, close to complete lack of sgE RNA in the lungs was also
observed at 2 days after the high-dose SARS-CoV-2 challenge when
TriSb92 was administered 2 h or even 4 h after the infection (Fig. 4a).
No Cq value for sgE RNA could be obtained for 4 of the 5 animals
treated 4 h post-infection, while Cq 32,66 was measured for one animal
a b
e
d
c
S0
S2
S1
Blot: α-spike
(convalescent serum)
TriSb92:
m
250
130
100
55
kDa
100oC 37oC
+ - + -
Blot: α-S2
S0
S2
TriSb92:
m
250
130
100
55
kDa
100oC 37oC
+ - + -
Blot: α-S1
S0
S1
TriSb92:
m
250
130
100
55
kDa
100oC 37oC
+ - + -
p24
Blot: α-capsid
TriSb92:
m
35
15
kDa
100oC 37oC
+ - + -
p24
m
Blot: α-capsid
35
15
kDa
Fig. 3 | TriSb92 does not prevent virus attachment to target cells but prevents
infection by inducing a conformational change in spike. a Spike-decorated
pseudoviruses were treated with TriSb92, COVID-19 convalescent serum (Patient),
or left untreated (None) before incubation with ACE2-expressing HEK293 cells. The
amount of cell-associated pseudoviral capsid protein (p24) after washing of the
cultures was determined by Western blotting. b–e Spike-pseudotyped virions
treated (+) or not treated (−) with TriSb92 were lysed in SDS-PAGE loading buffer
and warmed (37 °C) or boiled (100 °C) before analysis by Western blotting using
antibodies specific for the p24 capsid protein (b), spike S1 subunit (c), spike
S2 subunit (d), or COVID-19 convalescent serum that can recognize S1 and S2 (e).
The experiment 3a-e was repeated independently three times with similar results.
Uncropped original scans of all blots presented in panels a–e are provided as
Source Data files.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 4
5. (indicating sgE RNA levels < 0.01% of the average in the five untreated
mice). TriSb92 given 8 h after SARS-CoV-2 was still very beneficial,
although an efficient suppression of viral sgE RNA expression in the
lungs could be seen only in 3/5 of the mice (undetectable in two, 1.3% of
untreated in one). Perhaps due to the initial establishment of the
infection, however, the mice treated with TriSb92 after the infection
were not equally devoid of viral antigen in their lungs compared to the
mice that received TriSb92 prophylactically. SARS-CoV-2 nucleopro-
tein could be detected in the same cell types, although being markedly
less widespread and extensive than in the untreated animals (see
Table S2). Moreover, whereas in the untreated mice the infection of the
bronchiolar epithelium was associated with degenerative changes, no
such pathological alterations were observed in mice treated post-
infection with TriSb92.
To extend these studies to an animal model involving more
severe disease pathogenesis we used the mouse-adapted SARS-CoV-2
virus maVie16 that induces profound disease and mortality in Balb/c
mice recapitulating many aspects of human COVID-1917
. Also of note,
-1h -1h -1h
-4h -8h
0 0
25 25
25 25
2.5
- -
Dose [µg/nostril]:
Time from infection:
Experiment 1 Experiment 2
SARS-CoV-2
RNA
in
lung
tissue
[%
of
average
in
untreated
mice]
-2h
+8h
+2h +4h
0
25
25 25 25
-
Experiment 3
240
260
220
280
300
200
320
100
80
60
40
20
120
140
0
a
2
9
b
S
i
r
T
d
e
t
a
e
r
t
n
U
B
B
OE
RE
OE
RE
b
Fig. 4 | Prophylactic and early therapeutic efficacy of TriSb92 in mice.
a Subgenomic viral RNA was quantified in lung tissues of Balb/c mice 2 days after
challenge with 2 × 105
PFU of SARS-CoV-2 B.1.351 in three independent infection
experiments. The infected mice were treated with intranasal administration
TriSb92 at the indicated doses and times before or after the infection. b SARS-CoV-
2 nucleoprotein immunostaining in the nasal cavity and lung tissues 2 days after
infection in an untreated mouse (left) and in a mouse pretreated with 25 μg of
TriSb92 per nostril (right). The untreated animal exhibits viral antigen expression in
the nasal respiratory epithelium (RE) and olfactory epithelium (OE). In the lung,
several bronchioles (B) exhibit viral antigen in a variable number of epithelial cells
that are often degenerate (arrowheads) or sloughed off (arrows). In infected alveoli,
both type I pneumocytes (arrowhead) and type II pneumocytes (arrow) are posi-
tive. The bronchial lymph node (top inset) exhibits several positive cells (macro-
phages or dendritic cells). The animal that received TriSb92 does not exhibit any
evidence of viral antigen expression in nasal epithelium, lung and bronchial lymph
node. Bars: lung overviews – 500 µm; bronchial lymph nodes – 20 µm; all others –
10 µm. c The three mouse infection experiments shown involving 60 animals were
each performed once. Original data on RNA quantification are provided as Source
Data files. Panel b shows representative immunostaining findings, and a detailed
analysis of all animals are described in Table S2.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 5
6. in resemblance to the recently emerged immunoevasive Omicron
variant derivatives (such as BJ.1, BA.2.82, BH.1) the spike protein of
maVie16 has acquired mutations affecting the RBD residues K417,
Q493, and Q498. We used a lower (1 × 106
TCID) or a higher (5 x 106
TCID) dose of maVie16 to infect two groups of nine Balb/c mice, half
of which had received TriSb92 intranasally (25 µg/per nostril) one
hour earlier, and then monitored possible disease progression by
daily body weight recording (Fig. 5). Four mice that received just
mock treatment but no TriSb92 or virus were included as controls
and likewise monitored. All nine infected animals that did not receive
TriSb92 experienced significant weight loss at day 2, which at day 3
was so severe (≥ 15%) that 3 of 4 mice in the higher viral dose group
and at day 4 all of the remaining 6 control mice had to be euthanized.
By contrast, none of the mice that received a prophylactic dose of
TriSb92 showed any signs of weight loss (Fig. 5) or could be dis-
tinguished from the uninfected control animal based on their
apparent well-being or behaviour.
Together, these data show that in these two animal models
intranasal administration of TriSb92 atrelatively lowdoses can provide
an impressive protection and postexposure prophylactic effect against
SARS-CoV-2 infection as measured by virological and histopathologi-
cal parameters as well as objective severity of disease progression.
Feasibility of TriSb92 for use as a prophylactic formulation
To assess the feasibility of formulating TriSb92 into an intranasal spray
or drop for human use, we examined some of its key properties in this
regard, namely in vitro toxicity, potential cross-reactivity against nasal
epithelium, and stability under relevant storage temperatures. The
results of these studies were impressive. More specifically, even when
applied at very high concentration (1000 µg/ml) to human primary
endothelial cell (hNECs) culture, TriSb92 caused no signs of reduced
cell viability, as analyzed by measuring cellular metabolic activity
(Fig. S2). When binding of TriSb92 to extracts of hNECs was tested in an
ELISA-like assay, no signal above the background of the assay was seen
with any of the tested TriSb92 concentrations (as high as 10 µg/ml),
whereas a strong binding signal was observed from extracts prepared
from the same cells transduced to express SARS-CoV-2 RBD (Fig. S3).
Finally, we did not observe any loss of neutralizing activity of TriSb92
obtained from our research grade purification protocol and stored in
PBS with no added preservatives or inhibitors up to 15 months in ultra-
low freezer (−80 °C), regular freezer (−20 °C), refrigerator (+4 °C), or at
room temperature (+20–25 °C) (Fig. S4).
TriSb92 targets a conserved region in the RBD
To gain structural and mechanistic insight into the broadly cross-
neutralizing action of TriSb92, cryogenic electron microscopy
(cryoEM) studies were carried out. Single-particle cryoEM analysis of
the prefusion SARS-CoV-2 S trimer mixed with TriSb92 revealed three
particle populations distinguished by the up and down conformations
characteristic of sarbecoviral RBDs18–20
, with the majority (54%) of
particles presenting an all up RBD conformation, and minority popu-
lations presenting all down and mixed up and down RBD conforma-
tions (Fig. S5 and Fig. S6). Reconstructions of the all up and all down
populations yielded average estimated resolutions of 2.9 Å and 3.1 Å,
respectively (Fig. S5, Fig. S7, and Table S1; 6−7 Å resolution over the
flexible RBD regions). Reconstruction A describes the S-trimer with all
three RBDs in the up-conformation decorated with additional density
corresponding to bound TriSb92 (Fig. 6a), while reconstruction B
describes the S-trimer with all three RBDs in the down-conformation
without any additional density indicative of a sherpabody (Fig. S6 and
Fig. S7). To corroborate that the additional density associated with the
up-conformation RBDs was TriSb92-derived, we generated a model of
Sb92 with I-TASSER21
and fitted it into the additional density, con-
firming that this density perfectly matched with the size and shape of
the SH3-fold of TriSb92 (Fig. 6b, Fig. S8). The placement of RBD and
Sb92 models was unambiguous at map resolution of 6.9 Å, and iden-
tified the RT-loop of Sb92 as a key mediator of Sb-RBD interac-
tions (Fig. S8).
As illustrated in Fig. 6c, d, TriSb92 targets a region distal from the
ACE2 binding site that is highly conserved among sarbecoviruses. In
line with the observed cross-neutralization (Fig. 2), only a single resi-
due within the predicted binding site of TriSb92 diverges between
SARS-CoV-2 (Wuhan-Hu-1) and SARS-CoV-1. Furthermore, apart from
just three of the 27 RBD amino acids changes subsequently acquired by
SARS-CoV-2 (S375F, T376A and R408S, which are located at the very
edge of the TriSb92 epitope), VOCs, including the most recent Omi-
cron subvariants, do not contain mutations involving this binding
surface (Fig. 6c, d). The epitope of TriSb92 is distinct from the epitopes
of therapeutic monoclonalantibodies (Fig. S9) that primarily target the
ACE2 binding site and remain vulnerable to amino acid changes
accruing in this region. Instead, the epitope of TriSb92 partially over-
laps with the ‘cryptic epitope targeted by monoclonal antibody (mAb)
CR302222
(Fig. S9) that does not compete with binding to ACE2.
Indeed, the ability of ACE2 and Sb92 to simultaneously bind to the RBD
in a non-competitive manner could also be experimentally verified
using a sandwich-ELISA approach (Fig. S10).
Discussion
The emergence of SARS-CoV-2 variants that compromise vaccine
efficacy and are resistant to the available therapeutic monoclonal
antibodies23–28
underscores the importance to develop molecular tools
that potently neutralize VOCs. In this study, we describe a promising
SARS-CoV-2 inhibitor, TriSb92, based on an antibody-mimetic target-
ing scaffold termed the sherpabody. TriSb92 targets a highly con-
served region and could neutralize all tested VOCs and even a related
sarbecovirus SARS-CoV-1.
In our hands, pseudoviruses were slightly more sensitive to neu-
tralization than the corresponding authentic SARS-CoV-2 variants, but
in both cases the concentration of TriSb92 required for half-maximal
inhibition of infection (IC50) was less than 300 pM for all pre-Omicron
SARS-CoV-2 variants as well as for Omicron BA.1 and BA.3, where only
one amino acid change (S375F) appears within the TriSb92 epitope.
Infection with 1x106 TCID (n= 4)
Infection with 5x106 TCID (n= 5)
TriSb92 + infection with 1x106 TCID (n= 4)
TriSb92 + infection with 5x106 TCID (n= 5)
Uninfected control (n= 4)
Alive Euthanized
4
d
3
d
2
d
1
d
0
d
110
105
100
95
90
85
80
Relative
change
in
body
weight
(%)
Fig. 5 | TriSb92 can protect from a lethal challenge with mouse-adapted SARS-
CoV-2. Body weight development of Balb/c mice that were infected with 1 × 106
or
5 × 106
PFU of the pathogenic SARS-CoV-2 strain maVie16 following intranasal
administration TriSb92 (25 μg of per nostril; red lines and symbols) or the same
volume of saline buffer (grey lines and symbols) 1 h earlier, as indicated. Four
control mice received similar mock treatment but no TriSb92 or virus (blue lines
and symbols). The experiment was terminated at day 4 post-infection when all
infected mice that had not received TriSb92 prophylaxis had been euthanized
because of losing 15% or more of their weight (crossed empty symbols). This
experiment was performed once. Original data on mouse weight development are
provided as Source Data files.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 6
7. Evolution from BA.1 to the BA.2 and BA.5 lineages resulted in two
additional RBD amino acid changes (T376A and R408S) located in the
periphery of the TriSb92-binding interface, which was associated with
a modest decrease in sensitivity to TriSb92. Nevertheless, BA.5 was still
very effectively neutralized by TriSb92 with a subnanomolar IC50 value
measured for a clinical isolate (0.83 nM) as well as a corresponding
pseudovirus (0.35 nM). Some of the more recent Omicron variants
(BF.7, BA.2.13, and BA.2.3.20) were equally or even more sensitive to
neutralization compared to BA.5, whereas others (BU.1, XBB, and
BQ.1.1) were 2- to 5-fold less sensitive to the TriSb92. None of these
newer variants contain additional amino changes in the TriSb92
binding region (see Fig. S1. Considering that the mechanism of action
of TriSb92, discussed below, it could be speculated that mutations
elsewhere in the S gene may have provided increased stability for the
pre-fusion conformation of spike proteins encoded by some of the
recent BA.5 subvariants.
In any case, all of the tested variants, including XBB, and BQ.1.1
were potently neutralized by TriSb92. This suggests that TriSb92 is
likely to be effective also against future immune escape variants of
SARS-CoV-2, and considering the high conservation of the TriSb92
target epitope in related animal viruses, it could also be useful as a first
line of defence against pandemic human sarbecoviruses emerging in
the future.
An advantage of sherpabodies over conventional antibodies and
most antibody fragments is that they can be readily assembled into
multimers in a context-independent manner to enhance avidity, spe-
cificity, as well as functionality. The trimeric design of TriSb92 was
chosen considering the trimeric architecture of the SARS-CoV-2 spike
glycoprotein. This provided TriSb92 an impressive capacity for half-
maximal inhibition (IC50) of the SARS-CoV-2 infection at picomolar
concentration despite only a moderately high binding affinity (KD) of
30 nM of the interaction between a monomeric Sb92 sherpabody and
an individual RBD (Wuhan-Hu-1).
Besides its binding avidity, the strong neutralization potency of
the trimeric TriSb92 inhibitor may also to stem from its mode of
action. Instead of competing with the high-affinity interaction between
ACE2 and the RBD of spike, TriSb92 prevents SARS-CoV-2 entry by
triggering a series of conformational changes that initially involve the
positioning of the RBD subunits of the spike trimer. which appear to
trigger additional changes involving the S2 region and loss of a func-
tional prefusion conformation More specifically, our cryo-EM results
indicate that engagement with TriSb92 induces an all three RBDs up
state of spike, as evidenced by the high prevalence of the all up RBD
conformation, which is known to be rare except when induced by a
binding partner29–32
. Interestingly, the binding site of TriSb92 is inac-
cessible in the down-conformation of the RBD. We postulate that once
Fig. 6 | Cryo-EM of SARS-CoV-2 S in complex with TriSb92 reveals the highly
conserved TriSb92 binding site. a Side and top views of the cryoEM reconstruc-
tion of spike trimer in complex with TriSb92. b Locally refined cryoEM recon-
struction of the RBD region, with fitted models of Sb92 (generated with I-TASSER)
and the RBD (PDB 7KMS; https://www.ncbi.nlm.nih.gov/Structure/pdb/7KMS).
c Surface rendering of the RBD with the ACE2 binding site and the TriSb92 epitope
highlighted (upper panel), and the location of amino acid changes in VOCs relative
to the TriSb92 epitope highlighted (lower panel). d Pairwise sequence alignment of
SARS-CoV-1 and SARS-CoV-2. The binding sites of TriSb92 and ACE2 are highlighted
in orange and in purple, respectively. Circles above the RBD residues indicate
amino acid changes in Omicron, Delta, and/or Beta variants, and are coloured as
follows: white is found in Beta or Delta and later (Omicron) variants; mint green is
found in Omicron BA.1 and later subvariants; medium lime green is found in
Omicron BA.2, BA.4/5; dark green is found in the most recent Omicron subvariants.
The mapped amino acid changes and associated variant information are presented
in Fig. S1.
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 7
8. an RBD of the spike samples the up-conformation (the common one
RBD up state), a subunit of TriSb92 binds to the RBD, and the
remaining two free TriSb92 subunits readily sequester ensuing up-
conformations of the two other RBDs until an all-up conformation is
achieved. This model is consistent with our findings that following
TriSb92 treatment, the S-trimer presents primarily in an all-up state
(~54%) fully engaged with the sherpabody, with smaller populations of
mixed up/down and all-down states (Figs. S5, S6). However, the all
three RBDs up state observed in our cryoEM analysis, performed using
a prefusion-stabilized (K986P/V987P mutations) spike ectodomain
with an abrogated furin cleavage site and a C-terminal trimerization
domain, appears to reflect only the initial stage of this inhibitory
conformational change, which in the case of native spike trimer on the
viral membrane results in a more fundamental structural reorganiza-
tion. Treatment of spike-decorated pseudoviral particles with TriSb92
induced an altered conformation in the S2 subunit of spike that was
evidenced by a failure to detect cleaved S2 or S2-containing S0 pre-
cursor protein by Western blotting. Instead, the amount of virion-
associated cleaved S1 protein remained unchanged, indicating that
TriSb92 treatment did not lead to shedding of the S1 subunit, as has
been demonstrated for certain antibodies that target RBD epitopes
overlapping with the TriSb92 binding region33,34
. In agreement, we also
did not observe any decrease in virion attachment to ACE2 receptor-
expressing target cells by TriSb92. Thus, we conclude that the inhibi-
tory mechanism of TriSb92 involves pushing of virion-associated spike
from its native prefusion state into a bona fide post-fusion or another
conformation that cannot support productive viral entry after recep-
tor binding.
TriSb92 was built from a sherpabody clone (Sb92) derived from
phage-library screening without any further affinity optimization.
Thus, it should be relatively facile to achieve an even higher inhibitory
potency by affinity maturation of Sb92 and perhaps also by optimi-
zation of the trimerization linkers in TriSb92. However, this may not be
of great practical relevance considering the already low IC50 con-
centrations of TriSb92 and the ease of producing it in very high
quantities in low-cost bacterial expression systems. Moreover, the
extended on-shelf stability in ambient temperatures render TriSb92 a
suitable candidate for nasal spray products.
Treatment of mice intranasally with as little as 5 ug of TriSb92
could effectively protect them from a subsequent challenge with SARS-
CoV-2. The intranasal dose of TriSb92 that should be administered to
susceptible persons at risk for SARS-CoV-2 exposure remains to be
established but is likely to be substantially lower than extrapolation of
our current data on mice that were challenged by inoculation of a
rather massive amount of SARS-CoV-2 (2 × 105
TCID of B.1.351 or 5 × 106
of maVie16) into their respiratory tract. Likewise, compared to the
current mouse model data the time window allowed for administering
TriSb92 before or after natural SARS-CoV-2 exposure to prevent active
viral replication and disease could be wider. Moreover, even in cases
when TriSb92 would fail to prevent the infection from progressing, by
limiting the early amplification of the virus in the epithelium of the
nasal cavity and nasopharynx and thereby delaying the infectious
process TriSb92 could effectively tip the balance in favour of the host
and thereby help to reduce the risk of severe COVID-19 disease.
The pressure on healthcare systems posed by the continuously
emerging viral variants emphasizes the need for new innovations to
tackle the rapidly evolving immune escape potential of SARS-CoV-2,
and to prepare for future pandemics caused by related sarbecoviruses
evolving in the nature. Our current data show that TriSb92 represents a
valuable addition to the arsenal of available measures for addressing
these challenges.
Methods
Research reported in this study complies with all relevant ethical
regulations, and our animal study protocol has been approved by the
Animal Experimental Board of Finland (license number ESAVI/
28687/2020.
Phage panning
Sherpabody phage display library (size ~1011
cfu) was obtained from
Next Biomed Therapies Oy. To develop sherpabodies specific for
SARS-CoV-2 spike receptor binding domain (RBD), phage affinity
selection process was conducted using standard solid phase sorting
strategy. Specific phage-displayed sherpabodies were selected for by
panning against RBD-mouse IgG2a Fc-fusion protein35
. Three sequen-
tial rounds of off-target depletion and specific panning were per-
formed using a control mFc and specific RBD-mFc, respectively. The
immobilized control and target proteins (30 µg/ml in PBS; Maxisorp
Immunotubes, Nunc) were sequentially incubated in the presence of
infectious naïve sherpabody phage library in 2.5% milk-PBS-0.1%
Tween20, for 2 h (RT) and o/n (4 °C), respectively. Non-specific phages
were removed by extensive washing (PBS-0.05% PBS-Tween), and the
remaining pool of phage were eluted and amplified in E. coli XL1-Blue
host cells (Avantor; #AGLS200249) according to standard protocols.
The amplified pool of phages was collected, and the process was
reiterated over three rounds to enrich phage-displayed sherpabodies
specific to the RBD-target protein.
Screening and characterization of RBD-binding clones by ELISA
Representative transformants from the second and third panning
rounds were tested for specific binding to the RBD-mFc target protein
by enzyme-linked immunosorbent assay (ELISA). Mimicking the affi-
nity selection process, in phage-ELISA the target and control proteins
were immobilized on an immunoplate (Maxisorp, Nunc). Each single
colony represents progeny from a single E. coli cell that harbours a
phagemid expressing a unique sherpabody-pIII fusion protein. Spe-
cifcally, phage-ELISA was performed in 96-well Maxisorp microtiter
plates (Nunc) coated over night at 4 °C with 100 µl (10 µg/ml in PBS) of
target (RBD-mFc) and control proteins (Anti-E-tag antibody; GE
Healthcare; cat# 27941201 V; lot# 355351). The wells were washed 3 x
with PBS-0.05% Tween20 and blocked with 5% skimmed milk powder
in PBS (milk-PBS) for 2 h at RT. Appropriate dilutions of sherpabody-
displaying single phage clones were prepared in milk-PBS and incu-
bated with the coated target protein for 1 h at RT followed by washes 3
x with PBS-0.05% Tween20 to remove unbound phage. The detection
was performed with HRP-conjugated mouse monoclonal anti-M13
antibody (1:5000; GE Healthcare/Cytiva; Cat# RPN1236; Lot# 385982)),
and TMB (3,3’ 5,5’-tetramethylbenzidine) substrate (Thermo Fisher;
Cat#34028). The staining reaction was stopped with 1 M sulfuric acid
and absorbance measured at 450 nm using Hidex Sense Microplate
Reader. The DNA encapsulated by the positive phage clones was then
sequenced and translated to determine the sequence of the displayed
sherpabody.
Sherpabody production and purification
The discovered unique sherpabodies were cloned and expressed in E.
coli as monomeric and/or trimeric GST-fusion proteins using standard
protocols (GE Healthcare). 15 mer Gly-Ser, (GGGGS)3, linkers were
applied in between each fusion partner. GST-tagged sherpabodies
were purified by affinity chromatography using glutathione sepharose
according to manufacturer’s instructions (GE Healthcare). The buffer
was exchanged to PBS by dialysis (140 mM NaCl, 10 mM phosphate
buffer, 3 mMKCl, pH 7.4), and the purified sherpabodies were stored at
−80 °C, −20 °C and/or at + 4 °C.
ELISA
Affinity analysis by semi-quantitative sandwich-ELISA was performed
using plastic-coated (o/n, 4 °C) GST-sherpabody fusion protein fol-
lowed by binding of a concentration series of soluble RBD-His target
protein35
(1 h, RT). The washes and detection was performed as
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 8
9. described above using monoclonal HRP-conjugated anti-His antibody
(1:5000; Invitrogen; Cat# MA1-21315-HRP; Lot# 2312647).
GST-Sb92/RBD-His/ACE2-mFc sandwich-ELISAs were performed
in two ways: first using plastic-coated GST-Sb92 as the capturing
reagent (10 µg/ml) and ACE2-mIgG2a as the detection reagent (10 µg/
ml) and then vice-versa (10 µg/ml and 5 µg/ml, respectively) to ana-
lyse their ability to simultaneously bind to RBD-His35
(2-fold dilution
series starting from 10 µg/ml). The complex formation was detected
using either HRP-conjugated goat anti-Mouse-IgG (Sigma Aldrich;
1:5000) or mouse monoclonal anti-GST (1:5000; GE Healthcare; Lot#
17007382)) antibodies. Her2-binding GST-Sb1206 served as a nega-
tive control.
The specificity (off-target) of TriSb92 binding to RBD was inves-
tigated by ELISA. Whole cell lysates of primary human nasal epithelial
cells (HNECs; see isolation protocol below) were prepared by lysing
106
cells/ml in ice cold Lysis buffer (50 mM Tris pH 7.4, 150 mM NaCl,
1% NP-40, 1 mM EDTA) for 30 min, on ice (vortexing every 5–10 min).
Nunc Maxisorp 96-well plates were coated with the concentrated cell
lysates o/n, + 4 °C (100 µl/well, 1:100 in PBS). Whole cell lysate derived
from HNECs transduced with an adenoviral vector directing the
expression of cell-surface expressed RBD of SARS-CoV-2 spike protein
were used as a positive control. The ELISA was performed similarly as
described above using standard protocols.
Neutralization assays
HEK293T (ATCC; Cat# CRL-3216) and HEK293T-ACE2 cells were
maintained in DMEM supplemented with 10% fetal bovine serum, 2% L-
Glutamine, and 1% penicillin/streptomycin (complete medium).
Angiotensin-converting enzyme 2 (ACE2) expressing HEK293T cells
were generated by lentivirus-mediated gene transduction. Briefly,
pWPI-puro plasmid containing ACE2 cDNA (AB046569.1) was co-
transfected with p8.9NdSB and vesicular stomatitis virus G protein
(VSV-G) expressing envelope plasmids into HEK293T cells in complete
medium using polyethylenimine. The recombinant lentivirus contain-
ing supernatant was collected 48 h post-transfection, filtered and used
to infect wild-type HEK293T cells. Transduced cells were selected with
puromycin.
Luciferase encoding SARS-CoV-2 pseudotyped reporter virus was
generated by transfecting HEK293T cells with p8.9NdSB, pWPI-GFP
expressing Renilla luciferase, and pCAGGS, an expression vector con-
taining the SARS-CoV-2 S protein cDNA of the Wuhan-Hu-1 reference
strain (NC045512.2). The last 18 amino acids containing an endo-
plasmic reticulum (ER)-retention signal of the spike protein was
removed to enhance transport to the plasma membrane. SARS-CoV-1
pseudovirus was similarly constructed. Pseudovirus stocks were har-
vested 48 h after transfection, filtered and stored at −80 °C. Inserts for
the pseudotyping expression vectors producing spike glycoproteins
encoded by the original Wuhan-Hu-1 strain (with D614G mutation) or
its variants B.1.351 (Beta), B.1.617.2 (Delta), and B.1.1.529 (Omicron),
including the subvariants BA.1, BA.3, BA.2, BA.2.13, BA.4/5, BA.2.3.20,
BF.7, BQ.1.1, XBB, BU.1, or SARS-CoV-1 were assembled from synthetic
DNA fragments (Integrated DNA Technologies) using Gibson assembly
cloning kit (New England Biolabs; Cat1 E5510S) and veri fied by DNA
sequencing.
To assess its neutralizing activity TriSb92 was serially diluted in
complete medium. 12.5 µl of TriSb92 dilutions were mixed with 37.5 µl
of luciferase encoding SARS-CoV-2 pseudotyped reporter viruses in
96-well cell culture plates and incubated at 37 °C for 30 min. After
incubation, 20,000 HEK293T-ACE2 cells (in 50 µl) were added to the
wells and the plates were further incubated at 37 °C for 48 h. The
amount of internalized pseudovirus in infected cells was quantified by
measuring luciferase activity using Renilla-GLO assay (Promega; Cat6
E2710). The relative luciferase units were normalized to those of con-
trol samples. The pseudovirus neutralization experiments were repe-
ated independently three or more times with similar results. The
average and standard deviations of representative assays performed in
duplicates is shown.
To assess the inhibitory activity of TriSb92 against clinical virus
isolates, the neutralization was performed as described above for the
pseudoviruses with the following modifications: 40 000 VeroE6-
TMPRSS2-H10 cells36
were seeded per well and mixed with virus-
inhibitor mixture, which was replaced with complete DMEM 1 h post
infection (p.i) at 37 °C. Nine hours later the cells were fixed with 4%
paraformaldehyde, permeabilized with 3% BSA-PBS-0.3 % Triton-X100,
and labelled with rabbit polyclonal anti-SARS-CoV-2 nucleoprotein
(NP; 1:1000; Rockland Immunochemicals; Cat3 200-401-A50; Lot7
200-402-A50) primary antibody and goat Alexa Fluor 488-conjugated
(Invitrogen; 1:5000) anti-rabbit polyclonal secondary antibody. The
cell nuclei were visualized by Hoechst staining, and the percentage of
cells that labelled positive for SARS-CoV-2 NP was quantified using
Opera Phenix High Content Screening System (PerkinElmer). Each
experimental condition involved five replicate wells, and an average of
15,000 cells (total > 70,00 per condition) per well were analyzed.
Neutralization of authentic viruses were repeated with similar results
three times for Wuhan, twice for Delta, BA.1, and BA.5 and once for
Beta in experiments performed in duplicate and involved counting of
approximately 25,000 cells per condition after immunostaining illu-
strated in the figure insert. The original data are provided as a Source
Data file
The clinical isolates used in this study were isolated in Finland
from patient nasopharyngeal samples. Beta variant is the isolate hCoV-
19/Finland/THL-202101018/2021 (EPIISL_3471851), Delta is hCoV-19/
Finland/THL-202117309/2021 (EPI_ISL_2557176), Omicron/BA.1 is
hCoV-19/Finland/THL-202126660/2021 (pending for the Gisaid ID),
Omicron/BA5.1 is hCoV-19/Finland/THL-202213593/2022 (EPI_ISL_
13118918, GeneBank ID OP435368). Viruses were propagated in
VeroE6-TMPRSS2-H10 cells36
. The generation of mouse-adapted
maVie16 SARS-CoV-2 is described elsewhere17
. All cell lines used had
a well-traceable origin and were authenticated in our laboratory by
light microscopic morphological analysis only. All cells lines have been
tested negative for mycoplasma contamination. No commonly mis-
identified cells were used in the study.
Cell viability assay
Primary human nasal epithelial cells (HNECs) were isolated by brushing
from the nasal cavity of a male donor after informed consent. The
isolated cells were cultured and maintained in PneumaCult™-Ex Plus
Basal Medium supplemented with 1x PneumaCult™-Ex Plus Supple-
ment, 1x hydrocortisone (200x stock solution 96 µg/ml) and 1x
penicillin-streptomycin (all from StemCell Technologies). For cell
expansion, the culture flasks and plates were coated with Collagen
Solution according to manufacturer’s instructions, and Animal
Component-Free Cell Dissociation Kit was used for dissociation and
passaging (all from StemCell Technologies).
For the cell viability assay, HNECs were cultured on an opaque-
walled 96-well plate (10 000 cells/well) for 24 h, and then treated with a
2-fold concentration series of TriSb92 diluted in complete culture
medium (starting from 1 mg/ml) for 24 h at 37 °C. NaN3 (5%) served as a
cytotoxic drug control. Cell viability was measured using CellTiter-Glo
2.0 Assay (Promega; Cat# E2710) according to manufacturer’s
instructions.Average and standard deviations of a representative assay
performed in triplicates were calculated.
Stability of TriSb92 during long-term on-shelf storage
The stability of TriSb92 after long-term storage in different tempera-
tures was investigated using pseudovirus neutralization assay using
Wuhan-Hu-1 reference strain. TriSb92 was stored as 1 mg/ml stocks in
PBS (140 mM NaCl, 10 mM phosphate buffer, 3 mM KCl, pH 7.4) in
room temperature [RT; + 21–25 °C], fridge [+6–8 °C] or freezer [–20 °C
or –80 °C] for 1–15 months (mo).
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 9
10. Animal studies
Balb/c mice (Envigo) were transported to the University of Helsinki
(Finland) biosafety level 3 (BSL-3) facility and acclimatized to indivi-
dually ventilated biocontainment cages (ISOcage; Scanbur) for seven
days with ad libitum water and food (rodent pellets). The mice were
kept 4–6 h in the light during the day time, and the rest of the day i.e.,
18–20 h in the dark. The temperature and humidity in the BSL-3
laboratory and cages was kept between 21–23 °C and 25–35%, respec-
tively. After the acclimatization period, 9-week old female Balb/c were
placed under isoflurane anesthesia and intranasally inoculated with
25 µl per nostril of TriSb92 (25 or 2.5 µg/nostril). The mice were chal-
lenged by infection with 20 µl of SARS-CoV-2 B.1.351 clinical isolate
(2 × 105
PFU) or with mouse-adapted maVie16 SARS-CoV-217
(0.5–1 x 106
PFU). Immediately following the inoculation, the isoflurane was swit-
ched off and the animals were held in an upright position for a few
seconds to allow the liquid to flush downwards in the nasal cavity. All
mice were weighed on a daily basis, and their wellbeing was carefully
monitored throughout the experiment for signs of illness (changes in
posture or behaviour, rough coat, apathy, ataxia and weight loss), but
none of the mice showed any clinical signs. Euthanasia was performed
2 days post infection under terminal isoflurane anesthesia with cervical
dislocation. All animals were dissected immediately after death and the
right lungs collected for virological examination. The left lung,
remaining thoracic organs and heads (animals from the first experi-
ment) were fixed in 10% buffered formalin for 48 h and stored in 70%
ethanol for histological and immunohistochemical examinations.
RNA isolation and RT-PCR
RNA was extracted from the right lung of the mice using Trizol
(Thermo Scientific) according to the manufacturer’s instructions. Iso-
lated RNA was directly subjected to one-step RT-qPCR analysis using
TaqMan fast virus 1-step master mix (Thermo Scientific) and AriaMx
instrumentation (Agilent) as described previously for E and subE
genes37
. The RT-qPCR for actin was conducted as previously described
in ref. 38
. Relative quantification of actin-normalized viral RNA levels
was achieved by the comparative Ct method39
using the average of
non-treated animals as reference.
Histology and immunohistochemistry
The left lung, remaining thoracic organs and heads were trimmed for
histological examination. Heads were sawn longitudinally in the mid-
line using a diamond saw (Exakt 300; Exakt) and gently decalcified in
RDF (Biosystems) for 5 days at room temperature and on a shaker.
Tissues were routinely paraffin wax embedded. Consecutive sections
(3–5 µm) were prepared from lungs and heads and routinely stained
with hematoxylin-eosin (HE) or subjected to immunohistochemistry
for the detection of SARS-CoV-2 antigen, as previously described
in ref. 16
.
Recombinant SARS-CoV-2 S trimer production and complex
formation
To express the SARS-CoV-2 S, a gene encoding for the prefusion sta-
bilized S protein ectodomain19
was produced as synthetic cDNA
(GeneArt, Life Technologies). The cDNA template encoded for the
residues 14 − 1208 of the original Wuhan-Hu-1 strain S protein (NCBI
Reference Sequence: YP_009724390.1) with prefusion-stabilizing pro-
line substitutions at residues 986 and 987, an abrogated furin S1/S2
cleavage site with a GSAS substitution at residues 682–685, and a
C-terminal T4 fibritin trimerization motif followed by an HRV3C pro-
tease cleavage site, SpyTag003, and 8xHisTag. The gene was cloned
into the mammalian expression vector pHLsec (Adgene) and trans-
fected into Expi293F™ (Thermo Fisher Scientific) suspension cells at a
density of 3 × 106
cells per ml using the ExpiFectamine™ 293 Trans-
fection Kit (Thermo Fisher Scientific). Following 6 days of cultivation
on an orbital shaker a 36.5 °C and 5% CO2, the S protein containing
supernatant was collected, clarified by centrifugation, and filtered
through a 0.45 µM filter. Imidazole was added to the supernatant to
3 mM final concentration, and SARS-CoV-2 S protein was purified from
the supernatant by immobilized nickel affinity chromatography with a
1 ml HisTrap excel column (Cytiva) using 300 mM imidazole for elu-
tion. S-protein containing eluate was concentrated and buffer
exchanged to 10 mM Tris pH 8 + 150 mM NaCl buffer using an Amicon
Ultra centrifugal filter (MWCO 100 kDa, Millipore). Prior to grid pre-
paration, pure TriSb92 was added to a purified S-trimer aliquot at 1.5x
molar excess, and the complex was incubated on ice for 15 min.
Cryo-EM grid preparation, data acquisition and data processing
A 3 μl aliquot of a pure, prefusion SARS-CoV-2 S-trimer (0.3 mg/ml)
mixed with TriSb92 (0.05 mg/ml) was applied on Quantifoil 1.2/1.3
grids (1.2 μm hole diameter, 200 mesh copper) that had been glow
discharged in a plasma cleaner (PDC-002-CE, Harrick Plasma) for 30 s.
The grids were blotted for 8 s and plunged into liquid ethane using a
vitrification apparatus (Vitrobot, Thermo Fisher Scientific). Data were
collected on a Titan Krios transmission electron microscope (Thermo
Fisher Scientific) equipped with Gatan K2 direct electron detector
using electron exposure of 55 e−
/Ų per image at a nominal magnifi-
cation of 165,000x, resulting in a pixel size of 0.82 Å (Table S1). Data
were processed in cryoSPARC40
(Fig. S5). Contrast transfer function
parameters were estimated by CTFFIND441
. Particles were picked with
Topaz42
, using a subset of S-trimer particles first pruned by 2D classi-
fication as the training set. After another round of 2D classification to
discard false positive particles, an initial volume of the S trimer was
calculated ab initio. After 3D refinement of particle poses and shifts,
local motion correction, extraction of particles with box size of 512x512
and second round of refinement with C3 symmetry, the symmetry was
expanded, and the particles were subjected to 3D variability analysis43
which focused to the RBD region. This revealed three main classes of
particles: all RBDs up, all RBDs down, and a mixed up and down
population (Fig. S5, Fig. S6). Maps of the all up and all down classes
were reconstructed with non-uniform refinement. A map for all RBDs
down (reconstruction B) class was calculated applying C3 symmetry,
after removing the symmetry copies created by symmetry expansion.
For all RBDs up map, no symmetry was applied (reconstruction A).
Instead, the RBD region density was further refined by local, focused
refinement using particles where the bulk of the S-trimer density had
been subtracted. The resulting maps were filtered to local resolution
for further analysis. CryoEM data collection and processing statistics
are presented in Table S1.
Fitting SARS-CoV-2 S and Sb92 into the cryo-EM reconstructions
A molecular model of the SARS-CoV-2 S-trimer, derived from PDB
7KMS44
, was docked into our reconstruction A of the SARS-CoV-2 spike
using the fitmap function in UCSF ChimeraX45
. In short, a map was
simulated for the S-trimer structure to the resolution of 2.9 Å, to match
the resolution of the spike reconstruction, and fitting was performed
using fitmap global search. The top solution yielded a map-to-map
correlation score of 0.78, confirming that, similar to structure 7KMS,
our reconstruction of the S-trimer displays a 3-up RBD conformation.
We observed that the innate flexibility of RBDs resulted in weaker
density features in RBD regions of the full spike reconstruction, and so,
RBDs were modelled into locally refined RBD-region density (Figs. S5,
S8). First, an RBD was separated from the 7KMS spike structure in
Coot46
and fitted into the locally-refined RBD region reconstruction
using fitmap in ChimeraX, yielding a correlation score of 0.86. Fur-
thermore, additional density not comprised of the S-protein was
observed adjacent to each RBD (Fig. 6). To confirm whether this den-
sity wascomprised of Sb92, the cryoEM reconstructionwas segmented
around the RBD using color zone (coloring radius of 2.5 Å) and split
map functions in Chimera, followed by fitting a model of Sb92, pre-
dicted by I-TASSER21
to high confidence (C-score 0.51) and geometry
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 10
11. optimized in Phenix47
, into the additional density with a fitmap global
search. The top solution placed Sb92 into the density adjacent to RBDs
with a correlation score of 0.78. Furthermore, this sherpabody place-
ment reveals that the RT-loop, which contains antigen-binging muta-
tions in Sb92 (Fig. 1), forms a key interface with the RBD (Fig. S8).
Residues comprising the RT-loop were refined into the density using
ISOLDE48
within ChimeraX. Finally, three copies of the RBD−Sb com-
plex were fitted back into the reconstruction of the full spike (recon-
struction A) and connected to the rest of the fitted spike derived from
7KMS in Coot, completing the model of the SARS-CoV-2 spike in
complex with Sb92.
Our second reconstruction B (Fig. S7), was validated as a closed
conformation by fitting a SARS-CoV-2 structure (PDB 6ZP049
, pre-
senting a 3-down RBD conformation) into the density. Fitmap global
search was performed between a map simulated for structure 6ZP0 at
resolution of 3.1 Å, and our cryoEM reconstruction B, yielding a map-
to-map correlation score of 0.76 and leaving no unexplained density.
Molecular graphics and protein interface analysis
Molecular graphics images were generated using PyMOL (The PyMOL
Molecular Graphics System, Version 2.5.0, Schrödinger, LLC) and
C5151
himeraX v1.5, developed by the Resource for Biocomputing,
Visualization, and Informatics at the University of California45
. Resi-
dues comprising the interface of SARS-CoV-2 S with ACE2 receptor and
inhibitors, including TriSb92 and therapeutic monoclonal antibodies,
were identified using the PDB ePISA server.
Reporting summary
Further information on research design is available in the Nature
Portfolio Reporting Summary linked to this article.
Data availability
The cryo-EM density maps of i) SARS-CoV-2 spike with RBDs in the
“up”-conformation and decorated with TriSb92 (accession code EMD-
16383) and ii) SARS-CoV-2 spike with RBDs in the “down” conformation
(EMD-16388) have been deposited in the EMDB at the EBI. Coordinates
of the fitted SARS-CoV-2 spike in complex with Sb92 have deposited in
the PDB (accession code PDB 8C1V). All data generated or analysed
during this study are included in the main text and its supplementary
information files. Other structures used in this study were obtained
from the PDB with accession codes 1S1N (nephrocystin SH3 domain),
7KMS (SARS-CoV-2 S-trimer with all RBDs in the up conformation
bound to ACE2), 6ZP0 (SARS-CoV-2 S-trimer with all RBDs in the down
conformation), 7A29 (sybody-bound SARS-CoV-2 spike), and 6W41,
7KMG, 7C01, 6XDG RBD-Fab complexes. Source data are provided with
this paper.
References
1. Hou, Y. J. et al. SARS-CoV-2 reverse genetics reveals a variable
infection gradient in the respiratory tract. Cell 182,
429–446.e414 (2020).
2. Baum, A. et al. REGN-COV2 antibodies prevent and treat SARS-CoV-2
infection in rhesus macaques and hamsters. Science 370, 1110–1115
(2020).
3. Huo, J. et al. A potent SARS-CoV-2 neutralising nanobody shows
therapeutic efficacy in the Syrian golden hamster model of COVID-
19. Nat. Commun. 12, 5469 (2021).
4. Ku, Z. et al. Nasal delivery of an IgM offers broad protection from
SARS-CoV-2 variants. Nature 595, 718–723 (2021).
5. Nambulli, S. et al. Inhalable Nanobody (PiN-21) prevents and treats
SARS-CoV-2 infections in Syrian hamsters at ultra-low doses. Sci.
Adv. 7, eabh0319 (2021).
6. Wu, X. et al. A potent bispecific nanobody protects hACE2 mice
against SARS-CoV-2 infection via intranasal administration. Cell
Rep. 37, 109869 (2021).
7. Du, L., Yang, Y. & Zhang, X. Neutralizing antibodies for the pre-
vention and treatment of COVID-19. Cell Mol. Immunol. 18,
2293–2306 (2021).
8. Wrapp, D. et al. Structural basis for potent neutralization of beta-
coronaviruses by single-domain camelid antibodies. Cell 181,
1004–1015.e1015 (2020).
9. Schoof, M. et al. An ultrapotent synthetic nanobody neutralizes SARS-
CoV-2 by stabilizing inactive Spike. Science 370, 1473–1479 (2020).
10. Xiang, Y. et al. Versatile and multivalent nanobodies efficiently
neutralize SARS-CoV-2. Science 370, 1479–1484 (2020).
11. Xu, J. et al. Nanobodies from camelid mice and llamas neutralize
SARS-CoV-2 variants. Nature 595, 278–282 (2021).
12. Simeon, R. & Chen, Z. In vitro-engineered non-antibody protein
therapeutics. Protein Cell 9, 3–14 (2018).
13. le Maire, A. et al. Solution NMR structure of the SH3 domain of
human nephrocystin and analysis of a mutation-causing juvenile
nephronophthisis. Proteins 59, 347–355 (2005).
14. Crawford, K. H. D. et al. Protocol and reagents for pseudotyping
lentiviral particles with SARS-CoV-2 spike protein for neutralization
assays. Viruses 12, 513 (2020).
15. Cao, Y. et al. BA.2.12.1, BA.4 and BA.5 escape antibodies elicited by
Omicron infection. Nature 608, 593–602 (2022).
16. Kant, R. et al. Common laboratory mice are susceptible to infection
with the SARS-CoV-2 beta variant. Viruses 13, 2263 (2021).
17. Gawish, R. et al. ACE2 is the critical in vivo receptor for SARS-CoV-2
in a novel COVID-19 mouse model with TNF- and IFNgamma-driven
immunopathology. Elife 11, e74623 (2022).
18. Shang, J. et al. Structural basis of receptor recognition by SARS-
CoV-2. Nature 581, 221–224 (2020).
19. Walls, A. C. et al. Structure, function, and antigenicity of the SARS-
CoV-2 spike glycoprotein. Cell 181, 281–292.e286 (2020).
20. Yuan, Y. et al. Cryo-EM structures of MERS-CoV and SARS-CoV
spike glycoproteins reveal the dynamic receptor binding domains.
Nat. Commun. 8, 15092 (2017).
21. Yang, J. & Zhang, Y. I-TASSER server: new development for protein
structure and function predictions. Nucleic Acids Res 43,
W174–W181 (2015).
22. Yuan, M. et al. A highly conserved cryptic epitope in the receptor
binding domains of SARS-CoV-2 and SARS-CoV. Science 368,
630–633 (2020).
23. Planas, D. et al. Reduced sensitivity of SARS-CoV-2 variant Delta to
antibody neutralization. Nature 596, 276–280 (2021).
24. Planas, D. et al. Sensitivity of infectious SARS-CoV-2 B.1.1.7 and
B.1.351 variants to neutralizing antibodies. Nat. Med 27,
917–924 (2021).
25. Chen, R. E. et al. In vivo monoclonal antibody efficacy against SARS-
CoV-2 variant strains. Nature 596, 103–108 (2021).
26. Dong, Y. et al. The way of SARS-CoV-2 vaccine development: suc-
cess and challenges. Signal Transduct. Target Ther. 6, 387 (2021).
27. Schmidt, F. et al. Plasma neutralization properties of the SARS-CoV-
2 Omicron variant. medRxiv. (2021).
28. Tada, T. et al. Partial resistance of SARS-CoV-2 Delta variants to
vaccine-elicited antibodies and convalescent sera. iScience 24,
103341 (2021).
29. Barnes, C. O. et al. Structures of human antibodies bound to SARS-
CoV-2 spike reveal common epitopes and recurrent features of
antibodies. Cell 182, 828–842.e816 (2020).
30. Ke, Z. et al. Structures and distributions of SARS-CoV-2 spike pro-
teins on intact virions. Nature 588, 498–502 (2020).
31. Yan, R. et al. Structural basis for the different states of the spike
protein of SARS-CoV-2 in complex with ACE2. Cell Res. 31,
717–719 (2021).
32. Lu, M. et al. Real-Time Conformational Dynamics of SARS-CoV-2
Spikes on Virus Particles. Cell Host Microbe 28, 880–891.e888
(2020).
Article https://doi.org/10.1038/s41467-023-37290-6
Nature Communications| (2023)14:1637 11