Pioneer dehradun-english-edition-2021-08-08

20?BD;4
?>;8241D8;3B0:4B785C
F0;;DCB834A435AC
=Tf3T[WX)CWT3T[WX?^[XRT
WPbTaTRcTSPfP[[ÛbWX__X]V
R^]cPX]TabPccWTPX]VPcTÛ
ATS5âcUâbTRdaXchaTPb^]b
PWTPSÛ8]ST_T]ST]RT3Ph
RT[TQaPcX^]bÛUXRXP[bbPXS^]
BPcdaSPhCWTR^]cPX]Tab
WPeTQTT]_[PRTSX]bdRWP
fPhcWPc]^^]TXbPQ[Tc^
bTTX]bXSTcWT_aTXbTbÛcWT
dVWP[TaPUâcUa^fWTaT
cWT?aXTX]XbcTaPSSaTbbTb
cWT]PcX^]^]8]ST_T]ST]RT
3PhPbT]Xâ_^[XRTÛUXRTa
bPXS
C0;810=4=C4A=AC7
05?AE8=280;20?8C0;
:PQd[)CP[XQP]UXVWcTabT]cTaTS
cWTRP_XcP[Û]âcWTa]
0UVWP]XbcP]³b9PfiYP]_aêX]RT
^]BPcdaSPhP_aêX]RXP[
[PfPZTabPXSPUcTabfTT_X]V
cWa^dVW]X]TÛ SXbcaXRcbX]
cWT_aêX]RTCWT6êTa]T]c
SXS]^cST]h[PfPZTa
^WPPS:PaX9PfiYP]X³b
R[PXcWPcCP[XQP]UXVWcTabWPS
T]cTaTSBWTQTaVWP]QdcbPXS
cWTRXchWPS]^cUP[[T]8UcWT
RXchUP[[bXcfX[[QTcWTbTR^]S
_aêX]RXP[RP_XcP[
X]PbP]hSPhbc^bdRRdQc^
cWTCP[XQP]BTeTaP[^cWTaÛ
cWTR^d]cah³b#_aêX]RXP[
RP_XcP[bPaTcWaTPcT]TS
?VVcR[dX`]UV_Rc^VRc_d:_UZR^RZUV_ReY]VeZTWVRe
?C8Q C:H
They called it the Olympics
like no other and India
would agree as debutant javelin
thrower Neeraj Chopra shat-
tered several glass ceilings to
become the country’s first gold-
medallist in 13 years, his stu-
pendous show making it the
best ever Games for a nation
starved for success at the
grandest sporting spectacle.
With the addition of
Chopra’s gold on the last
day of their competitive sched-
ule, India signed off with seven
medals in all, including two sil-
ver and four bronze, the last of
which was delivered by super-
star wrestler Bajrang Punia on
the day.
In shoring up India’s per-
formance, Chopra achieved
several firsts.
He became the
youngest Indian to win an
Olympic gold, the first in
track-and-field to do
so and the only one to
do it in his debut
Games.
At 23, he
joined Abhinav
Bindra in the select
gold club but beat
him on age as the latter
was 25 when he claimed
the top prize in the 2008 Beijing
Games.
With this, the coun-
try surpassed the previ-
ous best haul of six
medals achieved in the
2012 London Games
where there was
no gold.
It was also
the first time that
India picked up medals
across so many varied disci-
plines. There were weightlift-
ing and wrestling silver
medals through Mirabai
Chanu and Ravi Dahiya
respectively.
And the four bronze
medals came from badminton
star P V Sindhu, boxer Lovlina
Borgohain, Punia and the
men’s hockey team, which fin-
ished on the podium for the
first time in 41 years.
Chopra saved the best
moment for the last.
The 23-year-old son of a
farmer from Khandra village
near Panipat in Haryana pro-
duced a second round throw of
87.58m in the finals, which
nobody in a field of 12 could
come anywhere close to.
Brimming with confidence
with hardly any nerves on dis-
play and just the way he did it
in the qualification round
three days back,
Chopra began with a
bang by sending the
spear to a distance
of 87.03m and
then improved
it to 87.58m,
his best of the day.
“It feels unbeliev-
able. It is the first time India
has won a gold in athletics, so
I feel very good. We have just
one gold here in other
sports,” he said after the
triumph that would
immortalise him as a
great.
“This is our first
Olympic medal for a
very long time, and in
athletics it is the first
time we have gold,
so it’s a proud
moment for me
and my country.
“ M i l k h a
Singh wanted
to hear the
national anthem in a stadium.
He is no longer with us but his
dream has been fulfilled,” the
23-year-old javelin thrower
said dedicating the achieve-
ment to the iconic sprinter,
who had finished fourth in
the 1960 Rome Olympics.On
the wrestling mat, Punia pulled
off a bronze medal on Olympic
debut after outwitting Daulet
Niyazbekov in the men’s
freestyle 65kg play-off.
The medal-winning per-
formance saved the 27-year-old
and the Indian wrestling con-
tingent from embarrassment
since the wrestlers had entered
Tokyo with high expectations.
“I am not happy. This is not
the result I had set out to
achieve. Winning an Olympic
medal is no mean achievement
but I can’t jump with joy with
bronze,” Bajrang told PTI.
The country also raised a
toast to golfer Aditi Ashok, who
came very close to a eagerly-
anticipated medal before end-
ing fourth.
:_UZR¶dSVdeVgVc
@]jâZTYRf]
3R[cR_XSRXd
hcVde]Z_X3c`_kV
?C8Q 270=3860A7
Cash rewards to the tune of
C9 crore poured in for star
javelin thrower Neeraj Chopra,
who on Saturday won India’s
first ever track-and-field
Olympic medal with
a gold-medal winning feat at
Tokyo Games.
After Chopra secured
India’s second individual gold
in Olympic history with a sen-
sational performance, Chief
Minister of Haryana Punjab
ML Khattar and Amarinder
Singh announced cash rewards
of C6 crore and 2 crore respec-
tively.
The BCCI announced that
C1 crore has been reserved for
Chopra, who produced a sec-
ond round throw of 87.58m in
the finals to stun the athletics
world and end India’s 100-
year wait for a track and field
medal in the Olympics.
Khattar announced that
Chopra will be made head of
upcoming Centre for
Excellence in Athletics in
Panchkula.
9RcjR_RAf_[RSR__`f_TV
TRdYRhRcUdW`c4YàcR
?C8Q C:H
Indian women’s hockey team
skipper Rani Rampal on
Saturday condemned the
allegedly casteist abuse that
her teammate Vandana
Katariya’s family has faced,
saying that it was nothing short
of shameful.
The family of Katariya,
who scored four goals during
the Olympics, found itself at the
receiving end of allegedly
casteist slurs from few people
in their neighbourhood in
Haridwar after the team lost the
semi-final clash against
Argentina on Wednesday.
“It’s such a bad thing which
has happened. We work so
hard to represent our country.
Stop all these things like dis-
criminating on religion,
casteism because we work
above all these things,” Rani
said during a Press conference.
India finished fourth in the
Games after going down to
Great Britain 3-4 in an intense-
ly fought bronze play-off.
“We come from different
parts of India, follow different
religions. But when we come
here we work together for
India. It’s so shameful when we
see people indulging in such
behaviour,” Rani said.
“But there are also people
who have given us so much
love even though we didn’t win
a medal. So they should learn
from such people. If we want to
make India a hockey nation, we
need everyone,” she added.
6KDPHIXO5DQL
FRQGHPQVFDVWHLVW
VOXUVKXUOHGDW
.DWDULD¶VIDPLO
1PYaP]V?d]XPRT[TQaPcTbPUcTaSTUTPcX]V:PiPZWbcP]b3Pd[Tc=XhPiQTZêSdaX]V
cWTXaT]´bUaTTbch[T%$ZVfaTbc[X]V1a^]iTTSP[PcRWPccWT!![h_XRb^]
BPcdaSPh ?C8
A0:4B7:B8=67Q =4F34;78
The overall terrorist violence
in the Union Territory of
Jammu Kashmir has
declined by 40 per cent as com-
pared to last year, but capital
Srinagar has emerged as a
hotspot of terrorist violence
with an increase in the number
of terror incidents reported
from the city.
Srinagar alone recorded
terror-related 16 incidents, 21
per cent of a total of 75 inci-
dents reported from across
the Valley till so far this year.
All the parameters of terrorist
violence in Srinagar have sur-
passed those from the tradi-
tional hotbed of terrorism in
Pulwama, Anantnag and
Shopian.
The findings are part of an
internal assessment of the
Central Reserve Police Force
(CRPF), a key stakeholder of
anti-terrorist operations as
also law and order roles in the
Valley as well as the
Intelligence Bureau (IB)
accounting for terror incidents
reported in the Valley till June
this year.
“During the last over one
month, five more terror inci-
dents have been added to the
list. Youths from the educated
and affluent class residing in
Srinagar joining the terror fold
have further emerged as a
major challenge for the securi-
ty establishment in the Valley,”
a senior CRPF official said.
According to the report,
“Srinagar emerges as the
hotspot of terrorists. Incidents
(are) being driven by TRF.”
Srinagar has also reported
the maximum security forces’
casualty in action this year. Of
the 15 casualties reported
across the valley this year, eight
comes from Srinagar.
Srinagar has recorded the
presence of a maximum num-
ber of terrorists and recoveries
of IEDs. The surge in violence
in Srinagar is being driven by
Pakistani terror group Lashkar-
e-Tayabba (LeT)’s front — The
Resistance Front (TRF).
?=BQ =4F34;78
Indian Covid-vaccine basket
has expanded with the sin-
gle dose Covid-19 vaccine
Janssen, manufactured by US
pharma giant Johnson and
Johnson, becoming the fifth
jab to get Emergency Use
Authorisation (EUA) by the
Government on Friday. The
four other Covid-19 vaccines
already approved by the
Government are Covishield,
Covaxin, Sputnik V and
Moderna.
“India expands its vac-
cine basket! Johnson and
Johnson’s single-dose Covid-
19 vaccine is given approval
for Emergency Use in India.
Now India has 5 EUA vac-
cines,” Union Health Minister
Mansuk Mandaviya tweeted.
JJ had applied for EUA
for its jab on Friday and was
granted the approval the same
day by the Drugs Controller
General of India (DCGI).
?=BQ =4F34;78
Days after the National
Commission for
Protection of Child Rights
(NCPCR) issued a notice to
Twitter India seeking action
against Congress leader Rahul
Gandhi for revealing the iden-
tity of a minor who was raped
and murdered, the micro-blog-
ging platform has taken down
his controversial tweet. A click
on the tweet led to a message
that read, “This tweet violated
the Twitter rules.”
Posting a picture of his
meeting with the minor’s fam-
ily earlier on Wednesday, Rahul
had tweeted in Hindi, “Parents’
tears are saying only one thing
— their daughter, the daughter
of this country, deserves justice.
And I am with them on this
path to justice.”
The action from Twitter
comes after the NCPCR had
asked the Delhi Police and the
microblogging site to take
action over Rahul posting the
photo of the girl’s family.
Following Rahul’s tweet, a
complaint was lodged with the
Delhi Police against the
Congress leader for disclosing
Delhi’s Nangal rape victim’s
identity and thus violating sec-
tion 23 of Protection of
Children from Sexual Offences
(POCSO) Act, 74 of Juvenile
Justice (Care and Protection of
Children) Act, 228A of the IPC.
Meanwhile, a Delhi-based
lawyer Vineet Jindal has filed a
police complaint against Rahul
for disclosing the rape victim’s
identity.
BC055A4?AC4AQ =4F34;78
A27-year-old man, disguised
as balloon seller, was
arrested from West Delhi’s
Jaffarpur Kalan in Dwarka area
for supplying firearms to gang-
sters in Delhi and NCR, Delhi
Police said on Saturday, adding
that 20 pistolsand nine bullets
were recovered from his pos-
session.
The police got a tip-off that
that Mufeed, a resident of
Mathura district in Uttar
Pradesh, will come to Delhi on
Friday to supply firearms and
can be trapped near
Ghummanhera Mod here, a
senior police officer said.
A man carrying a bag on
his back and holding a few bal-
loons in his hand was spotted
near the place.
At first, he appeared to be
a regular balloon seller, the offi-
cer said.
When the police asked
him to surrender for search, the
man started running. He let go
off the balloons and brought
out a pistol from the bag and
waived it at the police, the
police officer added.
?=BQ =4F34;78
In an effort to reduce both
noise and environmental pol-
lution, the Indian Railways on
Saturday announced to intro-
duce the country’s first hydro-
gen-fuelled train. India will be
the third country to experiment
on this alternate fuel after
Germany and Poland, which
are conducting trial runs.
Initially, the hydrogen fuel-
based technology will be intro-
duced on the 89-km long
Sonipat-Jind route. The
Railways has also floated ten-
ders for retrofitting the existing
DEMU rakes into green fuel-
based trains.
A Railway Ministry
spokesperson said the trans-
porter as part of the National
Hydrogen Energy Mission has
taken a leap forward in the
development of hydrogen fuel
cell-based power movement
to kick off the concept of
Hydrogen Mobility in the
country.
The official said the loco
pilot of the locomotive will not
face any problem as there will
be no change in the driving
console.
“Initially, two DEMU rakes
will be converted, and later two
hybrid narrow gauge locos will
be converted,” said a Railway
official.
He said railways had invit-
ed bids for hydrogen fuel cell-
based technology by retro-
fitting DEMU in the 89 km
Sonipat-Jind Section of
Northern Railway.
He explained that the
retrofitting of diesel-powered
DEMU and converting it into
the hydrogen fuel-powered
train set will not only save costs
to the tune of C2.3 crore annu-
ally by converting from diesel
to hydrogen but also save the
carbon footprint (NO2) of
11.12-kilo tons per annum and
particulate matter of 0.72-kilo-
tons per annum.
“After conversion, the train
will run on hydrogen fuel, the
greenest mode of transport as
hydrogen can be generated by
electrolysing the water from
solar energy,” he said.
The official said after the
successful implementation of
this pilot project, all the rolling
stock which will operate on
diesel fuel after electrification
can be planned to be run on
hydrogen fuel.
Another Railway Ministry
official said as a pilot project,
the hydrogen-powered pas-
senger train would be opera-
tional in the Northern zone.
The official said for the first
time, two motor coaches with
1,400 horsepower (HP) each
would haul the 10-coach
hydrogen-powered passenger
train.
He said the train would be
running through a push-pull
method using two motor
coaches being retrofitted with
hydrogen kits.
652=E2==J
2WX]P ' '
DB0 % (
9P_P] ! !
A2 ! !$ !
61aXcPX] ! ! !!
0dbcaP[XP !!
6TaP]h %
=TcWTa[P]Sb !
8cP[h (
5aP]RT ' !
8]SXP ! #
2^d]cah 6 B 1
6ULQDJDUHPHUJHVWHUURUKRWVSRW
DPLGGLSLQYLROHQFHLQ- .
EVcc`cZdegZ`]V_TV
Ucàd%!Z_FE
SfeeYVZc4RaZeR]
dVVd#dfcXV
:_UZRZ_T]fUVd
dZ_X]VU`dV
;R_ddV_Z_Zed
gRTTZ_VSRdVe
CfXccTacPZTbS^f]
APWd[´b_^bcPUcTa
?2B R^_[PX]c
4`_SR]]``_dV]]Vc
YV]UW`cdfaa]j`W
Rc^de`XR_XdeVcd
+GURJHQWRSRZHU6RQLSDW-LQGJUHHQWUDLQ
:PbWXaXT]bT[[cWTXa_a^SdRTPccWTU[^PcX]VeTVTcPQ[TPaZTc^]cWT3P[;PZTX]
BaX]PVPa^]BPcdaSPh 0?
6^[STSP[[Xbc=TTaPY2W^_aP_^bTbSdaX]VcWTTSP[RTaT^]hUâcWTT]´b
YPeT[X]cWa^fPccWT!![h_XRb^]BPcdaSPh 0?
New Delhi: The Indian men’s
and women’s hockey teams
jumped one spot each to
achieve their highest-ever
world rankings at number 3
and 8 respectively, riding on
their historic campaign at the
Tokyo Olympics.
8=380=4=´B0=3F4=´B
72:4HC40B02784E4
14BC4E4AFA;3A0=:8=6B
;H?82B !! )6^[S
0B80= 604B ! ')6^[S
2=F40;C7 604B ! ')6^[S
0B80= 0C7;4C82B 270?8=B78?B
! )6^[S
FA;3 D!0C7;4C82B
270?8=B78?B ! %)6^[S
BDC7 0B80= 604B ! %)6^[S
0B80= 9D=8A 270?8=B78?B ! %)
BX[eTa
2DAA4=C =0C8=0; A42A3 7;34A)
''¯!!
2DAA4=C FA;3 9D=8A A42A3
7;34A)'%#'¯! %
=44A0927?A0´B
02784E44=CB
exclusive
pioneer
?dQ[XbWTS5a^
34;78;D2:=F 17?0;
17D10=4BF0A A0=278
A08?DA270=3860A7
347A03D=7H34A0103
E890HF030
;PcT2Xch E^[ $8bbdT! %
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1
fffSPX[h_X^]TTaR^
DA@CE)
038C88BB4B430;
8=F4=³B6;5
H@C=5'
C0;810=4=C4A=AC7
05?AE8=280;20?8C0;
@?6J(
6H0;20;;B5A8=2A40B8=6
70=3;4G?ACB
347A03D=BD=30H0D6DBC'!! *?064B'#C
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+ X]bcPVaPR^SPX[h_X^]TTa

QWhat is your role in Bhagya Lakshmi
about?
I play Lakshmi Bajwa. She is a self-less
girl who wants to help people. She is polite,
soft-spoken and loves her family very
much. So much so that she can do anything
for them.
QWere there any apprehensions before
taking up the role?
Not at all. I was extremely happy and
excited to play the character. The moment
I read the script, it was a pleasure that the
role has found me. In fact, when I read my
audition script, I found an instant connect
with the character. I am in the best of my
spirits and mood when I am in the shoes
of the character. Not even for once did I
have a second thought about it.
QThe show has a diverse and talented
cast on board. How’s the experience
working with them?
It has been an amazing experience
working with Uday sir and Smita Bansal
ma’am. Everybody is very sweet and polite,
including my co-star Rohit Suchanti. I feel
like home at the set. It is so comforting and
joyful.
QHow easy or difficult was it to get into
the skin of the character?
It wasn’t too difficult. I share many
similarities with Lakshmi and that makes
it more easier for me to get into the skin
of the character. Just like my character,
I am soft-spoken too. And what I am
learning from the character is her giving
nature and will to help people. Generally,
before helping people we always think
whether it will do some harm to us or not,
but Lakshmi, on the contrary, is ever ready
to help people without thinking about its
after-effects.
QHow did acting happen?
It happened in 2011 when I joined
theatre after someone said that I have a
pretty and charming face and that I should
try my luck in acting. I took it seriously and
joined theatre and since then there’s no
looking back. I am completely in love with
it.
QHow has the journey been thus far?
The journey hasn’t been too harsh for
me. I am grateful for that. But there was a
time when I was out of work for one-and-
a-half-year, it was a rough period. Apart
from that things have been great. I feel
lucky to be working in such a situation.
Also, I feel blessed to have done good work
in this short span of my career.
QA moment that you cherish/regret the
most.
The moment that I cherish the most,
like I mentioned earlier, is that I have got
to a lot of varied roles. I have done a
supernatural show, have played a
negative character and now I am
here playing Lakshmi. Also, I don’t
regret anything in life. Just like
Lakshmi, I too believe in bhagya (destiny)
and that everything is pre-written for you.
The situation is never in your hands, the
reaction is. If something turns out good,
it’s amazing, if not, then it’s a learning
experience, as simple as that.
QWhat kind of roles attract you?
I love doing positive roles, they are my
forte. When I am doing such roles, I can
easily connect with them. With that
being said, recently I have played a negative
character in one of my shows, and I loved
it too. I got to learn so much as an actor.
So, the kind of roles that attract me are the
ones that are challenging. Having played
a variety of roles, I now want to play
characters that have a spine and are not
only meant for filling up the space. For
Bhagya Lakshmi, in the first episode itself,
I had so much to do. We were shooting in
the river. Then there was an accident
sequence where we are pulling a bus. So
when you have so much activity to do, it
increases the fun quotient.
347A03D=kBD=30H k0D6DBC '!! UX[bce!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG6KHG1R 3DWHO1DJDUR2SHUDWLYH,QGXVWULDO$UHD
'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU
12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS
VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
A]R_J`fcDf_URj
4
][XVWcT]h^da
fTTZT]S
^^SQh
bX__X]Vb^T
^RZcPX[b7TaT
PaTPUTfTPbh
aTRX_Tb^]cWTV^
E8A68=
98C
8]VaTSXT]cb)
Y;XTfTSVTb!
c^
YX]c[TPeTb%c^
'
YBdVPa_^fSTa!
cb_
YG^cXZ2[TPa
;T^]![
Y8RTRdQT
Y^YXc^bhad_!$
[
Y [XTb[XRT
VPa]XbW
?aT_PaPcX^])
Y8]PcP[[V[Pbb
XgP[[
X]VaTSXT]cbfXcW
RW^__TSX]c[TPU
[XTfTSVTb
6Pa]XbWfXcWb[XRT
Û[XT
F
WX[TcWTUXabcT_Xb^STÛITT2^TSh
BW^fWT[_TSTeTah8]SXP]UPX[h
d]fX]S^]cWTXaR^dRWfXcWb^TÛ8]SXPb
c^_R^TSXP]bPZX]VcWT;;cWTXa
bcaTbbPfPhcWXbfTTZT]SfTfX[[bTT
AXcTXbW3TbWdZWPZTdbA5;fXcWWXb
WX[PaX^dbP]cXRbCWT1^[[hf^^SbcPaP[^]V
fXcWfXUTh6T]T[XP3TbWdZWfTaTb_TRXP[
VdTbcb^]cWTbW^fQdccWThfTaT]ccWT
^][hVdTbcb_aTbT]c^]cWTbTcCWXb
fTTZT]SITT2^TShBW^fP[b^STRXSTS
c^ST[XeTaPdRW]TTSTSS^bTÛ[PdVWcTa
c^cWT^]TbfW^]TTSXccWT^bc¯cWT
dQPXSPQQPfP[[Pb fW^fTaTWXceTah
WPaSSdaX]VcWT2E83 (_P]STXR
FXcWT[TeT]R^TSXP]bÛcWTbW^f¯
0[X0bVPaBdVP]SWPXbWaP1W^bP[T3a
BP]ZTc1W^bP[T6PdaPe3dQTh1P[[aPPY
BXSSWPacWBPVPa3XehP]bW3fXeTSX
CTYPbbfX?aPZPbW2WXcaPbWXAPfPc0SXchP
=PaPhP]P]S?d]Xc9?PcWPZ_TaUâX]V
b^TWX[PaX^dbPRcbP]ScWT;PdVWX]V
1dSSWPÛcWTbW^f5PaPW:WP][TPeX]V
cWTX]b_[XcbfXcWWTafXcchaTPRcX^]bcWT
WPaSfâZX]VSPQQPfP[[Pb fTaTbTT]
d]fX]SX]VX]P7PbX]BcaTbb6^]T^^S
7^fTeTac^PZTcWTTg_TaXT]RTTeT]âT
T]cTacPX]X]VAXcTXbW3TbWdZWV^cWXb
PRcX]VbW^Tb^]P]S_TaUâTScf^PRcb
fXcWBXSSWPacWBPVPaP]SfTWPeTc^bPh
TeTah^]TfPbW^[SX]VcWTXabc^PRWP]S
[PdVWX]VSdaX]VcWTbW^^c
AXcTXbWP__TPaTSc^QTbXccX]V^]c^_Û
P]X]U[PcTS3X]^bPdaR^bcdTSdaX]VcWT
UXabcPRcP]SBXSSWPacWBPVPaPRcX]VPbP
UTP[TRWâT^VaP_WTacaXTSc^cTPRW
AXcTXbWbSX]^bPdaW^fc^SP]RTSdaX]VcWT
bW^^cFWX[TcWTR^TShcWPcU^[[^fTSfPb
cad[h^dcÛcWXbfâ[SXcfPbcWT]TgcPRc
cWPcaTP[[h[TUcTeTah^]T^]bTcbcd]]TS
0UcTaBXSSWPacWb_WT]^T]P[PRc^]P
b[^_TSbTcfXcW?d]Xc9?PcWPZP]S1P[[APPY
AXcTXbWcaXTSWXbWP]SbPc_TaUâX]VP
SP]RTfXcWBXSSWPacW^]cWTb[^_TSbTcPb
fT[[FWX[TcWTcf^SP]RTSfWX[TUP[[X]V^]
c^_ÛTPRW^cWTacWTXaT[TRcaXRRWTXbcah
P]S_PbbX^]PcTa^[T_[Ph^]cWTb^]V;PWd
d]W;PVP6PhP fX[[bdaT[h[TPeTcWT
eXTfTabb_TTRW[Tbb
8]UPRc6T]T[XPfPbP[b^bcd]]TS?^bc
cWTPRcbWTbPXS°8eT]TeTabTT]cWXb
_PbbX^]PcTbXSTÛAXcTXbWhbT[U[PdVWb±
0SSX]V^]c^WTaR^T]c5PaPWbPXS
°6T]T[XPh^d[[WPeTc^PSSPb[^_TPch^da
W^dbTc^bTTcWXbbXSTÛAXcTXbW±
FWX[TAXcTXbW6T]T[XPP]S5PaPWb
QP]cTaXbP[[bTcc^T]cTacPX]cWTPdSXT]RTb
S^]^cXbbcWTR^XRPRcbQhP[[cWT
PacXbcTbÛITT2^TShBW^fSdaX]VcWXb
fTTZT]SbT_Xb^ST
µ:92G6?6G6CD66?E9:DA2DD:@?2E6D:56@7C:E6:D9¶
243HF8C70C03:05HBC4AH 0:4F0H5A=0H80=0=38
1PRZX]VTPRW^cWTad_P]S
bWPaX]VP]PPiX]V
RPPaPSTaXT^]P]SÛUbRaTT]
Xbb^TcWX]VcWPcSTUX]TbcWT
cf^_^_d[PaPRcâbfW^PaT
RdaaT]c[hbTT]TbbPhX]V[TPS
a^[TbX]B^]hB01b9XYPYX
2WWPc?Paa:^XX7PX Pb2?
7XQP=PfPQ9XYPYX
BWdQWPbWXbW9WPFWX[T
0]d_D_PSWhPhB^P
APcW^SP]SAPbWX1PfP
R^]cX]dTc^PSS]Tf
SXT]bX^]bc^cWTbW^fP]S
XcbX]caXVdX]Vbcâh[X]TcWT
PSSXcX^]ÛBdRWTcP:WP]]P
P]S9XcdBWXeWPaTP]SEX_X]
7TTa^WPeTPSSTSPUaTbW
_Tab_TRcXeTc^cWXbT]cXaT[h
UaTbWbcâh[X]T
CWTb_PaZ[X]VRWTXbcah
QTcfTT]2?P]S9XYPYXXbcWT
cP[ZÛcWTc^f]P]SBPPhP
Xb[TPeX]V]^bc^]Tb
d]cda]TSQhRaTPcX]V]Tf
ca^dQ[TUâ9X]SP[bP]SBWPaPb
TeTahSPh
7XQP=PfPQcP[ZX]VPQ^dc
fWPcPZTbcWTbW^fd]X`dT
bPXS°CWTbW^fWPbP
R^_[TcT[haTUaTbWTSbcâh[X]T
P]SWPbPSTPbca^]V
R^TQPRZ^]cT[TeXbX^]fTPeX]V
X]PQ[T]SÛVT]aTbCWTbW^f
WPbQTT]aTRTXeX]V[êTP]S
P__aTRXPcX^]Ua^P[[êTacWT
R^d]cahUâcWTfPhXcbbcâhWPb
QTT]Z]XccTSaTR^V]XbX]VXcc^
QT^]TÛcWTUXabccT[TeXbX^]
bW^fbfXcWPQ[T]SX]cWTVT]aT
hcXX]VWPbQTT]_^[XbWTS
bX]RT8QTVP]bW^^cX]VUâcWXb
bW^fCWTRdaaT]ca^[TaT`dXaTb
Tc^PST`dPcT[h_[PhcWTa^[T
ÛcWTVW^bcBPPhPP]S2?fW^
Xbc^SPh³bTaPVXa[8WPeTP[fPhb
QTT]PUP]ÛQTX]VP_PacÛ
B^]hB01P]SfTWPeT[dRZX[h
V^cb^TPPiX]VSXaTRcâbP]S
PZTabfW^bd__âcdb±
C 4 ; ; H C 0 ; 4
DXYcT_SeVY]Yc_^DUWYcSQ]
9@6E962EC6
5:2=!!
KVV
Z_X+R_`[3R[aRjVV?VV_R
8faeRDRdYZER_hRc
CReVU+ !
F
rom the Bandit Queen (1994)
where he played dacoit Man
Singh, Manoj Bajpayee has been
wowing his viewers. With movies like
Bhonsle, Special 26, Satya, Aligarh and
Gangs of Wasseypur, to name a few.
Bajpayee has set a benchmark for
himself.Viewersnowexpecthimtoup
his game every time that they see him
on the 70 mm screen.
Directed by Rensil D’Silva and
produced by Sony Pictures Films
India, Dial 100, doesn’t disappoint.
Despite the fact that there is very little
action and most of the time Bajpayee
spends his time inside an emergency
control room, the film holds your
attention from the word go. You
know that the emergency call that he
takes is not going to be a simple one
and that there is a connection. Even
before the film comes to its
conclusion, the connection is out in
the open. All that is left is to see how
things end.
As Nikhil Sood, senior PI
Mumbai Police, Bajpayee plays the
role to a T. Of course, this is not the
first time that the versatile actor
played a cop. His previous movie,
Silence... Can You Hear It, where he
plays ACP Avinash Verma also won
many hearts. This one is no different.
In fact, he is the only driving force
here even though it has the likes of
Neena Gupta. Though she plays the
role of a mother hell bent on revenge
rather beautifully, it is Bajpayee who
holds everything together.
As Sood, his understated role as
a cop has been well-fleshed out and
portrayed well. Though his anger and
frustration are evident, the way he
keeps a check on both is brilliant. His
need to protect his family, at whatever
cost and not play by the rules belies
his statement that he is a good cop and
never has never misused the system.
Yet he endears himself with the
audience since besides being a cop, he
is a father first.
An interesting watch despite
predictable drama that has plenty of
gaps. — BWP[X]XBPZbT]P
@?6J27:2+726DE2A
A2A6C+E96:?8@74@?D
5ZdT`gVcj
5`Tf^V_eRcj
CReVU+ !
A
lmost everybody has
heard about the Telgi
scam, about Abdul Karim
Telgi and his rise from a fruit
seller to a scam that involved
thousands of crores. Those who
were victims of the scam, would
need no introduction to what
happened but there are many
who would want to know what
was so special about Telgi.
Money Mafia: Fake Stamp
Paper: The King of Cons, a
documentary gives an insight to
what transpired. The 28-minute
docu-style film is interesting to
watch as it has bites from people
who were involved in the
investigation and the journalist
who broke the news.
The series, Money Mafia,
promises to detangle the white-
collar crimes. And it all begins
with the Telgi scam. The eight
episodes broken into two seasons
will investigate scams in various
segments like revenue and law, tax
and finance, cyber frauds and the
stock market.
This episode takes you from
his days as a fruit seller to the days
behind the jail and how he
continued to run business from
behind the bars. The narrative is
straight-forward even though
there are parts where one feels that
he was somewhat glorified.
The only problem is that the
documentary leaves a lot many
questions unanswered like how it
all worked and how he built the
nexus. Overall, it is a
documentary that will give only
the superficial information
without going much into the
depth. — BWP[X]XBPZbT]P
HReTYZeW`c
R_`[3R[aRjVV
A0=64
98C
8]VaTSXT]cb)
Y;XTfTSVTb!c^

YX]c[TPeTb%c^'
YaP]VTUaTbWRdQT
$_XTRTb
YBdVPa_^fSTa!
cb_
Y;XTYdXRT$[
YG^cXZâP]VT!
[
YaP]VTb[XRT Uâ
VPa]XbW
Y^YXc^bhad_!$
[
Y4[STaU[^fTabhad_
[
?aT_PaPcX^])
Y8]PcP[[V[PbbXg
P[[X]VaTSXT]cbfXcW
RW^__TSX]c
[T^]fTSVTb
âP]VTRdQTb
6Pa]XbWfXcWPb[XRT
ÛaP]VT
2^dacTbh)0]ZXcP
BTWVP[3XaTRcâ
G^cXZ5adYdb
0
Q^dc hTPabPV^2^[âb
Qa^dVWcP]TfaTe^[dcX^]^]
8]SXP]CEfXcWXcb_PcW
QaTPZX]VbW^f1P[XZPEPSWd
cWPcPSSaTbbTScWTbdQYTRcÛ
RWX[SPaaXPVTX]cWTbX_[Tbc
hTc_^fTaUd[P]]Ta0c^_XR
cWPcfPbbcX[[[PQT[[TSPbcPQ^^
X]^daR^d]cahfPbQa^dVWcc^
[XUTcWa^dVW0]P]SX³bbcâhcWPc
c^^ZcWT]PcX^]QhbcâFWX[T
cWTbW^fbdRRTbbUd[[hRWP]VTS
P]h[XeTbP]SX]SbTcbcWT
TeX[Rdbc^ÛQPP[eXePPW Xb
bcX[[_aTeP[T]cP]ScWaXeX]VX]
b^T_PacbÛ^daR^d]cah
FXcWP]PXc^QaX]VPQ^dcP
RWP]VTP]SaTXV]XcT
R^]eTabPcX^]bc^TaPSXRPcTRWX[S
PaaXPVTRdbcÛa^b^RXTch
cWTRWP]]T[XbbTcc^[Pd]RW
1P[XZPEPSWdBTPb^]!
CWTbW^ffX[[RP_cdaTcWT
Y^da]ThÛP]PhX 0]P]SX_[PhTS
QhBWaThP?PcT[PbbWTcPZTb
STUX]XcXeTbcT_bcÛXVWcP]Sd]S^
cWTX]YdbcXRTS^]Tc^WTa
?a^SdRTSQhB_WTaTaXVX]b
1P[XZPEPSWdBTPb^]! fX[[
_aTXTaT^]0dVdbc(!! P]S
fX[[PXa^]SPhc^5aXSPhPc')
_^][h^]2^[âb
CP[ZX]VPQ^dc_[PhX]V
0]P]SXBWaThP?PcT[bPXS°h
UPX[hP[fPhbc^[STPQ^dccWT
b_TRXP[_[PRTcWTRWPaPRcTaÛ
0]P]SXW^[SbX]cWTWTPacbÛ
P]h8]SXP]b8PTgcaTT[h
TgRXcTSPbfT[[PbP[Xcc[T]Tae^db
c^_[PhPRWPaPRcTacWPc[TUcbdRW
P]X_PRc^]TeTah^]Th
RWPaPRcTaÛ0]P]SXX]P]h
fPhbXb[XZTfW^8PbWTXb
QaPeTWP__hP]S[êTbS^X]V
VPaQP8TPVTa[h[^^ZUâfPaSc^
cWT]TfY^da]Th±
µ:dYRcVdZ^Z]RcZeZVdhZeY=RdY^Z¶
08B7F0AH0:70A4fW^_[Phb;PZbWX1PYfPX]ITTCE³b1WPVhP;PZbWX
cT[[bDB1070B78PQ^dcWTaa^[TTg_TaXT]RTÛfâZX]VfXcWcWTcTPP]S
aTRP[[bcWTcXTfWT]bWTfPb]³cfâZX]VUâ^]TP]SPWP[UhTPa
CWTY^da]ThWPb]c
QTT]c^^WPabWUâ
T8PVaPcTUd[
UâcWPc1dccWTaT
fPbPcXTfWT]8
fPb^dcÛfâZUâ
^]TP]SPWP[UhTPa
XcfPbPa^dVW
_TaX^S0_PacUa^
cWPccWX]VbWPeT
QTT]VaTPc8UTT[
[dRZhc^WPeTQTT]
fâZX]VX]bdRW
PbXcdPcX^]

dccPaPZWP]S
347A03D=kBD=30H k0D6DBC '!!
90B:8A0=27?A0Q
347A03D=
These days visitors are com-
ing to Uttarakhand in large
numbers to calm their minds
and soothe their spirits after
suffering the strain and pains
brought in by Covid- 19. The
various destinations in
Uttarakhand have been known
to provide spiritual solace to
people. The scenic beauty and
the divine environment have
made this region blessed and
people can feel the healing
touch of these mountains and
dales.
Ashrams, guest houses and
hotels have been full of people
who came into the Himalayan
state to free themselves from
the feeling of being caged in by
the pandemic. This attraction
and pull has existed for ages.
Saints, poets and philosophers
have come here and found
inspiration and peace.
Many years ago, the great
poet and philosopher Gurudev
Rabindranath Tagore, whose
death anniversary was on
August 7, came to these very
mountains to heal his heart, to
calm his mind.
The summer of the year
1903 saw him as a grief-strick-
en 42-year old father with two
of his children, trying to find
solace in the serene Himalayas
in Kumaon. He was both father
and mother to his children in
his lonely retreat in the pines.
His wife Mrinalini had passed
away in 1902 and his twelve
year daughter Renuka had con-
tracted tuberculosis. In early
May of 1903, he left for
Kumaon with Renuka and his
younger son Samindranath.
He stayed in Ramgarh near
Nainital till August and wrote
the series of poems “Shishu”
(The Child) that became
known as “The Crescent
Moon” in order to entertain the
motherless children. He took
the two children back to
Kolkata and in mid-September
1903, Renuka died. Later, even
Sami died (1907). But Tagore
could never forget the peaceful
ambience of the Kumaon
Himalayas and kept returning
to their echoing silence to
experience tranquility which
inspired him greatly. He wrote
some verses of Gitanjali while
he was in Kumaon in 1903.
And it was here that the idea of
Visva Bharati first came to his
mind. It is believed that he had
even thought of setting up an
ashram in the Himalayas.
Tagore came to the mountains
of Kumaon again in early May
in the year 1914 and remained
there till June. He was at
Ramgarh, in a cottage amid
apple orchards and pines from
where one gets a breathtaking
panoramic view of the
Himalayas from Chaukhamba
to the Himalayan ranges in
Nepal.
The place left him spell-
bound and became a great
favourite with him. Tagore also
visited Almora, the ridge-top
town 70 kilometres from
Nainital. In 1937, four years
before he died, Tagore spent a
very creative summer at
Almora. In May and June 1937,
Tagore stayed here and wrote
his poems “Sejunti”, “Akaash
Pradeep” and “Nobojaatok”
besides his book on science
“Bishwa Porichoy”. He also
made some sketches with local
colours. A bronze statue of his
can be seen at the Tagore
House.
Another great poet,
Harivansh Rai Bachchan visit-
ed Dehradun and Mussoorie in
1937. He was 29 years old and
his first wife, Shyama, had suc-
cumbed to tuberculosis in the
winter before the summer of
1937. Bachchan was in grief
and had come to Doon with his
friend Brij Mohan who was a
resident of Doon. He went up
to Mussoorie with Brij Mohan
to pay a visit to the well-
known professor Amar Nath
Jha who had bought Lynwood
Cottage where he spent his
summers. He had taught
Bachchan when he was an
undergraduate and was
annoyed with him for leaving
the university after the first year
of MA (English).The summer
of 1937 was indeed a turning
point in Bachchan’s life. He
found strength in Dehradun
and Mussoorie to begin afresh
in life.
If such great men could
nurse their hearts back to
health in these beautiful moun-
tains, every one can. There is
no denying the unique healing
power of the Himalayas in
Uttarakhand. In Kim, Rudyard
Kipling writes, “Who goes to
the hills, goes to his mother”.
8UQY^Wd_eSX_VEddQbQ[XQ^Tµc]_e^dQY^cYcQWU_T
?=BQ 347A03D=
The Chief Minister Pushkar
Singh Dhami has claimed
that Uttarakhand would
achieve the target of 100 per
cent vaccination in four
months. The CM inaugurated
a mega vaccination camp at
Nirankari Bhawan here on
Saturday.
Speaking on the occasion
he said that the world’s biggest
vaccination programme
against Covid-19 is being
underway in India under the
able leadership of Prime
Minister Narendra Modi. He
said that the camps are being
organised in remote and
mountainous areas of the state
for vaccination against Covid-
19. The CM also interacted
with the people who had come
for vaccination.
The Health Minister, Dhan
Singh Rawat said that the
health department has taken a
target to vaccinate more than
1.50 lakh people on Saturday
and for it 750 camps are
being organised in the state.
He added that in the
camp at Nirankari Bhawan
one thousand people would
be vaccinated.
The director general
(DG), State Health services
Dr Tripti Bahuguna and
senior officers of the health
department were present on
the occasion.
3TWaPSd])CWT_[P]ÛcWTBcPcT
7TP[cWST_PacT]ccêPRRX]PcTP
aTRâS]dQTaÛ_T^_[T^]
BPcdaSPhfPbbdRRTbbUd[Pb
$!##ePRRX]TbW^cbfTaT
PSX]XbcTaTSX] '!bTbbX^]b
WT[S^]cWTSPhCWTbcPcTWTP[cW
ST_PacT]cSPcPaTeTP[bcWPc
(RXcXiT]bP]S (
Ua^]c[X]TfâZTabP]S'
WTP[cWRPaTfâZTabfTaT
ePRRX]PcTS^]BPcdaSPhC^cP[Û
$ #'$_T^_[TWPeTQTT]
_PacXP[[hePRRX]PcTSfWX[T
$Ud[[hePRRX]PcTSX]cWT
bcPcTbÛPa
A42A3E0228=0C8=
=B0CDA30H
F¶YR_Ue`gRTTZ_ReVR]]Z_W`fc^`_eYd+45YR^Z
EPRRX]PcX^]
aTRâSPbâT
cWP] $[PZW
ePRRX]PcTS^]
BPcdaSPh
?=BQ 347A03D=
Chief Minister Pushkar
Singh Dhami interacted
with member of Indian women
hockey team Vandana Katariya
on a virtual platform on
Saturday and congratulated
her for her performance and
achievement of the team. He
said that Katariya has enhanced
the pride of Uttarakhand.
Dhami said that the state gov-
ernment has announced a cash
reward of Rs 25 lakh for
Katariya and decided to bestow
her with the Tilu Rauteli award.
The CM said that a new sports
policy would be made and
every facility would be provid-
ed to the sports persons. Dhami
also held telephonic talks with
the brother of Vandana and
congratulated him.
The secretary, HC Semwal
was also present on the occa-
sion.
'KDPLFRQJUDWXODWHV9DQGDQD
.DWDULDIRUKHUSHUIRUPDQFH
?=BQ 347A03D=
The State Health
department report-
ed 38 new cases of the
novel Coronavirus
(Covid-19) and 59
recoveries from the dis-
ease in Uttarakhand on
Saturday. No death from
the disease was report-
ed in the state on the
day.
The cumulative
count of Covid-19
patients in the state is now at
3,42,374 while a total of
3,28,476 patients have recov-
ered from the disease so far. In
the state 7367 people have lost
their lives to Covid -19 till date.
The recovery percentage from
the disease is now at 95.94.
The State Health depart-
ment reported eight new
patients of Covid -19 each
from Dehradun, six each from
Haridwar and Pithoragarh,
four each from Almora and
Rudraprayag, three each from
Nainital and Pithoragarh, two
each from Bageshwar, Chamoli,
Champawat and Tehri and one
each from Udham Singh Nagar
and Uttarkashi districts on
Saturday.
The State now has 492
active cases of Covid 19.
Dehradun with 209 cases is at
top of the table of active cases
while Pithoragarh is at second
spot with 58 active cases.
Chamoli has 52, Udham Singh
Nagar 42, Rudraprayag 31,
Champawat 25, Uttarkashi 17,
Pauri 14, Bageshwar and
Haridwar 13 each, Almora
eight and Nainital and Tehri
five active cases each of the dis-
ease.
The State reported four
new cases of Mucormycosis
(Black fungus) on Saturday. A
total of 568 patients of Black
Fungus have been reported till
date in the state and out of
them 126 have died.
2êXS ()']TfRPbTb
$(aTRêTaXTbX]D³ZWP]S
?=BQ 347A03D=
Launching an attack on the
BJP government on the
issue of unemployment, the
leader of Aam Aadmi Party
(AAP), Ravindra Jugran has
said that the BJP has only mis-
guided the youth in the name
of providing employment in
the last four and half years of
its rule. He was addressing the
media persons here on
Saturday.
He said that the BJP came
to power in 2017 on the
promise of providing employ-
ment but in the last four and
half years the state is on the top
in terms of unemployment
percentage. “A report of Centre
for Monitoring Indian
Economy (CMIE) suggests that
in the last five years, unem-
ployment has seen a six fold
increase. The BJP has done
nothing other than changing
the chief ministers,’’ he said.
Presenting the figures, the
AAP leader said that more
than 50,000 posts in the gov-
ernment department are lying
vacant at present and the num-
ber of registered unemployed is
more than eight lakhs now.
The AAP leader said that
the process of filling 1218 posts
of forest guards started in the
year 2018 but it is still on and
the scam in the examination
has exposed the zero tolerance
on corruption rhetoric of BJP.
He added that the examination
to appoint 2621 nurses in the
health department has been
postponed three times and five
examinations of subordinate
services selection commissions
are stuck for quite some time.
About 4.37 lakh unemployed
people have been waiting for
these examinations for the last
six months. The AAP leader
said that the state government
had promised to provide self
employment to the youngsters
who had returned back to their
villages but this promise too
has remained unfulfilled. He
said that the PCS examination
has not been conducted for the
last four years and many appli-
cants have become over aged
while waiting for these exami-
nations.
âTcWP]$
_^bcbX]cWT
VêTa]T]c
ST_PacT]cPaT[hX]V
ePRP]cPc
_aTbT]c)9dVaP]
?=BQ 347A03D=
The Uttarakhand Congress
has blamed the BJP gov-
ernment for engaging in nepo-
tism while selecting candidates
for prestigious Tilu Rauteli
awards.
The spokesperson of
Uttarakhand Congress, Garima
Dasauni said that the entire
selection process of the Tilu
Rauteli awards has come under
cloud.
She said that the awardees
include not only the daughter
of a cabinet minister of the state
but an office bearer of Mahila
Morcha of BJP.
Dasauni also criticised the
BJP government for the recent
order pertaining to work dis-
tribution among the personal
staff of chief minister Pushkar
Singh Dhami. She said that in
the order some of the staff
members of CM have been
assigned the task which per-
tains to coordination with the
BJP workers and Rashtriya
Swayamsevak Sangh (RSS)
members. Dasauni said that
under the Uttar Pradesh (UP)
work distribution regulations,
1975 which are applicable in
Uttarakhand also the powers of
CM and governor are
described.
She said that as per the
rules, the personal staff of CM
is appointed by the secretariat
administration (SAD) and their
salaries and perks are paid
from the state treasury. Dasauni
claimed that the rules clearly
say that the members of the
staff cannot be asked to do
work for a political party.
19?_a^^cX]V]T_^cXbD´ZWP]S2^]VaTbb
?=BQ 347A03D=
The Uttarakhand
Government has issued
directions to the Finance
department regarding the eco-
nomic package announced for
the stakeholders related to
tourism. The amount of the
financial relief will be given to
the stakeholders from the chief
minister’s relief fund.
Further in the order, it has
been mentioned that the relief
amount will be received by the
District Tourism Development
Officer (DTDO) on behalf of
the district magistrate through
DBT. For financial assistance
from the government, one can
register on the Uttarakhand
tourism portal. After the con-
firmations, the DTDO con-
cerned will deposit the amount
directly in the account of the
beneficiary through DBT on
the behalf of district magistrate.
Homestays owners registered
with Uttarakhand Tourism
Development Board (UTDB)
will also be eligible as individ-
ual beneficiaries. A govern-
ment directive of nearly Rs
66.66 crore has been made by
the tourism department for the
relief of the stakeholders.
Tourism minister Satpal
Maharaaz said, “Government is
committed to bring the tourism
industry back on track after the
rapidly decreasing cases of
Covid-19. The registered ben-
eficiaries will get great relief
from this package. This will
also provide momentum to
boost the economy of the state.
Secretary Dilip Jawalkar
said, “The tourism industry has
suffered loss due to Covid,
prolonged lockdown and the
postponed Char Dham Yatra in
the state. At the same time,
business at tourist places has
also been badly affected which
resulted in stakeholders facing
financial problems. This will
give much-needed relief to the
stakeholders.”
According to officials,
financial assistance of Rs 2,000
per month for six months will
be given to the persons work-
ing in the operation of various
activities of tourism business
registered in tourism and other
departments. An amount of Rs
60 crore will be allocated to
50,000 beneficiaries. Registered
tour operators and adventure
tour operators will be given
financial assistance at the rate
of Rs 10,000. A sum of Rs 65.50
lakh will be allocated for 665
beneficiaries. Further, 630
trekking guides registered with
the tourism department will get
financial assistance at the rate
of Rs 10,000. Financial assis-
tance of Rs 10,00 will be given
to 93 boat operators of Tehri
dam reservoir and business-
men in the tourism department
will be given exemption in
license and renewal fees.
Businessmen of registered
rafting and aero sports will get
exemption in license renewal
fees while exemption in license
renewal fee will be given for 98
boat operators in Tehri dam
reservoir in the year 2021-22.
Apart from this, financial assis-
tance will be provided on inter-
est reimbursement for six
months in the finance depart-
ment for Veer Chandra Singh
Garhwali and Deendayal
Upadhyay Home Stay Scheme
loan.
D_ebYc]cdQ[UX_TUbcd_WUd
QYTVb_]3=BUYUV6e^T
?=BQ 347A03D=
In a development which is
being viewed as an attempt
by former chief minister and
general secretary of All India
Congress Committee (AICC),
Harish Rawat to build bridges
with former Pradesh Congress
Committee (PCC) president
Kishore Upadhyaya, Rawat has
heaped praise on Upadhyaya
for his role in promoting
Uttarakhandiyat. The former
CM took to social media to
appreciate Kishore Upadhyaya.
Remembering Upadhyaya’s role
in the struggle for giving rights
to affected people of Tehri
dam project, Rawat said he
fully supports Upadhyaya’s mis-
sion for forest dwellers rights.
“The forest dwellers act is due
to Sonia Gandhi and as her
staunch supporter Upadhyaya
has launched a mission. It is
very important that the
Congress party comes to power
in Uttarakhand so that the
mission of Upadhyaya is car-
ried forward,’’ he said.
?=BQ 347A03D=
Abi-annual monitoring sur-
vey conducted by Humane
Society International/India
(HSI India) has shown a sharp
decline in lactating females
and puppies with successful
sterilisation and vaccination
of 66 per cent of street dogs.
These have been conducted
over the past five years in the
city with support of Municipal
Corporation of Dehradun
(MCD). In 2021 itself, 3,211
street dogs were sterilised and
vaccinated against rabies in
Dehradun by HSI India.
HSI India started its
Animal Birth Control (ABC)
programme in Dehradun in
November 2016 with its objec-
tives to control street dog pop-
ulation, reduce human-dog
conflict and improve the wel-
fare of street dogs. Till date, the
programme has carried out
spay and neuter or sterilisation
surgeries for a high percentage
of the dog population in the
city – 73 per cent in core
Dehradun zones and 53 per
cent in the adjacent and 40
newly added municipal wards
in the west and east, changing
the dynamics of the dog pop-
ulation growth and improving
the lives of dogs and humans.
HSI India Dog Population
Management Programme-
Dehradun, programme man-
ager Dr Ashok Kumar said,
“We have already sterilized 66
per cent dogs of the city in the
last four years and the remain-
ing will be done in the next few
years. After evaluating the
impact and progress made so
far, we have now decided to tar-
get zones A and F, and both
regions of west zone 2 where
the sterilisation rates are less
than other zones.
Officer in-charge,
Uttarakhand Animal Welfare
Board and member, State ABC
Monitoring Committee, Dr
Ashutosh Joshi said, I am
happy to see that Dehradun is
among the cities that have a
good number of sterilisation
rates. The ABC programme
will not only control the pop-
ulation of the street dogs but
will also help reduce the num-
ber of dog bite and rabies
cases. According to HSI
India, there is a 13.35 per cent
decline in the number of dogs
counted in the survey of June
2021. The number of puppies
counted in the survey of May
2017 has declined by 38.5 per
cent in the results of June 2021
survey.
+6,VXUYHVKRZVVWUHHW
GRJVVWHULOLVHGLQ'RRQ
7PaXbWAPfPc
_aPXbTb:XbWâT
UâUâTbcaXVWcb
RP_PXV]
APfPcWPbWTP_TS
_aPXbT^]D_PSWhPhP
UâWXba^[TX]
_a^^cX]V
DccPaPZWP]SXhPc
$$3DFFXVHV%-3
RIPLVJXLGLQJRXWK
RQHPSORPHQW

]PcX^]#
?=BQ 347A03D=
Delhi Public School,
Dehradun encouraged its
students to make Rakhis for
their brothers in the armed
forces as a token of gratitude
and respect for them. Colonel
Sanjay Malik from Dehradun
sub area was invited to the
school to receive a box full of
handmade rakhis and choco-
lates for the soldiers at the bor-
der at Siachen, far away from
their homes.
He said, “It is a very
thoughtful and heart-melting
gesture by the kids.”
5AD5VYcRUf_dV_Ud
CRYZdW`cd`]UZVcd ?=BQ 347A03D=
Anumber of citizens were
administered the Covid
vaccine at a vaccination camp
inaugurated by the Bank of
India zonal manager Jai
Narayan at Azad Colony here.
The camp was organised with
the assistance of the bank.
Speaking on the occasion,
Narayan said that the vaccine
is safe and necessary for pro-
tection from Covid-19.
Speaking as the chief guest,
Rajya Sabha member Naresh
Bansal said that the Central
and State governments are
working effectively to check
Covid. BJP state spokesman
Vinay Goel said that there has
been an increase in awareness
in society regarding vaccina-
tion.
1T]TUXRXPaXTb
PSX]XbcTaTS2^eXS
ePRRX]TX]RP_
BC055A4?AC4AQ =4F34;78
Ahead of Independence Day,
a wall of shipping con-
tainers has been erected by the
Delhi Police at the main gate of
Red Fort for security reasons.
According to a senior
police official, the containers
have been placed in such a way
that no one is able to see inside
the premises of the Mughal-era
fort, from where the Prime
Minister addresses the nation
on Independence Day.
Nobody would be able to
peek inside the fort from the
Chandani Chowk area. This is
the first time that police have
put up such a high wall, offi-
cials said, adding the contain-
ers would be decorated with
graffiti.
On Republic Day this year,
a large number of protesters
demanding the repeal of the
three farm laws had forced
their way into Red Fort. They
even hoisted flags from the
ramparts of the fort where the
PM unfurls the Tricolour on
Independence Day.
On January 26, the nation-
al capital witnessed clashes
between protesters and police
during the tractor parade by
farmers. A total of 394 police
personnel were injured while
30 police vehicles were dam-
aged in the violence.
In July, Balaji Srivastava,
the then Delhi Police
Commissioner, had issued
orders, prohibiting the flying of
aerial objects like drones,
paragliders, and hot air bal-
loons. The order shall remain
in force in the national capital
for a period of 32 days till
August 16. The Delhi Police has
seized a drone that was flying
near Vijay Ghat, the backside
of the Red Fort. The Jaguar
highway patrolling team of
north district was patrolling in
the area on Monday when it
saw a drone near Vijay Ghat.
BC055A4?AC4AQ =4F34;78
A60 year-old man died while
three others were injured
when a two-storey building
collapsed in northeast Delhi’s
Nand Nagri area on Saturday.
The deceased has been
identified as Kanti Lal while the
injured have been identified as
Dhani Ram (65), his wife
Anaro Devi (65) and Rajkumar
(64).
Following the incident, the
Delhi Chief Minister Arvind
Kejriwal took to Twitter to say
he was monitoring the situa-
tion. “This accident of house
collapse is very sad. All possi-
ble help is being provided for
relief and rescue. I am contin-
uously monitoring the incident
through the district adminis-
tration,” he said in a tweet in
Hindi. According to Atul Garg,
the Director of Delhi Fire
Services (DFS), a call was
received around 1.30 PM about
the house collapse in an auto
market in Nand Nagri, follow-
ing which six fire tenders were
rushed to the spot.
“The building which col-
lapsed had shops on the ground
floor. One person was taken
out by the public and another
was rescued by Delhi Fire
Services officials,” said Garg.
The police said the house
was owned by Dhani Ram, who
was living there with his fam-
ily.
“The injured, Dhani Ram,
his wife Anaro Devi and
Rajkumar have been shifted to
GTB hospital. One Kanti Lal
was found from the debris and
shifted to hospital where he was
declared brought dead. Legal
action into the incident is
being initiated accordingly,”
said the senior police official.
Chairman of the Standing
Commitee of the East Delhi
Municipal Corporation Beer
Singh Panwar said he and
other senior officials of the
EDMC visited the site of the
mishap and tried to get the res-
cue work done.
“No loss of life has taken
place due to the incident, only
three persons were injured
whom I visited at GTB Hospital
too,” he said.
Panwar said, the building
was a little over 10 years old,
and it seems, the landlord had
“tried to do some extra con-
struction after a crack had
occurred on the ground floor
level”
NLOOHGLQMXUHGDV
EXLOGLQJFROODSVHVLQ
QRUWKHDVW'HOKL
5V]YZA`]ZTVVcVTed^RVdYZWe
hR]]`fedZUVCVU7`ce
?=BQ 270=3860A7
Two Haryana sports per-
sons on Saturday scripted
history in Tokyo Olympics by
winning Gold and Bronze for
India. Hailing from Panipat
district, Neeraj Chopra, made
the country and his state
proud after winning gold
medal in Men's Javelin Throw,
while Bajrang Punia, from
Jhajjar district, bagged bronze
after registering a win of 8-0
in freestyle wrestling.
Addressing media per-
sons after watching the match
at his residence in
Chandigarh, Haryana Chief
Minister Manohar Lal Khattar
while congratulating both the
athletes announced cash
rewards of Rs. 6 crore and
Rs.2.5 crore for the gold and
bronze medal winners respec-
tively. Minister of State for
Sports and Youth Affairs
Sandeep Singh was also pre-
sent on this occasion.
“Apart from a cash reward
of Rs.6 crore, the State
Government has decided to
offer the position of Head at
Centre of Excellence for
Athletics to be constructed in
Panchkula to Neeraj Chopra
under the provision of giving
government jobs as per State’s
Sports Policy,” announced
Khattar.
He said that Bajrang
Punia would be given a cash
reward of Rs 2.5 crore for win-
ning bronze.
He will also be given a
government job as per the
provision made in State's
Sports Policy, said the Chief
Minister.
C'TcW`c8`]U^VUR]Zde4Y`acR
C#TcW`cAf_ZR+YReeRc
?=BQ 270=3860A7
The state of Haryana on
Saturdayerupted in joy with
people, overwrought with emo-
tions, taking to the streets to
rejoice at Neeraj Chopra's gold-
medal winning feat at the Tokyo
Olympics.
The 23-year-old on
Saturday became only the sec-
ond Indian to win an individual
gold in the Olympics and the
first from the country to claim
a track-and-field medal at the
Games. The phone hasn't
stopped buzzing in the Chopra
household ever since as con-
gratulatory messages poured in
from several dignitaries.
Chopra's father Satish, who has
a farming background, said his
son had made the entire coun-
tryproud. Hehad theblessings
of the entire country, he said.
The news of Chopra's vic-
tory came shortly after wrestler
Bajrang Punia had claimed a
bronze, which led to a big cele-
bration in Sonipat. And it con-
tinued as fans in Sonipat,
Rohtak, Jhajjar, Bhiwani and
Panipat rejoiced at the perfor-
mances of the players from the
state.TheChoprafamilyhadput
up a giant screen and all from
the neighbourhood, including
children, had gathered there to
watch the live action from
Tokyo. With a battery of media
persons at their home, the
Chopra family was busy attend-
ing to the guests. Chief Minister
Manohar Lal Khattar, who ear-
lier spoke to Bajrang Punia's
father, also rang up Chopra's
parents to congratulate them.
Chopra'ssecondroundthrowof
87.58m in the finals not only
stunned the athletics world but
also ended India's 100-year wait
foratrackandfieldmedalinthe
Olympics.Withthiswin,hewon
the country's seventh medal
andalsojoinedshooterAbhinav
Bindra (2008 Beijing Games) as
India's only second individual
gold winner in the showpiece.
Nearly, five years ago, Chopra
had become the only Indian
athlete to win a gold medal at
the world level when he made
a new U-20 world record of
86.48m in the men’s javelin
throw event in the IAAF World
U-20 Championships in
Bydgoszcz, Poland.
7PahP]PTad_cbX]Y^hPUcTaYPeT[X]cWa^fTafX]b;H?826;3
BC055A4?AC4AQ =4F34;78
The Delhi Police
Commissioner, Rakesh
Asthana on Saturday addressed
police personnel to spell out the
priorities for the force and to
share his plans for their welfare
in the coming times. Over
10,550 police personnel and
senior police officers attended
the meeting. On this occasion,
the CP also announced that an
‘Open House’ will be held every
Friday for members of the force
to meet the CP if they have any
unsorted issues or grievances.
“Delhi Police personnel have to
deal with plethora of issues
that are unique to the city.
Force’s work in areas of law and
order, VVIP security and crime
investigation are praiseworthy.
It needs to be kept up and
enhanced,” said Asthana adding
that he will contribute in police
personnel’s performance by
leading from the front and
motivating them in all
times.Assuring that no poli-
ceperson shall face any difficulty
for bonafide discharge of duty,
Asthana said that it is the job of
the senior leadership to take
care of the force as mentors and
not find faults with them unnec-
essarily. Asthana told the Station
House Officers (SHOs),
Inspectors and Investigation
Officers (IOs) that time has
come for evidence based polic-
ing and scientific investigation.
“Complainants, victims and vis-
itors to police stations be treat-
ed politely and empathetically
by giving time and attention to
them, he directed the SHOs. Let
there be fear of police among
criminals and sense of security
among the law-abiding citi-
zens,” he said. “The criminals
should have fear of law and it
can only be instilled if we our-
selves are disciplined to core. So,
every policeman should be a
thorough professional and
remain updated,” said Asthana.
Asthana also called upon
the SHOs and supervisory offi-
cers to ensure that victims
should be able to get their FIRs
registered freely while our
emphasis will be to take the
cases to their logical end by
good detection and thorough
investigation. Asthana also said
that communal harmony is of
utmost importance in the
national capital and it has to be
maintained by the police
through engagement with lead-
ers and respectable of all com-
munities. Insisting on fairness
and impartiality, the CP said
that criminals have no religion
or community and strict action
on criminals be done unequiv-
ocally. The CP also mentioned
that all visitors to the city form
their first impression from the
traffic situation and therefore
Trafficpolicepersonnelhave the
responsibility to not only keep
the vehicular flow smooth but
also give the best impression of
Delhi Police to the public by use
of modern technology and
road science.
0bcWP]PPSSaTbbTb_^[XRT_Tab^]]T[
?=BQ 270=3860A7
Triggeringshockwaves,Youth
Akali Dal leader Vicky
Middukhera was shot dead in
broad daylight in Mohali on
Saturday, police said.
Two armed miscreants
opened fire at Middukhera in a
market area and fled the spot.
A case has been registered, and
further investigations are under-
way, police officials said, adding
that police are trying to identi-
fy the accused, four in total, and
are hopeful of nabbing them
soon.
Footage from CCTV cam-
eras in the area showed the mis-
creants open fire at Middukhera
as he was getting into his parked
car. The police said he had gone
to meet a real estate dealer in the
area. The miscreants, all wear-
ing caps and face masks, can be
seen chasing Middukhera and
firing shots as he attempted to
run for cover. The police said
eight to nine rounds were fired,
after which the miscreants
escaped in a car.
After the attack,
Middukhera, who was a former
president of the SAD's student
wing, Student Organisation of
India, was rushed to a nearby
hospital, where he was declared
brought dead, the police added.
Shiromani Akali Dal (SAD)
senior leader and party
spokesperson Daljit Singh
Cheema said the incident has
once again exposed the state's
deteriorating law and order sit-
uation. “No one feels safe
because the law and order situ-
ation in Punjab has broken
down,” he said.
H^dcW0ZP[X
3P[[TPSTa
bW^cSTPSX]
^WP[X

$
B637=33@j 236@/2C j AC2/G j/C5CAB

fâ[S%
0?Q :01D;
Taliban fighters entered the
capital of northern
Afghanistan’s Jawzjan province
on Saturday, a provincial law-
maker said, after sweeping
through nine of 10 districts in
the province.
The government did not
deny lawmaker Mohammad
Karim Jawzjani’s claim that
Taliban fighters had entered
Sheberghan, but said the city
had not fallen. If the city falls,
it will be the second provincial
capital in as many days to suc-
cumb to the Taliban. Several
other of the country’s 34
provincial capitals are threat-
ened.
On Friday, the Taliban took
control of the southwestern
Nimroz provincial capital of
Zaranj, where the government
says it is still battling insurgents
inside the capital.
Sheberghan is particularly
strategic because it is the
stronghold of US-allied Uzbek
warlord Rashid Dostum, whose
militias are among those res-
urrected to aid the Afghan
National Security and Defence
Forces.
Heavy airstrikes were
reported by residents of
Sheberghan who also said the
Taliban had freed prisoners
from the city jail. They request-
ed to remain anonymous fear-
ing retaliation from both sides.
Taliban fighters have swept
through large swathes of
Afghanistan at surprising
speed, initially taking districts,
many in remote areas. In recent
weeks they have laid siege to
several provincial capitals
across the country as the last
US and NATO troops leave the
country. The US Central
Command says the withdraw-
al is more than 95 per cent
complete and will be finished
by Aug. 31.
The US Air Force contin-
ues to aid the Afghan air force’s
bombing of Taliban targets in
southern Helmand and
Kandahar provinces as Afghan
security forces try to prevent a
Taliban takeover.
On Saturday, the US and
British embassies in Kabul
repeated a warning to its citi-
zens still there to leave “imme-
diately” as the security situation
deteriorated.
On Friday, Taliban fighters
assassinated Dawa Khan
Menapal, the chief of the
Afghan government’s press
operations for local and foreign
media. It came just days after
a coordinated attempt was
made to kill acting defence
chief Bismillah Kha
Mohammadi in a posh and
deeply secure neighborhood of
the capital.
In a report to the UN
Security Council on Friday
the UN envoy for Afghanistan
urged the council to demand
the Taliban immediately stop
attacking cities in their offen-
sive to take more territory.
Deborah Lyons also called
on the international commu-
nity to urge both sides to stop
fighting and negotiate to pre-
vent a “catastrophe” in the
war-torn country.
In Afghanistan’s Helmand
and Kandahar provinces in
the south of the country thou-
sands of Afghans were dis-
placed by the fighting and liv-
ing in miserable conditions.
In Helmand’s provincial
capital of Lashkar Gah,
Afghanistan’s elite commando
forces aided by regular troops
were trying to dislodge the
Taliban but with little success,
said Nafeeza Faiez, a provincial
council member. Taliban are in
control of nine of the city’s 10
police districts.
Faiez said conditions for
residents are desperate as they
hunker down inside their
homes, unable to get supplies
or get to hospitals for treat-
ment. Many of the public build-
ings have also been badly dam-
aged in the fighting.
ER]ZSR_V_eVc_`ceY2WXYR_ac`gZ_TZR]TRaZeR]
?C8Q 8B;00103
Pakistan’s National Security
Adviser Moeed Yusuf has
said that no US official or law-
maker asked for a military
base in Pakistan, rejecting
reports that the Biden admin-
istration was seeking American
military bases in the country to
influence developments in
neighbouring Afghanistan.
Yusuf made the comments
ashewrappeduphis10-daytrip
totheUS.Hemetseniorofficials
duringhisvisitbeforeleavingfor
Islamabad,theDawnnewspaper
reported on Saturday.
“The word base was not
mentioned, not even once,
during our talks, except in the
media,” Yusuf told US-based
Pakistani journalists while
summing up the visit.
“Bases were not discussed
at all from either side during
this trip because we have
already made our position
clear. That chapter is closed,” he
said. Prime Minister Imran
Khan in June ruled out hosting
American bases in Pakistan for
military action inside war-torn
Afghanistan, fearing it might
lead to his country being “tar-
geted in revenge attacks” by ter-
rorists. Earlier reports in both
US and Pakistani media
claimed that the Biden admin-
istration was seeking military
bases in Pakistan to influence
developments in Afghanistan,
particularly if the Taliban
seized Kabul.
At recent congressional
hearings, US officials did talk
about using Pakistani airspace
for reaching Afghanistan and
having bases in the region but
did not say where.
Underlining Pakistan’s
desire to maintain good ties
with the US and China, Yusuf
said, “if there are tensions
between the United States and
China, we cannot say that our
relations with both will remain
seamless.”
0?Q C47A0=
Iran on Saturday denounced
accusations by leading indus-
trial nations that Tehran was
behind last week’s deadly attack
on an oil tanker in the Arabian
Sea, the official IRNA news
agency reported.
The report quoted Foreign
Ministry spokesman Saeed
Khatibzadeh as saying Iran
“strongly condemns” Friday’s
statement by foreign ministers
of the Group of Seven. The
group is made up of represen-
tatives of Britain, Canada,
France, Germany, Italy, Japan
and the US.
Khatibzadeh said the state-
ment made baseless accusa-
tions against Iran. He called the
accusation a “scenario” created
by Israel and said Israel has had
a long history designing simi-
lar “plots.” The vessel Mercer
Street is managed by a firm
owned by an Israeli billionaire,
and Israel — along with the US
and Britain — had previously
pointed the finger at
Tehran.
The G-7 said Friday the
July 29 attack in international
waters in the Arabian Sea off
the coast of Oman that killed
two people was “a clear viola-
tion of international law.” They
added that “all available evi-
dence clearly points to Iran.”
“We condemn the unlaw-
ful attack committed on a mer-
chant vessel,” the foreign min-
isters said in a joint statement.
“This was a deliberate and tar-
geted attack, and a clear viola-
tion of international law.”
Khatibzadeh said Iran as been
committed to providing secu-
rity in the Persian Gulf and
Strait of Hormuz and said Iran
was ready to work with nations
to form a collective security
system while defending its sov-
ereignty.
In their statement, the G-
7 countries said “Iran’s behav-
ior, alongside its support to
proxy forces and non-state
armed actors, threatens inter-
national peace and security.”
“We call on Iran to stop all
activities inconsistent with rel-
evant UN Security Council
resolutions, and call on all
parties to play a constructive
role in fostering regional sta-
bility and peace,” they said.
0?Q F78C4?;08=B
Two Myanmar citizens were
arrested on charges alleging
that they conspired to oust
Myanmar’s ambassador to the
United Nations, who opposes
the military junta that seized
power earlier this year, by injur-
ing — or even killing — him.
Phyo Hein Htut and Ye
Hein Zaw plotted to seriously
injure or kill Myanmar’s
ambassador in an attack that
was to take place on American
soil, US Attorney Audrey
Strauss said in a release Friday.
According to court docu-
ments in White Plains federal
court, a Thailand arms dealer
who sells weapons to the
Myanmar military hired the
pair to hurt the ambassador to
try to force him to step down.
If that didn’t work, the ambas-
sador was to be killed, author-
ities said. Myanmar’s military
overthrew the country’s civilian
government in February.
Myanmar’s currently recog-
nized UN ambassador, Kyaw
Moe Tun, staunchly opposed
the ouster of civilian leader
Aung San Suu Kyi. In a speech
to the General Assembly in late
February, Tun called for “the
strongest possible action from
the international community”
to restore democracy.
Myanmar’s military has
tried to remove Tun from his
post, but the 193-member
General Assembly is responsi-
ble for accrediting diplomats
and has not taken action at the
military’s urging.
There was no immediate
response to a phone call and
email to Myanmar’s UN
Mission seeking comment.
The plot to maim or kill
Tun was to be carried out in
Westchester County, where the
ambassador lives, according to
two criminal complaints.
Htut last month was con-
tacted by the arms dealer, who
wanted to pay several thousand
dollars for Htut to carry out the
attack, the complaints said.
Htut received a $2,000 advance
on July 23, it added.
After the FBI learned of the
plot on Tuesday, it arranged to
interview Htut on Wednesday,
when Htut described the plan,
which included initially tam-
pering with the ambassador’s
tires to cause an accident, the
complaint said. It said Htut
received $4,000 in payments to
carry out the attack and was to
be paid another $1,000 once it
was finished.
In a complaint against Zaw,
authorities said Zaw admitted
after his arrest that he sent the
$4,000 to Htut.
0?Q A00;;07
Israeli warplanes struck two
targets in the Gaza Strip
early Saturday, the Israeli mil-
itary said, in response to incen-
diary balloons launched from
Gaza into Israel.
The Israeli military struck
what it said was a Hamas mil-
itary compound and a rocket
launching site after four incen-
diary balloons were launched
into Israel, setting fire to land
and damaging
agriculture. There were no
reports of casualties in Israel or
Gaza.
There was no immediate
comment from Hamas.
Israeli media reported that
four fires caused by incendiary
balloons broke out Friday after-
noon in areas close to the
Gaza Strip.
The launch of the balloons
comes over two months after
an 11-day war between Israel
and Hamas, the fourth since
the militant group seized power
in Gaza in 2007.
Hamas is upset that Israel
has done little to ease a crip-
pling blockade on the territo-
ry since the fighting ended and
appears to be using incendiary
balloons as a pressure tactic.
Israel’s new prime minister,
Naftali Bennet, has compared
the balloon launches to rocket
fire.
Israel and Egypt maintain
a blockade of Gaza that
includes Israeli control over the
territory’s coast and airspace
and restrictions on the move-
ment of people and goods in
and out of the territory.
0?Q 10=6::
Thai riot police on Saturday
fired water cannons, tear gas
and rubber bullets to repel a
crowd of several hundred young
anti-Government protesters
who marched on an army base
where Prime Minister Prayuth
Chan-ocha has his residence to
demand his resignation.
The demonstrators threw
rocks, bottles, fireworks and
fired slingshots during the
hours-long confrontation in
the Din Daeng area of
Bangkok, which was obscured
by swirling smoke.
The rally was led by the
Free Youth, a student protest
group that drew tens of thou-
sands to its protests last year. It’s
demanding Prayuth’s resigna-
tion over his handling of the
coronavirus crisis, which has
seen the number of cases spi-
raling and the health care sys-
tem stretched to the limit.
Prayuth has been criticised for
a slow vaccination programme.
Thailand reported a new
high of 21,838 confirmed cases
on Saturday, with 212 more
deaths. Bangkok and sur-
rounding provinces have been
under lockdown, including
overnight curfew, for weeks.
According to the city’s
Erawan Medical Center emer-
gency services, five people were
hospitalised, including three
police officers. The march was
called off in the early evening
but disturbances continued,
with protesters battling the
police and hurling objects.
?C8Q ;07A4
Pakistan’s law enforcement
agencies on Saturday arrest-
ed over 50 people, including the
mainsuspects,allegedlyinvolved
in an attack on a Hindu temple
in a remote town of the coun-
try’s Punjab province, a day
aftertheSupremeCourtadmon-
ished the authorities for their
failure to protect the shrine.
They also booked 150 peo-
ple in connection with the
attack on Wednesday.
A mob attacked the temple
at Bhong city of Rahim Yar
Khan district of the province,
some 590 kms from Lahore, in
protest against the release of an
eight-year-old Hindu boy, who
was arrested for allegedly uri-
nating in a local seminary.
“More than 50 suspects
have been arrested so far
through analysis of video
footages in a shameful ran-
sacking incident at a temple in
Rahim Yar Khan,” Punjab Chief
Minister Usman Buzdar tweet-
ed. “We will make sure that no
such incident happens (in the
future). Besides, the restoration
work of the temple has been
underway in full speed,” he
said.
He also shared the pho-
tographs of some of the arrest-
ed people on his social media
account. District Police Officer
(DPO) of Rahim Yar Khan
Asad Sarfraz told PTI that all
“main suspects” in the temple
attack case have been arrested.
An FIR has been registered
under terrorism and other sec-
tions of the Pakistan Penal
Code against over 150 people
for their involvement in attack-
ing the temple, he said.
Pakistan’s Supreme Court
on Friday pulled up authorities
for failing to stop the attack and
ordered the arrest of the cul-
prits, observing that the inci-
dent has tarnished the image of
the country abroad. Chief
Justice of Pakistan Gulzar
Ahmed said that vandalism at
the temple had brought shame
to the country as police acted
like silent spectators.
?C8Q F0B78=6C=
The whereabouts of a USD
5,800 bottle of Japanese
whiskey that was gifted to for-
mer US Secretary of State Mike
Pompeo is baffling the state
department which has
launched an inquiry into what
happened to the expensive
booze, according to media
reports.
The US Department of
State is looking into the where-
abouts of the bottle, CNN
reported, citing state depart-
ment filings in the federal reg-
ister.
The Government of Japan
gifted the whiskey to Pompeo
in 2019, the document says.
The department took the
unusual step of noting that the
whereabouts of the whiskey is
unknown. Similar filings over
the past two decades make no
mention of any similar inves-
tigations, The New York Times
reported.
“The department is look-
ing into the matter and has an
ongoing inquiry,” the filing
said. But it is unclear if Pompeo
himself received the whiskey or
if a staffer accepted it.
Pompeo said Thursday that
he never received the bottle of
whiskey and that he had “no
idea” it was missing, nor what
happened to the gift.
?C8Q 14898=6
China’s Wuhan city, where
the coronavirus first
emerged in 2019 and which is
currently experiencing a resur-
gence of infections, has tested
11.23 million of its over 12 mil-
lion people, local authorities
said on Saturday.
Wuhan reported six new
locally-transmitted confirmed
cases and 15 asymptomatic
cases. By the end of Friday,
Hubei province, Wuhan’s cap-
ital, reported 47 confirmed
Cocid-19 cases, including 31
locally-transmitted cases.
Wuhan has collected over
11.23 million samples for
nucleic acid testing, local
authorities said.
There were also 64 asymp-
tomatic cases under medical
observation, the state-run
Xinhua news agency reported.
The city launched a new,
all-inclusive testing drive on
August 4. The results from 10.8
million of the samples are
available.
Baltimore: The US is now
averaging 1,00,000 new Covid-
19 infections a day, returning to
a milestone last seen during the
winter surge in yet another
bleak reminder of how quick-
ly the delta variant has spread
through the country.
The US was averaging
about 11,000 cases a day in late
June. Now the number is
107,143.
It took the US about nine
months to cross the 1,00,000
average case number in
November before peaking at
about 2,50,000 in early January.
Cases bottomed out in June but
took about six weeks to go back
above 1,00,000, despite a vac-
cine that has been given to
more than 70 per cent of the
adult population.
The virus is spreading
quickly through unvaccinated
populations, especially in the
South where hospitals
have been overrun with
patients.
Health officials are fearful
that cases will continue to soar
if more Americans don’t
embrace the vaccine. AP
0?Q 34=E4ADB
When the delta variant started spreading, Gina
Welch decided not to take any chances: She
got a third, booster dose of the Covid-19 vaccine
by going to a clinic and telling them it was her first
shot.
The US Government has not approved boost-
er shots against the virus, saying it has yet to see
evidence they are necessary. But Welch and an
untold number of other Americans have managed
to get them by taking advantage of the nation’s vac-
cine surplus and loose tracking of those who have
been fully vaccinated.
Welch, a graduate student from Maine who
is studying chemical engineering, said she has kept
tabs on scientific studies about Covid-19 and fol-
lows several virologists and epidemiologists on
social media who have advocated for boosters.
0?Q ;=3=
ABritish scientist who gained
prominence for issuing dire warn-
ings about the spread of Covid-19 said
Saturday the UK is unlikely to need
future lockdowns, although new infec-
tions may rise significantly as social
interactions increase.
Professor Neil Ferguson, an infec-
tious disease expert at Imperial College
London, told The Times of London
that Britain is likely to move to a sit-
uation where the disease can be man-
aged by vaccinations rather than “cri-
sis measures” such as lockdowns.
“I wouldn’t rule it out altogether,
but I think it’s unlikely we will need a
new lockdown or even social-dis-
tancing measures of the type we’ve had
so far,’’ he said. “The caveat to that is,
of course, if the virus changes sub-
stantially.”
Data released Friday showed the
latest virus surge in the UK has eased,
with the number of people testing pos-
itive for Covid-19 falling in most parts
of the country. Based on its weekly sur-
vey of infection levels, the Office for
National Statistics said infection rates
appeared to be falling in England,
Scotland and Wales, though not in
Northern Ireland, with the biggest
declines in younger age groups.
Public health experts credit the
U.K.’s successful nationwide vaccina-
tion program for slowing the spread
of Covid-19 even in the face of the
more infectious delta variant, which
was first discovered in India and is
now the dominant form of the disease
in Britain.
AT[PcXeTbR^[[TPVdTbP]SUaXT]Sb_aPhQTWX]ScWTQ^ShÛ3PfP:WP]T]P_P[
SXaTRcâÛ0UVWP]XbcP]´b6êTa]T]c8]UâPcX^]TSXP2T]cTaX]:PQd[
0UVWP]XbcP]^]BPcdaSPh 0?
1RWDONEWKH86
IRUPLOLWDUEDVHLQ
3DNLVWDQ16$XVXI
,UDQUHMHFWV*
DFFXVDWLRQVRYHUIDWDO
DWWDFNRQRLOWDQNHU
EYRZA`]ZTVWZcVeVRcXRdZ_
acèVde`gVcaR_UV^ZTcVda`_dV
0]cX6êTa]T]c_a^cTbcTabPaRW^]Pa^PSX]1P]VZ^ZCWPX[P]S^]BPcdaSPh 0?
9cbQU]YYdQbicdbY[Uc
8Q]QcQVdUbQe^SX
_VVYbURQ__^c
#TYRcXVUZ_a]èe`YRc^`c
Z]]jR_^RcV_g`je`F?
SHRSOHDUUHVWHGRYHU
ERRNHGLQ3DNLVWDQIRU
DWWDFNRQ+LQGXWHPSOH
4YZ_R¶dHfYR_
TZejeVded#$^
R^ZUT`c`_RgZcfd
cVdfcXV_TV
86QRZDYHUDJLQJ
/QHZRYLG
LQIHFWLRQVDGD
FDDeReV5Vaeac`SZ_X
hYVcVRS`fed`W)!!Sèe]V
`WhYZdjXZgV_eÀ`âV`
2QFHJORRPVFLHQWLVWVDV
IXWXUH8.ORFNGRZQVXQOLNHO
D`^VZ_FDXVeeZ_X
4`gZU*S``deVcd
hZeY`fe752Raac`gR]

^]Th
?C8Q =4F34;78
Textiles Minister Piyush
Goyal on Saturday called
for increasing handloom
exports to Rs 10,000 crore and
doubling the production to Rs
1.25 lakh crore in the next three
years with a view to promoting
the growth of the sector.
At present, handloom
exports are worth Rs 2,500
crore and production is about
Rs 60,000 crore.
“Let us today all resolve collectively on this day that we
will go for a Rs 10,000 crore tar-
get for exports of handloom
products and a target to
increase our production to Rs
1.25 lakh crore in the next three
years,” he said at the National
Handloom Day celebrations.
He also suggested forming
a team under the chairmanship
of Sunil Sethi of Fashion
Design Council of India
(FDCI) consisting of weavers,
trainers, equipment makers,
marketing experts and other
stakeholders to recommend
ways and means to promote the
growth of the sector. The sec-
tor should become strong and
prosper without depending
much on state support, Goyal
said. “We have to look for new
ways to boost handloom pro-
duction and explore new mar-
kets,” he added.Speaking at the
event, Textiles Secretary U P
Singh said the ministry is
working on ways to ensure arti-
sans and weavers get the right
price for their products.
?C8Q =4F34;78
The Income Tax (I-T)
department on Saturday
notified three official email
IDs for taxpayers to register
grievances under the faceless or
e-assessment scheme.
The department issued a
message on its official Twitter
handle saying: “In a move
aimed to further improve tax-
payer services in alignment
with the Taxpayers’ Charter, the
Income Tax Department cre-
ates dedicated e-mail ids for
registering grievances in
respect of pending cases under
the Faceless Scheme.”
It said grievances can be
furnished under three separate
email IDs created for the pur-
pose.
“For faceless assessments:
samadhan.Faceless.Assessment
@incometax.Gov.In; For face-
less penalty:
samadhan.Faceless.Penalty@in
cometax.Gov.In; For faceless
a p p e a l s :
samadhan.Faceless.Appeal@inc
ometax.Gov.In,” the depart-
ment said.
Under the faceless assess-
ment system, a taxpayer or an
assessee is not required to visit
an I-T department office or
meet a department official for
income tax-related businesses.
A central electronic-based
system picks up tax returns for
scrutiny based on risk para-
meters and mismatches, and
then allots them randomly to
a team of IT officers in any city.
The scrutiny by these officers
are stated to be reviewed by
officers at another randomly
selected location.
The scheme was launched
by the Union government in
2019.
80=BQ =4F34;78
India’s real GDP is expected to
grow by 20 per cent on a
year-on-year (YoY) basis in
the first quarter of FY22,
Motilal Oswal Financial
Services (MOFS) said in a
report.
According to MOFS’
EcoScope report, the
‘Economic Activity Index’ for
India’s real GVA grew by 11.6
per cent YoY in June, after
growing 22.8 per cent YoY in
May.
“It implies EAI-GVA
growth of 22.6 per cent YoY in
1QFY22, following a contrac-
tion of 14.4 per cent YoY in
1QFY21. A low base led to
higher double-digit growth in
the non-farm sector, while
farm activity grew 6.6 per cent
in the quarter,” the report said.
“The estimates suggest that
India’s real GDP growth was 20
per cent YoY in 1QFY22, which
is in line with our expectations,”
it asserted.
Notwithstanding the dou-
ble-digit growth in 1QFY22,
the real GDP growth would
slow towards 5-7 per cent in the
remaining quarters of FY22.
“The way EAI-GVA, EAI-
GDP was also supported large-
ly by a low base. Although EAI-
GDP grew by a modest 3.6 per
cent YoY in June as against 11.6
per cent YoY in May, it
increased by 23 per ent YoY in
1QFY22 as against a contrac-
tion of 21.2 per cent YoY in
Q1FY21.
“While private consump-
tion grew by 18 per cent YoY
in 1QFY22, government rev-
enue spending contracted in
real terms in the quarter.
Preliminary estimates indicate
India’s EAI for GVA posted
lower double-digit growth of
11.6 per cent YoY in June, after
growing 22.8 per cent YoY in
May,” the report said.
80=BQ =4F34;78
The Income Tax Department
has further strengthened its
Faceless Scheme by extending
grievance registering facility
to taxpayers without any phys-
ical touch points.
The department has now
created dedicated e-mail ids for
the Faceless Scheme.
So a taxpayer may now be
required to just mail his/her
grievance related tax assess-
ment, levy of penalty or appeals
and the tax department would
address the same without
requiring taxpayer to be phys-
ically present for the work.
“In a move aimed to fur-
ther improve taxpayer services
in alignment with the
Taxpayers’ Charter, the Income
Tax Department has now cre-
ated dedicated e-mail ids for
the Faceless Scheme,” the I-T
department said on a tweet.
The department said that
grievances can be furnished ;
for Faceless assessments at
samadhan.faceless.assess-
ment@incometax.gov.in; for
Faceless penalty at samad-
han.faceless.penalty@incometa
x.gov.in; and for Faceless
Appeals at samadhan.face-
less.appeal@incometax.gov.in.
80=BQ =4F34;78
India expects to refund $1 bil-
lion to UK-based Cairn
Energy after it moved to scrap
a retrospective tax law that
unleashed bitter fights with
prominent foreign investors,
Financial Times reported.
The lower house of parlia-
ment on Friday approved a
draft law introduced the pre-
vious day, cancelling a 2012
policy that enabled New Delhi
to tax some foreign investments
retrospectively. The upper
house is expected to approve
the law as early as next week.
New Delhi would
also drop $13.5 billion
in outstanding claims
against multinationals
such as telecoms group
Vodafone, pharmaceu-
ticals company Sanofi
and brewer SABMiller,
now owned by AB
InBev, as part of efforts
to repair its damaged
reputation as an invest-
ment destination, the
report said.
Analysts say the
legal initiative would
allow New Delhi to
resolve a bitter interna-
tional tax battle with
Cairn that has grown
increasingly embar-
rassing for India. The
UK energy group has
sought in recent months
to seize some of the
government’s estimat-
ed $70bn worth of over-
seas assets.
“It’s a settlement
offer masquerading as a
law,” said one foreign
business analyst, who
requested anonymity.
Prime Minister
Narendra Modi’s gov-
ernment hopes the res-
olution of the dispute
can bolster its reputa-
tion among foreign
companies as it seeks
new investment to
revive India’s Covid-
battered economy.
80=BQ =4F34;78
Prime Minister Narendra
Modi on Friday urged
Indian Missions abroad to
showcase India’s manufacturing
capabilities globally.
Addressing the Indian
Missions across the globe vir-
tually, Modi also called for
close co-ordination among the
diplomats, Commerce
Ministry, Indian exporters and
producers in a bid to boost
exports from the country.
“’India House’ present in
different countries should also
become the representatives of
India’s manufacturing power.
From time-to-time you should
alert and guide stakeholders in
India, which will help in
improving the exports,” he
told the diplomats while
speaking on
‘#LocalGoesGlobal - Make in
India for the World’.
He was of the view that
now is the time to move ahead
with targets in terms of ‘Brand
India’.
“This is the time to estab-
lish a new recognition regard-
ing quality and reliablity. We
need to ensure that India’s
high value-added products
reach each and every corner of
the world,” Modi told the diplo-
mats.
Observing that exports
amount to 20 per cent of the
country’s GDP, the Prime
Minister said that given the size
and potential of the Indian
economy and that of the man-
ufacturing and services sectors
in the country, there is scope to
increase the share of exports in
the GDP.
Talking of the
Government’s decision to nul-
lify the much contentious ret-
rospective taxation provisions,
the Prime Minister noted that
the decision shows the govern-
ment’s commitment towards
stable policies and consistency
of those policies.
He mentioned of four key
factors which are required to
improve exports, the first factor
being the requirement for a
multi-fold growth in manufac-
turing. Elimination of obstacles
in terms of transportation and
logistics, government’s sup-
port for exports, and the inter-
national market for Indian
exports are the other key fac-
tors to enhance exports from
the country, Modi added.
Speaking of the govern-
ment’s support for the growth
in domestic manufacturing, he
said that the ‘production-
linked incentive’ (PLI)
schemes would help not only
in increasing the scale of
Indian manufacturing, but
also aid in raising the stan-
dards of global quality and
efficiency.
The Directorate of Tourism,
Jammu, organised a one
day Trek from Shri Mata
Vaishno Devi Shrine Board
Nursery, Panthal to Devi Pindi
which is situated at foothills of
Trikuta hills and believed to be
as equally important to Mata
Vaishno Devi on 7th of August,
2021 .A group of 30 Trekkers
and bloggers was flagged off by
Sh. Abhishek Sharma, IAS,
SDM Katra and Smt. Natasha
Kalsotra, JKAS, Joint Director
Tourism, Jammu. The trek is
about 5 km to the temple and
starts from a narrow stream
flowing throughout the trek
route. On this adventurous
track, there’s a variety of flora
and fauna making every sight
delightful. Huge peaks and
hillocks on the way promise to
keep the journey magnificent.
The surroundings are a visual
treat, particularly for nature
lovers.
CVR]85AXc`heY`W
#!J`JViaVTeVU
Z_B7J##+CVa`ce
?^SXTgWâcbSX_[^Pcbc^
bW^fRPbT8]SXP³bP]dUPRcdaX]V
_a^fTbb³Pa^d]ScWTfâ[S
8CST_cXbbdTbTPX[83bUâ
aTVXbcTaX]VVaXTeP]RTbd]STa
UPRT[TbbPbbTbbT]cbRWTT
)DFHOHVVJULHYDQFH
UHJLVWHULQJVFKHPH
LPSURYHG
SPhcaTZ
âVP]XbTSQh
3XaTRcâPcTÛ
C^daXb9Pd
6^hP[RP[[bUâX]RaTPbX]VWP]S[^^
Tg_âcbc^C RaX]cWaTThTPab
:_UZRe``WWVc
4RZc_6_VcXj
S_cVWf_U

Pioneer dehradun-english-edition-2021-08-08

Pioneer dehradun-english-edition-2021-08-08

Recommended

Recommended

More Related Content

More from DunEditorial

More from DunEditorial (20)

Recently uploaded

Recently uploaded (12)

Pioneer dehradun-english-edition-2021-08-08