![B0D60AB4=6D?C0Q :;:0C0
With Bengal elections
round the corner Prime
Minister Narendra Modi on
Saturday made a successful
use of a Government pro-
gramme organised to celebrate
the 125th anniversary of Netaji
Subhas Chandra Bose even as
he linked India’s soaring mili-
tary prowess and Atma Nirbhar
to Netaji’s Azaadi dreams.
Referring to “one of the
greatest sons of the country” as
the “first Prime Minister of
undivided India” Modi said
Bose would have been hugely
pleased with the current day’s
self reliance drive made by his
Government. “Steady eradica-
tion of poverty, hunger, illiter-
acy, adoption of scientific tech-
niques and strong borders was
the crux of Netaji’s concept of
Azaadi (freedom),” Modi said.
The greatest of freedom
movement would have been
“highly pleased to see how
Indian strength was flourishing
from LAC to LoC and how it
posses and manufactures state
of the art aircraft like Rafale
and Tejas,” said Modi, adding
Atma Nirbhar (self reliance)
drive made by his Government
was what Netaji wanted.
“The way we handled the
biggest pandemic of the centu-
ry and the way we are manu-
facturing and exporting vac-
cines to other countries too
would have Netaji proud,” he
said adding how his
Government was pursuing the
policies that was once envi-
sioned by Netaji. “Today we
have a national education pol-
icy in place and are coming up
with IITs, IIMs and other such
institutions and legislations to
take India from strength to
strength… would not Netaji be
proud of the developments that
we are making today… he cer-
tainly would have,” Modi said.
“Today India is retaliating
in equal measures whenever its
sovereignty is being challenged
on the borders,” said Modi
adding how the concept of
“Sonar Bangla” (golden Bengal)
— a political coinage of the BJP
taken out of Tagore’s works —
was inspired by Netaji.
“The concept of Sonar
Bangla fits with Netaji’s vision
of India and Bengal and it is in
this regard that the policy of
self reliance should be applied
both in the State and the entire
country,” Modi said.
In what local analysts said
a clever ploy to use Netaji
ahead of the elections, Modi
said “though every drop of our
blood is indebted to Netaji
and though we cannot pay
back his debt a time has come
to remember his contributions
to Indian freedom struggle
through various programmes”.
One such initiative the
Prime Minister said was the
renaming of Howrah Kalka
Mail as Netaji Subhas Express.
Modi’s “finely decorated
and well-packaged” statements
was aimed at not only the
Congress which is often
regarded as the mastermind
behind the disregard and aban-
donment Netaji suffered in the
pages of history but also sup-
port the BJP’s cause in election
bound Bengal, experts said.
“On the 125th birth
anniversary of the leader, I bow
to him on behalf of the grate-
ful nation. Today, I also salute
this virtuous land of Bengal,
which made the child Subhash
Netaji,” Modi said.
Addressing the Prakram
Diwas celebrations in the city,
Modi said, “On this day, that
brave son was born in the lap
of Mother Bharati, who gave a
new direction to the dream of
independent India.”
“On this very day, there
was that consciousness in the
darkness of slavery, who stood
in front of the biggest power of
the world and said, I will not
ask you for freedom, I will take
it away,” Modi said in his trib-
ute to Bose.
Earlier in the day, Modi
paid floral tributes at Netaji
Bose’s statue at the National
Library in the city. Modi went
around seeing paintings by
around 100 artists on a 40-metre
long canvas on the sprawling
lawns of Belvedere House at the
National Library compound.
He was accompanied by West
Bengal Governor Jagdeep
Dhankhar. “His bravery and
ideals inspire every Indian. His
contribution to India is indeli-
ble. India bows to the great
Netaji Subhas Chandra Bose.
PM@narendramodi began his
Kolkata visit and
#ParakramDivas programmes
by paying homage to Netaji
Bose at Netaji Bhawan,”
Prime Minister’s Office said in
a tweet after PM Modi reached
Kolkata.
BC055A4?AC4AQ =4F34;78
The Delhi Police on Saturday
gave permission to protest-
ing farmers’ unions to hold
their tractor rally on January 26
in the city. Meanwhile, Anil
Mittal, the Additional Public
Relations Officer (APRO) of
Delhi Police, claimed that the
policeandfarmers’unionsarein
final stage of talks for the routes
regarding tractor rally.
After attending the meeting
with Delhi Police, its counter-
parts Haryana and Uttar
Pradesh Police, farmers’ union
memberAbhimanyuKoharsaid
the tractor parades will start
from Ghazipur, Singhu and
Tikri border points of Delhi, but
details will be finalised on
Saturday night. Kohar claimed
that the Delhi Police has given
its nod to the farmers’ tractor
parade on Republic Day in the
national Capital.
Another farmer leader
Gurnam Singh Chaduni said as
thousands of farmers will par-
ticipate in the parade, there will
be no single route. Farmer
leader Darshan Pal said barri-
cades set up at Delhi border
points will be removed on
January 26 and farmers will take
out tractor rallies after entering
the national Capital. Thousands of farmers, mostly from Punjab
and Haryana, have been
protesting at several Delhi bor-
der points against the Centre’s
new agriculture laws for near-
ly two months. The unions
representing the farmers have
begun holding tractor rallies at
villages in Punjab to mobilise
people for the demonstration
on Republic Day.
The farmers are vehement-
ly opposing the Farmers
(EmpowermentandProtection)
Agreement of Price Assurance
andFarmServicesAct,2020;the
Farmers Produce Trade and
Commerce (Promotion and
Facilitation) Act, 2020; and the
Essential Commodities
(Amendment) Act 2020.
Enacted in September last
year, the three laws have been
projected bythe Centreasmajor
reforms in the agriculture sector
thatwillremovemiddlemenand
allow farmers to sell their pro-
duce anywhere in the country.
78C:0=370A8Q90D
Jawans of the Border Security
Force (BSF) on Saturday
detected another 150-metre
long and 30-feet deep cross-
border tunnel, fourth in the last
six months, in the Pansar area
of Kathua district.
The tunnel was detected
between border pillar number
14 and 15. A similar tunnel was
detected barely 10 days ago in
the Bobiya area of Samba sec-
tor on January 13.
Ground reports suggested
the starting point of the tunnel
was located closer to two
Pakistani border outposts
Abhiyal Dogra and Kingre-
de-Kothe located in Shakargarh
area. On the Indian side, the
local BSF commanders passed
necessary instructions to their
foot soldiers to remain in a state
of high alert in the run up to
the Republic Day celebrations
as Pakistani rangers may try to
push heavily armed infiltrators
inside the Indian territory to
launch terror attacks on vital
security installations.
Till the time of filing the
report the BSF authorities were
trying to ascertain whether
the same tunnel was recently
put to use by the Pakistan-
based handlers to push a group
of terrorists inside the Indian
territory. After supervising the
tunnel on ground zero,
Inspector General of BSF,
Jammu Frontier NS Jamwal
told reporters, “The tunnel
was detected by the BSF troops
during an ongoing anti tun-
neling drive launched in the
area on Saturday”. He said after
receiving intelligence inputs
about the presence of another
tunnel an extensive drive was
carried out in the forward area
which resulted in detection of
this tunnel.
Briefing media persons,
IG BSF also claimed the
tunnel was designed on
the same pattern as all previous
tunnels.
“Without the active con-
nivance of Pakistani establish-
ment and their consent it is not
possible to come closer to the
zero line,” he said.
?=BQ =4F34;78
India and China will hold
the ninth round of military
level talks on Sunday to find
ways to defuse stand-offs now
on for the last nine months at
the Line of Actual Control
(LAC) in Ladakh. The latest
talks take place after a gap of
nearly two months and
chances of a major break-
through are unlikely.
The logjam is persisting as
China wants India to first with-
draw its troops from the heights
of southern and northern banks
of the Pangong Tas (lake). In
August, the Indian Army
secured these hilltops over-
looking all the crucial Chinese
deployments thereby putting
them at a disadvantage.
Both the sides have so far
not managed to reach a mutu-
ally agreed plan for
disengagement and
de-escalation.
?=BQ A0=278
Rashtriya Janata Dal (RJD)
leader Lalu Prasad — con-
victed in fodder scam cases —
on Saturday was shifted to
AIIMS, Delhi after his health
condition deteriorated while
undergoing treatment at a
hospital at the Rajendra
Institute of Medical Science
(RIMS) in Ranchi for multi-
ple ailments.
Earlier, the Inspector
General of the jail said Lalu will
be flown to Delhi and should
be back in Ranchi within a
month, said .
“Lalu is having trouble
breathing for the last two days.
On Friday, he was found to be
having pneumonia.
Considering his age, we have
decided to shift him to AIIMS-
Delhi on the advice of doctors
for better treatment,” RIMS
Director Dr Kameshwar
Prasad told news
agency PTI.
?=BQ =4F34;78
In the past eight days since the
launch of the mega anti-
Covid-19 drive on January 16,
15.37 lakh persons have been
vaccinated till Saturday. Six
have died after taking the shots,
but the Government has main-
tained that their demise has no
link with the vaccination.
Around 500 cases of AEFI
have been reported. Health
experts have, however, urged
the Union Health Ministry
and ICMR to investigate these
deaths even if these were not
directly linked to the vaccine
against the coronavirus.
0n Saturday, a 56-year-old
woman who was a resident of
Gurugram, succumbed. After
taking the jab.
“The post-mortem con-
firms that cardio-pulmonary
disease was the reason for her
death and it was not related to
vaccination. None of these
deaths have been causally
linked with Covid-19 vaccina-
tion,” said an official from the
Union Health Ministry here on
Saturday.
“Is anybody investigating
deaths after vaccination so as to
come out with do’s and don’ts
about vaccination. This is the
science we need to contribute
to it so that future can be safe-
guarded,” said Dr Rahul
Bhargava, Director-Bone
Marrow Transplant
Programme, Fortis Memorial
Research Institute, Gurugram.
Another health expert
from the Government hospital
said most of these beneficia-
ries are said to have died
because of the heart-related
problems.
?C8Q F0B78=6C=
The United States Senate
would begin the impeach-
ment trial of former President
Donald Trump on February 8,
Senate Majority Leader Chuck
Schumer said.
“The January 6th insurrec-
tion at the Capitol, incited by
Donald J Trump was a day none
of us will ever forget. We all
want to put this awful chapter
in our nation’s history behind
us. But healing and unity will
only come if there is truth and
accountability. And that is what
this trial will provide,” Schumer
said on the senate floor.
BoththeRepublicanandthe
Democratic Party now have 50
seats each in the 100 member
Senate. Schumer said the house
managers will come to read the
articleofimpeachmentat7pmon
Monday.
B0D60AB4=6D?C0Q
:;:0C0
Irked by Jai Shri Ram slogans
raised by a section of the
audience, Bengal Chief
Minister Mamata Banerjee
on Saturday walked off the
podium refusing to deliver a
speech at an event — attend-
ed by Prime Minister
Narendra Modi —
to celebrate the 125th anniver-
sary of Netaji Subhas
Chandra Bose.
The Central Government
programme was organised at
the iconic Victoria Memorial.
Alleged saffron supporters
raised the slogans moments
before Mamata was to deliv-
er her speech.
Walking up to the podi-
um the Chief Minister said,
“I am grateful to the Central
Government and Prime
Minister Narendra Modi for
organising this programme
in Kolkata and calling me to
be a part of the celebra-
tions… but it must be
remembered that this is not
a political but a Government
programme and its dignity
must be preserved…
“I must also remind that
no one has the right to insult
someone after inviting that
person… so on protest, I
desist from delivering a
speech.”
Then she walked off in a
huff leaving back a befuddled
silence.
:_UZRSVT`^Z_XhYRe?VeR[ZV_gZdZ`_VU+`UZ
30VDV%RVHZRXOGKDYHEHHQKXJHOSOHDVHGZLWKHQWUH¶V$WPD1LUEKDUGULYH
?TTeTSQh9PXBWaXAP
b[^VP]b3XSXfP[Zb^UU
bcPVTfXcW^dcb_TTRW
2_`eYVcARef__V]W`f_U
R]`_XS`cUVc%eYZ_'^eYd
'HOKL3ROLFH2.¶VIDUPHUV¶
WUDFWRUSDUDGHRQ5'D
ZdR_f_Z`_dT`ad
RXcVV`_c`feVdW`c
^RcTYWc`^DZ_XYf
8YRkZafcEZcZ
:_UZR4YZ_R¶d
*eYc`f_U`W=24
aRc]Vjde`URj
e`V_UWRTV`WW
=R]fdYZWeVU
e`5V]YZ2::D
RWeVcYZdYVR]eY
UVeVcZ`cReVd
FDDV_ReVe`
deRceEcf^a
Z^aVRTY^V_e
`_7VScfRcj)
8`gedRjd'UVReYd
RWeVc[RSYRgV_`
]Z_hZeYdY`ed
ViaVcedRd:4C
e`ac`SVTRfdV
/JHWRYLGMDEVLQGDV
?aXTX]XbcTa=PaT]SaP^SXfXcWFTbc1T]VP[2WXTUX]XbcTaPPcP1P]TaYTTaT[TPbTbPQ^^ZSdaX]V !$cWQXacWP]]XeTabPah^U=TcPYXBdQPbW2WP]SaP1^bTPc
EXRc^aXPT^aXP[X]:^[ZPcP^]BPcdaSPh ?C8
5PaTabPaRWc^fPaSb3T[WXc^Y^X]cWTXaPVXcPcX^]PVPX]bccWT2T]caTbUPaaTU^a
[PfbX]0aXcbPa^]BPcdaSPh ?C8
0TSXRPSX]XbcTabcWTUXabcS^bT^U2^eXbWXT[SePRRX]T^]Ua^]c[X]Tf^aZTa?PfP]
BPaPbfPcPcPRXchSXb_T]bPahX]1XZP]Ta^]BPcdaSPh ?C8
$B70=C84B6DCC438=
58A48=40BC34;78
=Tf3T[WX) eTa$bWP]cXTb
fTaTVdccTSX]PPbbXeTUXaT
cWPcQa^ZT^dcX]TPbc3T[WX³b
6WPiX_da3PXah5PaPaTP^]
BPcdaSPh^UUXRXP[bbPXS5XaT
^UUXRXP[baTRTXeTSX]U^aPcX^]
PQ^dccWTQ[PiTPc # _
U^[[^fX]VfWXRW UXaTcT]STab
fTaTadbWTSc^cWTb_^c
64=A4C30DBC8=DB
58ABC1;02:345B42H
FPbWX]Vc^]) CWTD]XcTSBcPcT
BT]PcTWPbR^]UXaTScWT
]^X]PcX^]^U6T]TaP[aTcXaTS
;[^hS0dbcX]c^bTaeTPb
bTRaTcPah^UcWTSTUT]RT
ST_PacT]cPZX]VWXcWT
UXabcTeTa0UaXRP]0TaXRP]c^
^RRd_hcWTc^_?T]cPV^]
_^bXcX^]
6ECC40274A384B5
2E838=;D3780=0
;dSWXP]P)0
#'hTPa^[S
6^eTa]T]c
bRW^^[cTPRWTa
fW^WPScTbcTS
_^bXcXeTU^a2^eXS (SXTSPcP
_aXePcTW^b_XcP[WTaT^]
BPcdaSPhU^[[^fX]VfWXRWWTa
!R^[[TPVdTbP]ScWaTT
bcdST]cbP[b^aTcda]TS_^bXcXeT
aTbd[cbP]^UUXRXP[bPXS
20?BD;4
Chandigarh: Haryana police
was on Saturday questioning a
man after agitating farmer
leaders alleged that he was
involved in a conspiracy to kill
four of them and create dis-
turbance during their pro-
posed tractor parade in Delhi
on January 26.
The man was allegedly
nabbedattheSinghuborderby
the protesting farmer leaders
who paraded him before
reporters on Friday night and
later handed him over to the
police. His face covered with a
scarf, the man claimed that a
plan was hatched to shoot
four farmer leaders, who are
known faces in the media, on
the stage on Saturday.
“On January 26, there was
a plan to create disturbance
during the tractor parade by
opening fire on Delhi Police
personnel, which would
promptthemtoretaliateagainst
the protesting farmers in a
strong manner,” he claimed. A
policeofficialsaidtheman,stat-
edtobearound21yearsofage,
wasbeingquizzedinSonipatby
the Crime Branch of the state
police.Themanhasbeenresid-
ing in Sonipat and has no pre-
vious criminal record. “He was
not carrying any arms or
ammunition.We arequestion-
ing him, but nothing has so far
been found that points to any
kind of conspiracy, as is being
alleged,” the official said earli-
er in the day, adding that fur-
ther investigations are under-
way. When asked about the
matter, Chief Minister ML
Khattar said the police will give
an official statement after com-
pleting the questioning.
“Currently, the police is
questioning him. Till the time
this is going on, to say anything
will not be appropriate,” he told
reporters on Saturday on the
sidelines of an event,
At the Singhu border press
conference late on Friday
night, the farmer leaders pre-
sented the man who claimed
that his accomplices were
askedtoposeaspolicemenand
baton-charge the crowd during
the proposed tractor parade in
the national capital on
Republic Day.
The farmer leaders
claimed that they caught the
man from the protest site at
the Singhu border. He was
subsequently handed over to
the Haryana police. Farmer
leader Kulwant Singh Sandhu
alleged that attempts are being
made to disrupt the ongoing
agitation against three farm
laws.
Thousands of farmers,
mostly from Punjab, Haryana
and western Uttar Pradesh,
have been camping at several
border points of Delhi since
November 28 last year,
demanding a repeal of the
three farm laws and a legal
guarantee to the minimum
support price for their crops.
7PahP]P?^[XRT`dTbcX^]bP]PUcTa
_a^cTbcX]VUPaTa[TPSTabP[[TVTR^]b_XaPRh
c^ZX[[#^UcWTSXbad_ccaPRc^a_PaPST
?dQ[XbWTS5a^
34;78;D2:=F 17?0;
17D10=4BF0A A0=278
A08?DA270=3860A7
347A03D=7H34A0103
E890HF030
;PcT2Xch E^[ $8bbdT !
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
4bcPQ[XbWTS '%# 51,5HJQ1R+$(1*
fffSPX[h_X^]TTaR^
DA@CE)
?BA42E4A
05C4A40A;H9;CB
H@C=5'
?AC4BCB02ABBADBB80
340=3=0E0;=H³BA4;40B4
@?6J(
?4CA;384B4;?A824B
CD270;;C847867B
347A03D=BD=30H 90=D0AH!#!! *?064B'#C
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+ X]bcPVaPR^SPX[h_X^]TTa](https://image.slidesharecdn.com/pioneer-dehradun-english-edition-2021-01-24-210124015947/85/pioneer-dehradunenglishedition20210124-1-320.jpg)
![347A03D=kBD=30H k90=D0AH !#!! UX[bce!
9@6E962EC6
E96H9:E6E:86C
?VeW]Zi
Z_X+2URcdY8`fcRgAcZjR_R4Y`acR
CR[f^^RcCR`RYVdYR_[cVRc
CReVU+' !
T
here is something about a subject on
class friction that is intriguing and
fascinating especially for those who are
far removed from the actual reality. The White
Tiger based on Aravind Adiga’s book by the
same name is a movie that makes for a must
watch for several reasons.
First, Ramin Bahrani, the director, takes us
on a journey that is filled with a satirical
commentary on the class divide that exits even
today and the constant struggle between the
upper class and lower. With the upper class
wanting to dominate the other by keeping them
under their thumb by forcing them to remain
in poverty.
Second, the portrayal of this scenario is
extremely realistic. People who have been under
the thumb of zamindars, and they still continue
to be so, don’t have a choice. The entire village
is a slave to one master and strangely despite
the subjugation, they continue to serve the
master as feel it is an honour to be serving him
so closely.
Third, despite the film starting of on a dark
note and continues to be on a dark note till the
very end, the story resonates with everyone—
even those outside of India. The struggle by a
poor man wanting to make it big in life is what
almost all of us aspire.
Four, and the most important is the
absolutely brilliant and awesome performance
by Adarsh Gourav. This actor-singer as Balram
Halwai, a slave to his master, who dreams of
becoming something in life plays the part to a
T. From a driver to the owner of a company,
each part of his journey has been done to
perfection. His fascination with things that he
sees for the first time, is so natural. It is difficult
to imagine anyone playing this role but
Gourav. Watching him go from an unassuming
personality as a driver to a entrepreneur who
is comfortable in his skin is amazing to watch.
Definitely, Gourav is the white tiger here
who roars brilliantly. °BWP[X]XBPZbT]P
$GDUVK*RXUDYURDUV
I
t is rare that one gets to see
stories with deep meaning
that immediately catches
one’s attention, on TV. A case in
point is SET’s Kyun Utthe Dil
Chod Aaye. Set in 1947, Lahore,
pre-partition India, the show
narrates the story of three
young girls — Amrit, Vashma
and Radha. This story brings
forth their dreams, hope,
aspirations and new found love
— all this at the brink of
Independence. Knowing that
tomorrow will be different, the
three girls will set out to
conquer love and will stand the
test of time across borders.
Gracy Bitin Goswami, who
plays Amrit tells you that it is
the simplicity of the character
that attracted her to play Amrit.
“It’s a pre-partition era story
about a girl who loves her
family so much. She has many
dreams, but is ready to sacrifice
them for the sake of her family.
This is why she decides to
publish her poems with another
identity so that her father, who
is not a fan of such pieces,
doesn’t get hurt by her actions.
She goes through different
stories and has many emotions.
She is the reason behind
everybody’s smile. She is the
most beautiful girl of Lahore,
not only because of her
appearance, but because how
she is as a person.
This was the reason I was
attracted to play Amrit. Also,
she is so poised and has the
ability to deal with any situation.
I have been wanting to play
such a character. This is the first
time I am not playing a
teenager, whereas in my real life
I am, so I will be seen emoting
romance scenes. This is a big
deal and break for me. So,
there was no reason to turn
down the project,” she tells
you.
It was hard, she says, to get
into the skin of the character.
“The character is living in 1947.
She is shy and lives with a lot of
restrictions and today we are in
2021, so confident of whatever
we do and having the ability to
speak up for ourselves. So, I had
to take care of that and be
poised. Also, it was difficult to
bring in that body language and
the punjabi accent,” she tells
you.
It took Goswami a lot of
research and hard work to get
into the skin of such a different
character than hers. “I had to
watch a lot of 1970’s films and
shows and see how the actors
carried themselves and how
they dealt with situations. I
listened to the kind of songs we
had back then. I read a lot of
thick Sanskrit, Urdu and
Punjabi. I took tuitions to get
the diction right. I had to do a
lot of research to be able to play
Amrit,” she explains.
Goswami is not the only
jewel of the show, there is Diya
Aur Baati Hum’s fame Kanika
Maheshwari too, in a negative
role. She is back on TV after
three years and is excited to play
the role.
“I play Mogar, a widow. She
is very harmful and a dangerous
lady. She aims to create
unhappiness in the family and
is never happy with anything in
life. She thinks that it was
because of her brothers that she
ended up as a widow. She
blames them for marrying her
off at a young age in a small
house. She has this bitterness
and hence, wants to see others
unhappy too,” Maheshwari tells
you.
She tells you that she had no
apprehensions before taking
up the role. “This is a tailor-
made role for me. I have been
waiting to play such a role for
a long time. There is so much
to do in this show. Playing an
antagonist gives you a lot of
space to enhance your acting
skills. I am learning every day
and getting better at my craft,”
Maheshwari, who will be
sporting no makeup, tells you.
One thing that Maheshwari
likes about role is that though
the character has no colours
(dressed up in white clothes), it
is yet so colourful.
“The thing that I disliked is
that I am not getting to put any
makeup. As an actor, I like to do
makeup, but the role demands
me to look simple,” she says.
Just like Goswami,
Maheshwari too had to get her
punjabi accent right.
As appealing and unique
the trailer of the show looks, the
audience can hope they are in
for an entertainment ride with
this new offering with so many
good actors.
6A02H18C8=6BF08P]S:0=8:0074B7F0A8cT[[DB10
70B78fWPcB4C³b:hd]DccWT3X[2W^S0PhTP[[bTcc^V^^]PXa
Ua^^]SPhXbPQ^dccWTXaa^[TbP]SW^fRWP[[T]VX]VXcXbc^QT
P_Pac^U_TaX^SSaPP
³8?;F0BF0983´B3A40´
ITTCEWPbQTT]PUa^]cad]]TaX]
aTe^[dcX^]XbX]VcT[TeXbX^]R^]cT]c^eTacWT
_PbccWaTTSTRPSTbP]SXcXbP[[bTcc^
RWP]VTcWTUPRT^UdbXRaTP[XchbW^fb
^]RTPVPX]fXcWXcb[PcTbc]^]UXRcX^]
_a^_TachcWT8]SXP]?a^dbXR;TPVdT
8?;8]fWPcfX[[QTPR[dccTaQaTPZX]V
U^aPcX]]^ePcX^]ITTCEXbP[[bTcc^
_aTbT]cPdSXT]RTbfXcWcWTf^a[SbUXabc
TeTadbXR[TPVdTX]TPa[h!! FWX[TcWT
f^a[S^Ub_^acbWPbbTT]bTeTaP[[TPVdT
R^_TcXcX^]bcWXbd]X`dTdbXR[TPVdTfX[[
WPeTbXgcTPbaT_aTbT]cX]VSXUUTaT]c
aTVX^]b^U8]SXPQPcc[X]VXc^dcPVPX]bcTPRW
^cWTaX]PdbXRP[RWP_X^]bWX_4PRW^U
cWTbTbXgcTPbbd__^acTSQh[TPSX]V
1^[[hf^^SP]Sb_^acbRT[TQaXcXTbfX[[WPeT
c^__[PhQPRZbX]VTabPbcWTXaRP_cPX]b^]T
aTP[XchbW^fbcPaP]S^]TUaTbWe^XRTCWT
[XZTb^UXZPBX]VW:PX[PbW:WTaBPYXS
:WP]BWPP]0]ZXcCXfPaX9PeTS0[X0bTTb
:Pda1W^^XCaXeTSX0ZaXcX:PZPa?PhP[
3Te=TWP1WPbX]BWX[_PAP^WPeTQTT]
bXV]TS^]c^RP_cPX]cWTbXgi^]P[cTPb
5^abdRWPP^cWdbXRaTP[Xch
bW^fcWTRWP]]T[aTRT]c[h[Pd]RWTSP
eXQaP]cP]cWTcWPcbW^fRPbTSTPRW^UXcb
!cTPRP_cPX]bR^X]Vc^VTcWTaU^acWT
eTahUXabccXT2^_^bTSQhBPYXSFPYXS
cWXbdbXRP[PbcTa_XTRTXbP^]VbccWT
[PbcUTfR^_^bXcX^]b^UcWTSd^QTU^aT
FPYXS:WP]bcaPVXRSTXbT8]UPRcFPYXS
fPb^]T^UcWTUXabc_T^_[T^]Q^PaSU^acWT
bW^fP]S8]SXP]?a^dbXR;TPVdTfPb
WXbSaTPPb_TaBPYXS:WP]7TfPbb^
_PbbX^]PcTPQ^dcXccWPccWT[PcTdbXRXP]
f^aZTS^]XcTeTabX]RTcWTXSTPfPbQ^a]
0UcTaFPYXS_PbbX]VPfPhBPYXSXbUd[UX[[X]V
P]S[XeX]VWXbQa^cWTabSaTP
0bcWTRP_cPX]^U3T[WX3WdaaP]SWPab
P]ScWTR^_^bTa^UcWT8]SXP]?a^dbXR
;TPVdTP]cWTBPYXS:WP]aTeTP[TS)°8
WPeTQTT]Pbb^RXPcTSfXcWcWXbbW^fbX]RT
XcbbcPacX]UPRccWT^f]TabP]SFPYXSWPS
SaTPcPQ^dccWXbbW^fc^VTcWTaP]ScWTh
fTaTP[[f^aZX]Vc^fPaSbXc7TWPSc^[S
TcWPc8]TTSTSc^QTP_Pac^UcWTbW^f
P]SWT]RT8RPT^]Q^PaSU^aXcB^cWT
8]SXP]?a^dbXR;TPVdTfPbFPYXSb
SaTPP]SWTaT8P_dccX]Vh$_Ta
RT]cX]c^Xc±
C8=0B0?;0=BCCA0??827:D
0UcTa1WPhaP]XCX]PbP³b?PeXcaP
?d]XPR^TQPRZX]B^]hB01³b1PP[eTTa
ATcda]bWPe^RWPbaTSTUX]TSXcbT[UCWT
d_R^X]VT_Xb^STbfX[[fXc]TbbCX]PbP
VTccX]VTeT]UXTaRTacWP]QTU^aT0UcTa
_^Xb^]X]V1PP[eTTa3Te9^bWXfXcWP
b_XSTaP]S[TPeX]VWX_PaP[hiTSbWTWPb
bTcWTaThTb^]b^T^]TfW^RP]QTcWT
d[cXPcTRPcP[hbcU^aSTbcadRcX^]
FXcWWTa]Tf[hPR`dXaTS_^fTab
CX]PbPRaTPcTbPPVXRP[b_XSTafWXRW
bTRaTc[hQXcTb1PP[eTTa[TPeX]VWX_Pac[h
_PaP[hiTSD]PQ[Tc^WTP[1PP[eTTacWT
UPXaXTbP]SBWPdahPSTRXSTc^VTcPQPQh
VW^bc¯?XRWZd^dcWXbQ^gfW^TPbX[h
WTP[b1PP[eTTa?XRWZdPXbRWXTe^dbQdc
P]XT]bT[h_^fTaUd[QPQhVW^bcWPb
QTT]aTbXSX]VX]ETTa;^ZfWTaTWT
R^d[S]³cQTP]X_d[PcTSP]SXbdbTSQh
P]hTeX[
FWX[T?XRWZdWTP[b1PP[eTTaCX]PbP
cWa^dVWPPVXRP[_^acP[fXc]TbbTbcWT
T]cXaTPRcP]SSTRXSTbc^VTcWTaWP]Sb^]
?XRWZdfW^RP]PXSWTac^RaTPcTcWT
d[cXPcTWPe^R^]TPacW]cWT^cWTaWP]S
PbEXePP]EP]bWBPhP]XV^TbQPRZ^]
TPacWUa^ETTa;^Z?XRWZdbTRaTc[h
aTPRWTbEXePP]³bW^dbT^]TPacW?XRWZd
aTeTP[bcWPcWTWPb]^cQTT]PQ[Tc^V^
QPRZc^WXb_[P]TcP]Sc^aTcda]WTXb
aT`dXaTSc^S^^]TV^^SSTTS
FX[[?XRWZdQTPQ[Tc^_TaU^aPV^^S
STTSQTU^aTCX]PbPRP_cdaTbWX.7^f
fX[[EXePP]WT[_?XRWZdaTPRWWXbW^T.
EP]bWBPhP]XTbbPhX]VcWTa^[T^U
EXePP]bPXS°FWT]8[TPa]cPQ^dccWXbQPQh
VW^bcbc^ahXcfPbcWaX[[TSP]S8PbdaT
TeTah^]TfX[[[^eTXbRWXTe^dbP]SRdcT
?XRWZdCWTd_R^X]VT_Xb^STfX[[fXc]Tbb
CX]PbP³bSTPS[hcaP_U^a?XRWZdP]SXcfX[[
QTd_^]Q^cWcWT1PP[eTTabc^T]bdaT
?XRWZdPRR^_[XbWTbWXbV^^ScPbZX]
^aSTac^aTPRWWXb_[P]TcQdcXcfX[[]^cQT
cWPcTPbhFXcWCX]PbP³baTcda]cWT
RWP[[T]VTbPWTPS^UEXePP]P]S3TQdPaT
SP]VTa^dbP]SXcfX[[QTTgRXcX]Vc^fPcRW
W^fEXePP]WT[_b?XRWZd]cWT^cWTa
WP]SXcWPbQTT]TgRXcX]Vc^WPeT?PeXcaPSX
QPRZ^]cWTbTcbP]SbW^^cX]VfXcWWTa
PVPX]fPbPf^]STaUd[Tg_TaXT]RT±
C 4 ; ; H C 0 ; 4 A]R_J`fc5Rj
7TaXcPVT^U8]SXP4gWXQXcX^]
ET]dT)6^^S4PacW2Xch2T]caTP[[BTRc^a$6dadVaP7PahP]P
FWT])CX[[9P]dPah!%!!
CXT) !]^^]c^'_
4
gcT]SX]VcWTW^[XSPhbbTPb^]
6^^S4PacW2Xch2T]caTP[[
_aTbT]cbPaTYdeT]PcX]V8]SXP]
0acXbP]b³4gWXQXcX^]Rd
UTbcXeP[RdaPcTSQh]TF^a[S
5^d]SPcX^]¯P]=6fXcWcWT
^QYTRcXeTc^_a^^cTPacXbP]b
TgcT]SX]VcWTaXVWc_[PcU^ac^
bW^fRPbTcWTXaPacRaPUcCWT
TeT]c]PTS²7TaXcPVT^U8]SXP³
XbbTcc^caTPch^dcX[[9P]dPah
!%!!
CWTTgcaPePVP]iPfX[[
R^_aXbTP[[cWTZThPacXbP]b
Ua^SXUUTaT]caTVX^]bUa^P[[
^eTa8]SXP0[^bc#PacXbP]b³
RPcTV^aXTbX]R[dSX]VcWT
PSWdQP]X?PX]cX]VbUa^1XWPa?^ccTahUa^:WdaYPCPX[=PSd³bFPPVPXF^^S1aPbb
0acf^aZUa^3T[WXP]SP]h^aTPaTV^X]Vc^cPZTcWTb_^c[XVWc^eTaPU^ac]XVWc^][h
Pc6^^S4PacW2Xch2T]caTP[[
6WRURIRXQJGUHDPV
FP[[^U7^_T
C
WXbhTPaCWT1^ShBW^_XbdaVX]VTPRW^]T^Uh^dc^R^Tc^VTcWTaP]SPRc^]^da
R^[[TRcXeT_^fTac^RPaTP]ScaP]bU^acWTf^a[SX]c^PUPXaTaP]S^aTQTPdcXUd[f^a[S
C^PZTcWT2WaXbcPbPVXRaTP[U^aTeTahQTPdcXUd[Q^ShCWT1^ShBW^_d]eTX[TSXcb
2WaXbcPbFP[[^U7^_TX]R^[[PQ^aPcX^]fXcW3T[WXBcaTTc0acbW^fRPbTSPcBT[TRc
2XchfP[ZX]BPZTc=Tf
3T[WX
CWT1^ShBW^_
R^]cX]dTbc^bWX]TP[XVWc
^]8]SXP³bUTP[T
fPbcT_XRZTabfW^PaT
aPaT[hPRZ]^f[TSVTSPb
Ua^]c[X]TfPaaX^abX]cWT
2^eXSRaXbXb8]SXPWPb $
X[[X^]fPbcT_XRZTab¯
^bc[hf^T]¯fW^
R^[[TRcP]Sb^ac^eTa%
c^]]Tb^U_[PbcXRTeTahSPh
cWPcf^d[S^cWTafXbT
_^[[dcTaXeTabP]S^RTP]b
C^VXeTQPRZc^cWXb
R^d]Xch^UVaTT]
RadbPSTabCWT1^ShBW^_[Pd]RWTS?a^YTRc=0A8=dcaXcX^]k0QX[XchkATcaPX]X]Vk
8]R[dbX^]X]Pbb^RXPcX^]fXcW?[PbcXRbU^a2WP]VT8]SXP5^d]SPcX^]X]Rc^QTa!!FXcW
cWTPQXcX^]^UaPXbX]Vd_c^C$X[[X^]cX[[PaRW!! cWT_a^YTRcQT]TUXcbUTP[T
fPbcT_XRZTabX]:Pa]PcPZPfXcW??4ZXcbSXaTRcUX]P]RXP[bd__^acSPX[hTP[b]dcaXcX^]
bd__[TT]cbWTP[cWRPaTPfPaT]TbbP]ScaPX]X]Vc^fPaSbQTR^X]V_[PbcXR`dP[Xch
T]VX]TTab4eTah_daRWPbTfXcWCWT1^ShBW^_X]R[dSX]VcWT]Tf2WaXbcPbR^[[TRcX^]
fX[[WT[_bd__^accWTbPUTchP]SbTRdaXchU^aUTP[TfPbcT_XRZTabfW^PaT^bcPUUTRcTSQh
cWTRaXbXb^U2^eXS (B^V^P]SVaPQh^daUPe^daXcT_a^SdRc
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS
VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
3ULQWHGDQGSXEOLVKHGE$PLWDEK6KXNODIRUDQGRQEHKDOIRI0.3ULQWHFK/WG3XEOLVKHGDW%HDXWH(VSDFH3XEOLFDWLRQV3ULYDWH/LPLWHG62VW)ORRU'DNVKLQ0DUJ6HFWRUKDQGLJDUK7HO1RDQG3ULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R3KDVH,,,QGXVWULDO$UHD3DQFKNXOD+DUDQD(GLWRUKDQGDQ
0LWUD6HQLRU5HVLGHQW(GLWRU$PLWDEK6KXNOD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ%DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQHRPPXQLFDWLRQ2IILFH)
6HFWRU12,'$*DXWDP%XGK1DJDU833KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7)
Recommended
More Related Content
What's hot
What's hot (20)
Similar to Pioneer Dehradun-english-edition-2021-01-24
Similar to Pioneer Dehradun-english-edition-2021-01-24 (20)
More from DunEditorial
More from DunEditorial (20)
Recently uploaded
Recently uploaded (16)
Pioneer Dehradun-english-edition-2021-01-24
- 1. B0D60AB4=6D?C0Q :;:0C0 With Bengal elections round the corner Prime Minister Narendra Modi on Saturday made a successful use of a Government pro- gramme organised to celebrate the 125th anniversary of Netaji Subhas Chandra Bose even as he linked India’s soaring mili- tary prowess and Atma Nirbhar to Netaji’s Azaadi dreams. Referring to “one of the greatest sons of the country” as the “first Prime Minister of undivided India” Modi said Bose would have been hugely pleased with the current day’s self reliance drive made by his Government. “Steady eradica- tion of poverty, hunger, illiter- acy, adoption of scientific tech- niques and strong borders was the crux of Netaji’s concept of Azaadi (freedom),” Modi said. The greatest of freedom movement would have been “highly pleased to see how Indian strength was flourishing from LAC to LoC and how it posses and manufactures state of the art aircraft like Rafale and Tejas,” said Modi, adding Atma Nirbhar (self reliance) drive made by his Government was what Netaji wanted. “The way we handled the biggest pandemic of the centu- ry and the way we are manu- facturing and exporting vac- cines to other countries too would have Netaji proud,” he said adding how his Government was pursuing the policies that was once envi- sioned by Netaji. “Today we have a national education pol- icy in place and are coming up with IITs, IIMs and other such institutions and legislations to take India from strength to strength… would not Netaji be proud of the developments that we are making today… he cer- tainly would have,” Modi said. “Today India is retaliating in equal measures whenever its sovereignty is being challenged on the borders,” said Modi adding how the concept of “Sonar Bangla” (golden Bengal) — a political coinage of the BJP taken out of Tagore’s works — was inspired by Netaji. “The concept of Sonar Bangla fits with Netaji’s vision of India and Bengal and it is in this regard that the policy of self reliance should be applied both in the State and the entire country,” Modi said. In what local analysts said a clever ploy to use Netaji ahead of the elections, Modi said “though every drop of our blood is indebted to Netaji and though we cannot pay back his debt a time has come to remember his contributions to Indian freedom struggle through various programmes”. One such initiative the Prime Minister said was the renaming of Howrah Kalka Mail as Netaji Subhas Express. Modi’s “finely decorated and well-packaged” statements was aimed at not only the Congress which is often regarded as the mastermind behind the disregard and aban- donment Netaji suffered in the pages of history but also sup- port the BJP’s cause in election bound Bengal, experts said. “On the 125th birth anniversary of the leader, I bow to him on behalf of the grate- ful nation. Today, I also salute this virtuous land of Bengal, which made the child Subhash Netaji,” Modi said. Addressing the Prakram Diwas celebrations in the city, Modi said, “On this day, that brave son was born in the lap of Mother Bharati, who gave a new direction to the dream of independent India.” “On this very day, there was that consciousness in the darkness of slavery, who stood in front of the biggest power of the world and said, I will not ask you for freedom, I will take it away,” Modi said in his trib- ute to Bose. Earlier in the day, Modi paid floral tributes at Netaji Bose’s statue at the National Library in the city. Modi went around seeing paintings by around 100 artists on a 40-metre long canvas on the sprawling lawns of Belvedere House at the National Library compound. He was accompanied by West Bengal Governor Jagdeep Dhankhar. “His bravery and ideals inspire every Indian. His contribution to India is indeli- ble. India bows to the great Netaji Subhas Chandra Bose. PM@narendramodi began his Kolkata visit and #ParakramDivas programmes by paying homage to Netaji Bose at Netaji Bhawan,” Prime Minister’s Office said in a tweet after PM Modi reached Kolkata. BC055A4?AC4AQ =4F34;78 The Delhi Police on Saturday gave permission to protest- ing farmers’ unions to hold their tractor rally on January 26 in the city. Meanwhile, Anil Mittal, the Additional Public Relations Officer (APRO) of Delhi Police, claimed that the policeandfarmers’unionsarein final stage of talks for the routes regarding tractor rally. After attending the meeting with Delhi Police, its counter- parts Haryana and Uttar Pradesh Police, farmers’ union memberAbhimanyuKoharsaid the tractor parades will start from Ghazipur, Singhu and Tikri border points of Delhi, but details will be finalised on Saturday night. Kohar claimed that the Delhi Police has given its nod to the farmers’ tractor parade on Republic Day in the national Capital. Another farmer leader Gurnam Singh Chaduni said as thousands of farmers will par- ticipate in the parade, there will be no single route. Farmer leader Darshan Pal said barri- cades set up at Delhi border points will be removed on January 26 and farmers will take out tractor rallies after entering the national Capital. Thousands of farmers, mostly from Punjab and Haryana, have been protesting at several Delhi bor- der points against the Centre’s new agriculture laws for near- ly two months. The unions representing the farmers have begun holding tractor rallies at villages in Punjab to mobilise people for the demonstration on Republic Day. The farmers are vehement- ly opposing the Farmers (EmpowermentandProtection) Agreement of Price Assurance andFarmServicesAct,2020;the Farmers Produce Trade and Commerce (Promotion and Facilitation) Act, 2020; and the Essential Commodities (Amendment) Act 2020. Enacted in September last year, the three laws have been projected bythe Centreasmajor reforms in the agriculture sector thatwillremovemiddlemenand allow farmers to sell their pro- duce anywhere in the country. 78C:0=370A8Q90D Jawans of the Border Security Force (BSF) on Saturday detected another 150-metre long and 30-feet deep cross- border tunnel, fourth in the last six months, in the Pansar area of Kathua district. The tunnel was detected between border pillar number 14 and 15. A similar tunnel was detected barely 10 days ago in the Bobiya area of Samba sec- tor on January 13. Ground reports suggested the starting point of the tunnel was located closer to two Pakistani border outposts Abhiyal Dogra and Kingre- de-Kothe located in Shakargarh area. On the Indian side, the local BSF commanders passed necessary instructions to their foot soldiers to remain in a state of high alert in the run up to the Republic Day celebrations as Pakistani rangers may try to push heavily armed infiltrators inside the Indian territory to launch terror attacks on vital security installations. Till the time of filing the report the BSF authorities were trying to ascertain whether the same tunnel was recently put to use by the Pakistan- based handlers to push a group of terrorists inside the Indian territory. After supervising the tunnel on ground zero, Inspector General of BSF, Jammu Frontier NS Jamwal told reporters, “The tunnel was detected by the BSF troops during an ongoing anti tun- neling drive launched in the area on Saturday”. He said after receiving intelligence inputs about the presence of another tunnel an extensive drive was carried out in the forward area which resulted in detection of this tunnel. Briefing media persons, IG BSF also claimed the tunnel was designed on the same pattern as all previous tunnels. “Without the active con- nivance of Pakistani establish- ment and their consent it is not possible to come closer to the zero line,” he said. ?=BQ =4F34;78 India and China will hold the ninth round of military level talks on Sunday to find ways to defuse stand-offs now on for the last nine months at the Line of Actual Control (LAC) in Ladakh. The latest talks take place after a gap of nearly two months and chances of a major break- through are unlikely. The logjam is persisting as China wants India to first with- draw its troops from the heights of southern and northern banks of the Pangong Tas (lake). In August, the Indian Army secured these hilltops over- looking all the crucial Chinese deployments thereby putting them at a disadvantage. Both the sides have so far not managed to reach a mutu- ally agreed plan for disengagement and de-escalation. ?=BQ A0=278 Rashtriya Janata Dal (RJD) leader Lalu Prasad — con- victed in fodder scam cases — on Saturday was shifted to AIIMS, Delhi after his health condition deteriorated while undergoing treatment at a hospital at the Rajendra Institute of Medical Science (RIMS) in Ranchi for multi- ple ailments. Earlier, the Inspector General of the jail said Lalu will be flown to Delhi and should be back in Ranchi within a month, said . “Lalu is having trouble breathing for the last two days. On Friday, he was found to be having pneumonia. Considering his age, we have decided to shift him to AIIMS- Delhi on the advice of doctors for better treatment,” RIMS Director Dr Kameshwar Prasad told news agency PTI. ?=BQ =4F34;78 In the past eight days since the launch of the mega anti- Covid-19 drive on January 16, 15.37 lakh persons have been vaccinated till Saturday. Six have died after taking the shots, but the Government has main- tained that their demise has no link with the vaccination. Around 500 cases of AEFI have been reported. Health experts have, however, urged the Union Health Ministry and ICMR to investigate these deaths even if these were not directly linked to the vaccine against the coronavirus. 0n Saturday, a 56-year-old woman who was a resident of Gurugram, succumbed. After taking the jab. “The post-mortem con- firms that cardio-pulmonary disease was the reason for her death and it was not related to vaccination. None of these deaths have been causally linked with Covid-19 vaccina- tion,” said an official from the Union Health Ministry here on Saturday. “Is anybody investigating deaths after vaccination so as to come out with do’s and don’ts about vaccination. This is the science we need to contribute to it so that future can be safe- guarded,” said Dr Rahul Bhargava, Director-Bone Marrow Transplant Programme, Fortis Memorial Research Institute, Gurugram. Another health expert from the Government hospital said most of these beneficia- ries are said to have died because of the heart-related problems. ?C8Q F0B78=6C= The United States Senate would begin the impeach- ment trial of former President Donald Trump on February 8, Senate Majority Leader Chuck Schumer said. “The January 6th insurrec- tion at the Capitol, incited by Donald J Trump was a day none of us will ever forget. We all want to put this awful chapter in our nation’s history behind us. But healing and unity will only come if there is truth and accountability. And that is what this trial will provide,” Schumer said on the senate floor. BoththeRepublicanandthe Democratic Party now have 50 seats each in the 100 member Senate. Schumer said the house managers will come to read the articleofimpeachmentat7pmon Monday. B0D60AB4=6D?C0Q :;:0C0 Irked by Jai Shri Ram slogans raised by a section of the audience, Bengal Chief Minister Mamata Banerjee on Saturday walked off the podium refusing to deliver a speech at an event — attend- ed by Prime Minister Narendra Modi — to celebrate the 125th anniver- sary of Netaji Subhas Chandra Bose. The Central Government programme was organised at the iconic Victoria Memorial. Alleged saffron supporters raised the slogans moments before Mamata was to deliv- er her speech. Walking up to the podi- um the Chief Minister said, “I am grateful to the Central Government and Prime Minister Narendra Modi for organising this programme in Kolkata and calling me to be a part of the celebra- tions… but it must be remembered that this is not a political but a Government programme and its dignity must be preserved… “I must also remind that no one has the right to insult someone after inviting that person… so on protest, I desist from delivering a speech.” Then she walked off in a huff leaving back a befuddled silence. :_UZRSVT`^Z_XhYRe?VeR[ZV_gZdZ`_VU+`UZ 30VDV%RVHZRXOGKDYHEHHQKXJHOSOHDVHGZLWKHQWUH¶V$WPD1LUEKDUGULYH ?TTeTSQh9PXBWaXAP b[^VP]b3XSXfP[Zb^UU bcPVTfXcW^dcb_TTRW 2_`eYVcARef__V]W`f_U R]`_XS`cUVc%eYZ_'^eYd 'HOKL3ROLFH2.¶VIDUPHUV¶ WUDFWRUSDUDGHRQ5'D ZdR_f_Z`_dT`ad RXcVV`_c`feVdW`c ^RcTYWc`^DZ_XYf 8YRkZafcEZcZ :_UZR4YZ_R¶d *eYc`f_U`W=24 aRc]Vjde`URj e`V_UWRTV`WW =R]fdYZWeVU e`5V]YZ2::D RWeVcYZdYVR]eY UVeVcZ`cReVd FDDV_ReVe` deRceEcf^a Z^aVRTY^V_e `_7VScfRcj) 8`gedRjd'UVReYd RWeVc[RSYRgV_` ]Z_hZeYdY`ed ViaVcedRd:4C e`ac`SVTRfdV /JHWRYLGMDEVLQGDV ?aXTX]XbcTa=PaT]SaP^SXfXcWFTbc1T]VP[2WXTUX]XbcTaPPcP1P]TaYTTaT[TPbTbPQ^^ZSdaX]V !$cWQXacWP]]XeTabPah^U=TcPYXBdQPbW2WP]SaP1^bTPc EXRc^aXPT^aXP[X]:^[ZPcP^]BPcdaSPh ?C8 5PaTabPaRWc^fPaSb3T[WXc^Y^X]cWTXaPVXcPcX^]PVPX]bccWT2T]caTbUPaaTU^a [PfbX]0aXcbPa^]BPcdaSPh ?C8 0TSXRPSX]XbcTabcWTUXabcS^bT^U2^eXbWXT[SePRRX]T^]Ua^]c[X]Tf^aZTa?PfP] BPaPbfPcPcPRXchSXb_T]bPahX]1XZP]Ta^]BPcdaSPh ?C8 $B70=C84B6DCC438= 58A48=40BC34;78 =Tf3T[WX) eTa$bWP]cXTb fTaTVdccTSX]PPbbXeTUXaT cWPcQa^ZT^dcX]TPbc3T[WX³b 6WPiX_da3PXah5PaPaTP^] BPcdaSPh^UUXRXP[bbPXS5XaT ^UUXRXP[baTRTXeTSX]U^aPcX^] PQ^dccWTQ[PiTPc # _ U^[[^fX]VfWXRW UXaTcT]STab fTaTadbWTSc^cWTb_^c 64=A4C30DBC8=DB 58ABC1;02:345B42H FPbWX]Vc^]) CWTD]XcTSBcPcT BT]PcTWPbR^]UXaTScWT ]^X]PcX^]^U6T]TaP[aTcXaTS ;[^hS0dbcX]c^bTaeTPb bTRaTcPah^UcWTSTUT]RT ST_PacT]cPZX]VWXcWT UXabcTeTa0UaXRP]0TaXRP]c^ ^RRd_hcWTc^_?T]cPV^] _^bXcX^] 6ECC40274A384B5 2E838=;D3780=0 ;dSWXP]P)0 #'hTPa^[S 6^eTa]T]c bRW^^[cTPRWTa fW^WPScTbcTS _^bXcXeTU^a2^eXS (SXTSPcP _aXePcTW^b_XcP[WTaT^] BPcdaSPhU^[[^fX]VfWXRWWTa !R^[[TPVdTbP]ScWaTT bcdST]cbP[b^aTcda]TS_^bXcXeT aTbd[cbP]^UUXRXP[bPXS 20?BD;4 Chandigarh: Haryana police was on Saturday questioning a man after agitating farmer leaders alleged that he was involved in a conspiracy to kill four of them and create dis- turbance during their pro- posed tractor parade in Delhi on January 26. The man was allegedly nabbedattheSinghuborderby the protesting farmer leaders who paraded him before reporters on Friday night and later handed him over to the police. His face covered with a scarf, the man claimed that a plan was hatched to shoot four farmer leaders, who are known faces in the media, on the stage on Saturday. “On January 26, there was a plan to create disturbance during the tractor parade by opening fire on Delhi Police personnel, which would promptthemtoretaliateagainst the protesting farmers in a strong manner,” he claimed. A policeofficialsaidtheman,stat- edtobearound21yearsofage, wasbeingquizzedinSonipatby the Crime Branch of the state police.Themanhasbeenresid- ing in Sonipat and has no pre- vious criminal record. “He was not carrying any arms or ammunition.We arequestion- ing him, but nothing has so far been found that points to any kind of conspiracy, as is being alleged,” the official said earli- er in the day, adding that fur- ther investigations are under- way. When asked about the matter, Chief Minister ML Khattar said the police will give an official statement after com- pleting the questioning. “Currently, the police is questioning him. Till the time this is going on, to say anything will not be appropriate,” he told reporters on Saturday on the sidelines of an event, At the Singhu border press conference late on Friday night, the farmer leaders pre- sented the man who claimed that his accomplices were askedtoposeaspolicemenand baton-charge the crowd during the proposed tractor parade in the national capital on Republic Day. The farmer leaders claimed that they caught the man from the protest site at the Singhu border. He was subsequently handed over to the Haryana police. Farmer leader Kulwant Singh Sandhu alleged that attempts are being made to disrupt the ongoing agitation against three farm laws. Thousands of farmers, mostly from Punjab, Haryana and western Uttar Pradesh, have been camping at several border points of Delhi since November 28 last year, demanding a repeal of the three farm laws and a legal guarantee to the minimum support price for their crops. 7PahP]P?^[XRT`dTbcX^]bP]PUcTa _a^cTbcX]VUPaTa[TPSTabP[[TVTR^]b_XaPRh c^ZX[[#^UcWTSXbad_ccaPRc^a_PaPST ?dQ[XbWTS5a^ 34;78;D2:=F 17?0; 17D10=4BF0A A0=278 A08?DA270=3860A7 347A03D=7H34A0103 E890HF030 ;PcT2Xch E^[ $8bbdT ! 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T 4bcPQ[XbWTS '%# 51,5HJQ1R+$(1* fffSPX[h_X^]TTaR^ DA@CE) ?BA42E4A 05C4A40A;H9;CB H@C=5' ?AC4BCB02ABBADBB80 340=3=0E0;=H³BA4;40B4 @?6J( ?4CA;384B4;?A824B CD270;;C847867B 347A03D=BD=30H 90=D0AH!#!! *?064B'#C /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ X]bcPVaPR^SPX[h_X^]TTa
- 2. 347A03D=kBD=30H k90=D0AH !#!! UX[bce! 9@6E962EC6 E96H9:E6E:86C ?VeW]Zi Z_X+2URcdY8`fcRgAcZjR_R4Y`acR CR[f^^RcCR`RYVdYR_[cVRc CReVU+' ! T here is something about a subject on class friction that is intriguing and fascinating especially for those who are far removed from the actual reality. The White Tiger based on Aravind Adiga’s book by the same name is a movie that makes for a must watch for several reasons. First, Ramin Bahrani, the director, takes us on a journey that is filled with a satirical commentary on the class divide that exits even today and the constant struggle between the upper class and lower. With the upper class wanting to dominate the other by keeping them under their thumb by forcing them to remain in poverty. Second, the portrayal of this scenario is extremely realistic. People who have been under the thumb of zamindars, and they still continue to be so, don’t have a choice. The entire village is a slave to one master and strangely despite the subjugation, they continue to serve the master as feel it is an honour to be serving him so closely. Third, despite the film starting of on a dark note and continues to be on a dark note till the very end, the story resonates with everyone— even those outside of India. The struggle by a poor man wanting to make it big in life is what almost all of us aspire. Four, and the most important is the absolutely brilliant and awesome performance by Adarsh Gourav. This actor-singer as Balram Halwai, a slave to his master, who dreams of becoming something in life plays the part to a T. From a driver to the owner of a company, each part of his journey has been done to perfection. His fascination with things that he sees for the first time, is so natural. It is difficult to imagine anyone playing this role but Gourav. Watching him go from an unassuming personality as a driver to a entrepreneur who is comfortable in his skin is amazing to watch. Definitely, Gourav is the white tiger here who roars brilliantly. °BWP[X]XBPZbT]P $GDUVK*RXUDYURDUV I t is rare that one gets to see stories with deep meaning that immediately catches one’s attention, on TV. A case in point is SET’s Kyun Utthe Dil Chod Aaye. Set in 1947, Lahore, pre-partition India, the show narrates the story of three young girls — Amrit, Vashma and Radha. This story brings forth their dreams, hope, aspirations and new found love — all this at the brink of Independence. Knowing that tomorrow will be different, the three girls will set out to conquer love and will stand the test of time across borders. Gracy Bitin Goswami, who plays Amrit tells you that it is the simplicity of the character that attracted her to play Amrit. “It’s a pre-partition era story about a girl who loves her family so much. She has many dreams, but is ready to sacrifice them for the sake of her family. This is why she decides to publish her poems with another identity so that her father, who is not a fan of such pieces, doesn’t get hurt by her actions. She goes through different stories and has many emotions. She is the reason behind everybody’s smile. She is the most beautiful girl of Lahore, not only because of her appearance, but because how she is as a person. This was the reason I was attracted to play Amrit. Also, she is so poised and has the ability to deal with any situation. I have been wanting to play such a character. This is the first time I am not playing a teenager, whereas in my real life I am, so I will be seen emoting romance scenes. This is a big deal and break for me. So, there was no reason to turn down the project,” she tells you. It was hard, she says, to get into the skin of the character. “The character is living in 1947. She is shy and lives with a lot of restrictions and today we are in 2021, so confident of whatever we do and having the ability to speak up for ourselves. So, I had to take care of that and be poised. Also, it was difficult to bring in that body language and the punjabi accent,” she tells you. It took Goswami a lot of research and hard work to get into the skin of such a different character than hers. “I had to watch a lot of 1970’s films and shows and see how the actors carried themselves and how they dealt with situations. I listened to the kind of songs we had back then. I read a lot of thick Sanskrit, Urdu and Punjabi. I took tuitions to get the diction right. I had to do a lot of research to be able to play Amrit,” she explains. Goswami is not the only jewel of the show, there is Diya Aur Baati Hum’s fame Kanika Maheshwari too, in a negative role. She is back on TV after three years and is excited to play the role. “I play Mogar, a widow. She is very harmful and a dangerous lady. She aims to create unhappiness in the family and is never happy with anything in life. She thinks that it was because of her brothers that she ended up as a widow. She blames them for marrying her off at a young age in a small house. She has this bitterness and hence, wants to see others unhappy too,” Maheshwari tells you. She tells you that she had no apprehensions before taking up the role. “This is a tailor- made role for me. I have been waiting to play such a role for a long time. There is so much to do in this show. Playing an antagonist gives you a lot of space to enhance your acting skills. I am learning every day and getting better at my craft,” Maheshwari, who will be sporting no makeup, tells you. One thing that Maheshwari likes about role is that though the character has no colours (dressed up in white clothes), it is yet so colourful. “The thing that I disliked is that I am not getting to put any makeup. As an actor, I like to do makeup, but the role demands me to look simple,” she says. Just like Goswami, Maheshwari too had to get her punjabi accent right. As appealing and unique the trailer of the show looks, the audience can hope they are in for an entertainment ride with this new offering with so many good actors. 6A02H18C8=6BF08P]S:0=8:0074B7F0A8cT[[DB10 70B78fWPcB4C³b:hd]DccWT3X[2W^S0PhTP[[bTcc^V^^]PXa Ua^^]SPhXbPQ^dccWTXaa^[TbP]SW^fRWP[[T]VX]VXcXbc^QT P_Pac^U_TaX^SSaPP ³8?;F0BF0983´B3A40´ ITTCEWPbQTT]PUa^]cad]]TaX] aTe^[dcX^]XbX]VcT[TeXbX^]R^]cT]c^eTacWT _PbccWaTTSTRPSTbP]SXcXbP[[bTcc^ RWP]VTcWTUPRT^UdbXRaTP[XchbW^fb ^]RTPVPX]fXcWXcb[PcTbc]^]UXRcX^] _a^_TachcWT8]SXP]?a^dbXR;TPVdT 8?;8]fWPcfX[[QTPR[dccTaQaTPZX]V U^aPcX]]^ePcX^]ITTCEXbP[[bTcc^ _aTbT]cPdSXT]RTbfXcWcWTf^a[SbUXabc TeTadbXR[TPVdTX]TPa[h!! FWX[TcWT f^a[S^Ub_^acbWPbbTT]bTeTaP[[TPVdT R^_TcXcX^]bcWXbd]X`dTdbXR[TPVdTfX[[ WPeTbXgcTPbaT_aTbT]cX]VSXUUTaT]c aTVX^]b^U8]SXPQPcc[X]VXc^dcPVPX]bcTPRW ^cWTaX]PdbXRP[RWP_X^]bWX_4PRW^U cWTbTbXgcTPbbd__^acTSQh[TPSX]V 1^[[hf^^SP]Sb_^acbRT[TQaXcXTbfX[[WPeT c^__[PhQPRZbX]VTabPbcWTXaRP_cPX]b^]T aTP[XchbW^fbcPaP]S^]TUaTbWe^XRTCWT [XZTb^UXZPBX]VW:PX[PbW:WTaBPYXS :WP]BWPP]0]ZXcCXfPaX9PeTS0[X0bTTb :Pda1W^^XCaXeTSX0ZaXcX:PZPa?PhP[ 3Te=TWP1WPbX]BWX[_PAP^WPeTQTT] bXV]TS^]c^RP_cPX]cWTbXgi^]P[cTPb 5^abdRWPP^cWdbXRaTP[Xch bW^fcWTRWP]]T[aTRT]c[h[Pd]RWTSP eXQaP]cP]cWTcWPcbW^fRPbTSTPRW^UXcb !cTPRP_cPX]bR^X]Vc^VTcWTaU^acWT eTahUXabccXT2^_^bTSQhBPYXSFPYXS cWXbdbXRP[PbcTa_XTRTXbP^]VbccWT [PbcUTfR^_^bXcX^]b^UcWTSd^QTU^aT FPYXS:WP]bcaPVXRSTXbT8]UPRcFPYXS fPb^]T^UcWTUXabc_T^_[T^]Q^PaSU^acWT bW^fP]S8]SXP]?a^dbXR;TPVdTfPb WXbSaTPPb_TaBPYXS:WP]7TfPbb^ _PbbX^]PcTPQ^dcXccWPccWT[PcTdbXRXP] f^aZTS^]XcTeTabX]RTcWTXSTPfPbQ^a] 0UcTaFPYXS_PbbX]VPfPhBPYXSXbUd[UX[[X]V P]S[XeX]VWXbQa^cWTabSaTP 0bcWTRP_cPX]^U3T[WX3WdaaP]SWPab P]ScWTR^_^bTa^UcWT8]SXP]?a^dbXR ;TPVdTP]cWTBPYXS:WP]aTeTP[TS)°8 WPeTQTT]Pbb^RXPcTSfXcWcWXbbW^fbX]RT XcbbcPacX]UPRccWT^f]TabP]SFPYXSWPS SaTPcPQ^dccWXbbW^fc^VTcWTaP]ScWTh fTaTP[[f^aZX]Vc^fPaSbXc7TWPSc^[S TcWPc8]TTSTSc^QTP_Pac^UcWTbW^f P]SWT]RT8RPT^]Q^PaSU^aXcB^cWT 8]SXP]?a^dbXR;TPVdTfPbFPYXSb SaTPP]SWTaT8P_dccX]Vh$_Ta RT]cX]c^Xc± C8=0B0?;0=BCCA0??827:D 0UcTa1WPhaP]XCX]PbP³b?PeXcaP ?d]XPR^TQPRZX]B^]hB01³b1PP[eTTa ATcda]bWPe^RWPbaTSTUX]TSXcbT[UCWT d_R^X]VT_Xb^STbfX[[fXc]TbbCX]PbP VTccX]VTeT]UXTaRTacWP]QTU^aT0UcTa _^Xb^]X]V1PP[eTTa3Te9^bWXfXcWP b_XSTaP]S[TPeX]VWX_PaP[hiTSbWTWPb bTcWTaThTb^]b^T^]TfW^RP]QTcWT d[cXPcTRPcP[hbcU^aSTbcadRcX^] FXcWWTa]Tf[hPR`dXaTS_^fTab CX]PbPRaTPcTbPPVXRP[b_XSTafWXRW bTRaTc[hQXcTb1PP[eTTa[TPeX]VWX_Pac[h _PaP[hiTSD]PQ[Tc^WTP[1PP[eTTacWT UPXaXTbP]SBWPdahPSTRXSTc^VTcPQPQh VW^bc¯?XRWZd^dcWXbQ^gfW^TPbX[h WTP[b1PP[eTTa?XRWZdPXbRWXTe^dbQdc P]XT]bT[h_^fTaUd[QPQhVW^bcWPb QTT]aTbXSX]VX]ETTa;^ZfWTaTWT R^d[S]³cQTP]X_d[PcTSP]SXbdbTSQh P]hTeX[ FWX[T?XRWZdWTP[b1PP[eTTaCX]PbP cWa^dVWPPVXRP[_^acP[fXc]TbbTbcWT T]cXaTPRcP]SSTRXSTbc^VTcWTaWP]Sb^] ?XRWZdfW^RP]PXSWTac^RaTPcTcWT d[cXPcTWPe^R^]TPacW]cWT^cWTaWP]S PbEXePP]EP]bWBPhP]XV^TbQPRZ^] TPacWUa^ETTa;^Z?XRWZdbTRaTc[h aTPRWTbEXePP]³bW^dbT^]TPacW?XRWZd aTeTP[bcWPcWTWPb]^cQTT]PQ[Tc^V^ QPRZc^WXb_[P]TcP]Sc^aTcda]WTXb aT`dXaTSc^S^^]TV^^SSTTS FX[[?XRWZdQTPQ[Tc^_TaU^aPV^^S STTSQTU^aTCX]PbPRP_cdaTbWX.7^f fX[[EXePP]WT[_?XRWZdaTPRWWXbW^T. EP]bWBPhP]XTbbPhX]VcWTa^[T^U EXePP]bPXS°FWT]8[TPa]cPQ^dccWXbQPQh VW^bcbc^ahXcfPbcWaX[[TSP]S8PbdaT TeTah^]TfX[[[^eTXbRWXTe^dbP]SRdcT ?XRWZdCWTd_R^X]VT_Xb^STfX[[fXc]Tbb CX]PbP³bSTPS[hcaP_U^a?XRWZdP]SXcfX[[ QTd_^]Q^cWcWT1PP[eTTabc^T]bdaT ?XRWZdPRR^_[XbWTbWXbV^^ScPbZX] ^aSTac^aTPRWWXb_[P]TcQdcXcfX[[]^cQT cWPcTPbhFXcWCX]PbP³baTcda]cWT RWP[[T]VTbPWTPS^UEXePP]P]S3TQdPaT SP]VTa^dbP]SXcfX[[QTTgRXcX]Vc^fPcRW W^fEXePP]WT[_b?XRWZd]cWT^cWTa WP]SXcWPbQTT]TgRXcX]Vc^WPeT?PeXcaPSX QPRZ^]cWTbTcbP]SbW^^cX]VfXcWWTa PVPX]fPbPf^]STaUd[Tg_TaXT]RT± C 4 ; ; H C 0 ; 4 A]R_J`fc5Rj 7TaXcPVT^U8]SXP4gWXQXcX^] ET]dT)6^^S4PacW2Xch2T]caTP[[BTRc^a$6dadVaP7PahP]P FWT])CX[[9P]dPah!%!! CXT) !]^^]c^'_ 4 gcT]SX]VcWTW^[XSPhbbTPb^] 6^^S4PacW2Xch2T]caTP[[ _aTbT]cbPaTYdeT]PcX]V8]SXP] 0acXbP]b³4gWXQXcX^]Rd UTbcXeP[RdaPcTSQh]TF^a[S 5^d]SPcX^]¯P]=6fXcWcWT ^QYTRcXeTc^_a^^cTPacXbP]b TgcT]SX]VcWTaXVWc_[PcU^ac^ bW^fRPbTcWTXaPacRaPUcCWT TeT]c]PTS²7TaXcPVT^U8]SXP³ XbbTcc^caTPch^dcX[[9P]dPah !%!! CWTTgcaPePVP]iPfX[[ R^_aXbTP[[cWTZThPacXbP]b Ua^SXUUTaT]caTVX^]bUa^P[[ ^eTa8]SXP0[^bc#PacXbP]b³ RPcTV^aXTbX]R[dSX]VcWT PSWdQP]X?PX]cX]VbUa^1XWPa?^ccTahUa^:WdaYPCPX[=PSd³bFPPVPXF^^S1aPbb 0acf^aZUa^3T[WXP]SP]h^aTPaTV^X]Vc^cPZTcWTb_^c[XVWc^eTaPU^ac]XVWc^][h Pc6^^S4PacW2Xch2T]caTP[[ 6WRURIRXQJGUHDPV FP[[^U7^_T C WXbhTPaCWT1^ShBW^_XbdaVX]VTPRW^]T^Uh^dc^R^Tc^VTcWTaP]SPRc^]^da R^[[TRcXeT_^fTac^RPaTP]ScaP]bU^acWTf^a[SX]c^PUPXaTaP]S^aTQTPdcXUd[f^a[S C^PZTcWT2WaXbcPbPVXRaTP[U^aTeTahQTPdcXUd[Q^ShCWT1^ShBW^_d]eTX[TSXcb 2WaXbcPbFP[[^U7^_TX]R^[[PQ^aPcX^]fXcW3T[WXBcaTTc0acbW^fRPbTSPcBT[TRc 2XchfP[ZX]BPZTc=Tf 3T[WX CWT1^ShBW^_ R^]cX]dTbc^bWX]TP[XVWc ^]8]SXP³bUTP[T fPbcT_XRZTabfW^PaT aPaT[hPRZ]^f[TSVTSPb Ua^]c[X]TfPaaX^abX]cWT 2^eXSRaXbXb8]SXPWPb $ X[[X^]fPbcT_XRZTab¯ ^bc[hf^T]¯fW^ R^[[TRcP]Sb^ac^eTa% c^]]Tb^U_[PbcXRTeTahSPh cWPcf^d[S^cWTafXbT _^[[dcTaXeTabP]S^RTP]b C^VXeTQPRZc^cWXb R^d]Xch^UVaTT] RadbPSTabCWT1^ShBW^_[Pd]RWTS?a^YTRc=0A8=dcaXcX^]k0QX[XchkATcaPX]X]Vk 8]R[dbX^]X]Pbb^RXPcX^]fXcW?[PbcXRbU^a2WP]VT8]SXP5^d]SPcX^]X]Rc^QTa!!FXcW cWTPQXcX^]^UaPXbX]Vd_c^C$X[[X^]cX[[PaRW!! cWT_a^YTRcQT]TUXcbUTP[T fPbcT_XRZTabX]:Pa]PcPZPfXcW??4ZXcbSXaTRcUX]P]RXP[bd__^acSPX[hTP[b]dcaXcX^] bd__[TT]cbWTP[cWRPaTPfPaT]TbbP]ScaPX]X]Vc^fPaSbQTR^X]V_[PbcXR`dP[Xch T]VX]TTab4eTah_daRWPbTfXcWCWT1^ShBW^_X]R[dSX]VcWT]Tf2WaXbcPbR^[[TRcX^] fX[[WT[_bd__^accWTbPUTchP]SbTRdaXchU^aUTP[TfPbcT_XRZTabfW^PaT^bcPUUTRcTSQh cWTRaXbXb^U2^eXS (B^V^P]SVaPQh^daUPe^daXcT_a^SdRc $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV 3ULQWHGDQGSXEOLVKHGE$PLWDEK6KXNODIRUDQGRQEHKDOIRI0.3ULQWHFK/WG3XEOLVKHGDW%HDXWH(VSDFH3XEOLFDWLRQV3ULYDWH/LPLWHG62VW)ORRU'DNVKLQ0DUJ6HFWRUKDQGLJDUK7HO1RDQG3ULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R3KDVH,,,QGXVWULDO$UHD3DQFKNXOD+DUDQD(GLWRUKDQGDQ 0LWUD6HQLRU5HVLGHQW(GLWRU$PLWDEK6KXNOD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ%DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQHRPPXQLFDWLRQ2IILFH) 6HFWRU12,'$*DXWDP%XGK1DJDU833KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
- 3. 347A03D=kBD=30H k90=D0AH !#!! RP_XcP[ ?=BQ 347A03D= Chief Minister Trivendra Singh Rawat unveiled the foundation stone for a state level Sainya Dham at Purkul village here on Saturday. Speaking on the occasion, he announced that the one time grant provided to widows or dependents of soldiers and paramilitary personnel mar- tyred in border skirmishes or for internal security will be increased from C10 lakh to C15 lakh. The CM also unveiled the foundation stone for the head- quarters of Uttarakhand Purv Sainik Kalyan Nigam Limited (UPNL) on the occasion. Paying his tribute to Subhas Chandra Bose on his 125th birth anniversary, Rawat thanked Prime Minister Narendra Modi for commem- oration of Bose’s birth anniver- sary as Parakram Diwas. The CM said that when the PM had referred to Sainya Dham as the fifth Dham, efforts to build this monu- ment were intensified. “Our attempt is to make it lively and inspiring. Anyone coming here should experience its reality and feel inspired. I want that in the future, the oath taking cer- emony of the Government in Uttarakhand should take place at this Sainya Dham. Those who come to Dehradun from other states or countries should also visit this monument,” said the CM. Rawat further said that if there are any keepsakes of the martyred soldiers in their homes, a museum will be made to preserve these at Sainya Dham. For those inter- ested in joining the army, arrangements will be made for their training here. Stating that citizens can send their sug- gestions for making a grand Sainya Dham in Dehradun to the additional chief secretary, Sainik Welfare, the CM said that an expert committee will check all the suggestions received. The Mussoorie MLA Ganesh Joshi also expressed his views on the occasion. State’s Forest and Wildlife minister Harak Singh Rawat, State Minister for Higher Education, Dhan Singh Rawat, Dehradun mayor Sunil Uniyal ‘Gama’, other public representatives and officials were also present on the occasion. ]TcXTVaP]cU^aST_T]ST]cb^UPachaTS b^[SXTabc^QTaPXbTSc^C $;)2 CRhRef_gVZ]dW`f_UReZ`_de`_V W`cDRZ_jR5YR^Z_Afcf]gZ]]RXV ?=BQ 347A03D= The decision of the State Cabinet to purchase 132 new ambulances would effec- tively double the existing fleet of the emergency 108 ambu- lance service in the State. The 108 service at present has a fleet of 140 ambulances including one boat ambulance in Tehri Lake. The decision to increase the number of ambulances is significant since the present strength of the fleet is based on the population data of the year 2008. The state head of the 108 ambulance service, Anil Sharma told The Pioneer that the decision of the state cabi- net is highly appreciable and it would help the service in serv- ing the people of the state in a much better way. He said that the new ambulances would augment the fleet and the response time of the emergency service would get better. These ambulances would also be very helpful during the upcoming Kumbh in Haridwar. CWTSTRXbX^]c^ X]RaTPbTcWT ]dQTa^U PQd[P]RTbXb bXV]XUXRP]cbX]RT cWT_aTbT]c bcaT]VcW^UcWT U[TTcXbQPbTS^] cWT_^_d[PcX^]SPcP ^UcWThTPa!' =Tf PQd[P]RTbc^ S^dQ[TcWT ' bTaeXRTU[TTc ?=BQ 347A03D= Union Minister Ramesh Pokhriyal ‘Nishank’ has expressed hope that the Phase- I of the construction at the Jollygrant airport in Dehradun will be completed by March end. Chairing the meeting of Airport Advisory Committee at Dehradun Airport, Jollygrant today, Nishank, who is the chairman of Airport Advisory Committee at length discussed the ongoing construction at the airport and its future expansion plans. The Union Minister also suggested that Uttarakhand Civil Aviation Development Authority should explore com- ing up with a scheme of ‘Himalaya Darshan’ with the help of heli service providers and GMVN to attract tourists. Speaking about the UDAN scheme, the Chairman said that it should be leveraged to provide connectivity to hilly and remote areas of the State. Outlining the need to increase revenue through tourism, the Chairman said that a state of the art airport would provide livelihood to the people of the State. However he added that the sentiments and priorities of the local popula- tion around the airport must be kept in mind while the pro- posed expansion of the airport gets underway. The chairman said that land acquisition for the airport must also take into account the impact on ecology. The Minister said that the carbon footprint of the airport must be minimised and appre- ciated that the airport had banned single use plastic. He stressed the need for better connectivity of the airport from Dehradun City, Rishikesh and Haridwar. The Minister also mooted the idea of mak- ing Doiwala Railway Station as the primary connection of the airport. =XbWP]ZW^_TbU^aR^_[TcX^]^U3TWaPSd] PXa_^ac´b_WPbT R^]bcadRcX^]QhPaRWT]S ?=BQ 347A03D= Chief Minister Trivendra Singh Rawat granted financial approvals along with his approval for release of funds to start work in the cur- rent financial year for various public interest works and announcements related to the Urban Development, Medical Health, Home and other departments. The CM had announced setting up of the Ranikhet municipality office building at Chiliyanaula. For this, the CM granted approval for C98.96 lakh out of C1.98 crore in the current financial year. Rawat also granted approval with relaxation in regulations to accord Nagar Panchayat status to Nagla Gram Panchayat in Udham Singh Nagar district. The Urban Development department will now take necessary action as per the rules to grant urban local body status to Nagla. The CM C28.27 lakh financial approval and permitted release of 40 per cent of the amount for construction of Ambedkar Park near Yuva Bhawan in Lohaghat Nagar Panchayat, as per his announcement. He also grant- ed approval for C55.8 lakh- 5er cent of C1.12 crore for con- struction of Ukhimath Nagar Panchayat office building and issued instructions to release the amount in the current financial year. Further, as per the CM’s announcement, in the Rudraprayag Vidhan Sabha constituency, road construc- tion will be undertaken from Kamoldi Molkakhal motor road to Pipli playground. For this task, Rawat has granted financial approval of C75.98 lakh in the current financial year. Under the Medical Health department, the CM has approved cancelling the dis- ciplinary action underway against the then chief medical officer of Udham Singh Nagar Dr Hemant Kumar Joshi who is now retired. For mainte- nance works in various hos- pitals and CMO office, Dr Joshi was accused of violating the rules by splitting the bud- get into portions of less than C10 lakh. However, with the inquiry report of the health director general stating that there was no financial loss, the CM approved closing the dis- ciplinary action against Dr Joshi. Further, Rawat also granted approval to transfer Udham Singh Nagar district Panchayat office accountant Govardhan Dumka to Bageshwar on complaints of misbehaviour with senior offi- cials and not taking interest in work. 2VaP]cbP__a^eP[bU^aePaX^dbST_PacT]cP[f^aZb ?=BQ 347A03D= The agitating farmers kept the police on its toes on Saturday with their proposed march to the Rajbhawan in protest against the three farm laws. The traffic on the Haridwar Dehradun road went haywire as the protesting farm- ers hit the road in Doiwala area of Dehradun. The traffic on Dehradun Delhi highway was also affected by the agitation of farmers. The police and admin- istration had a tough time in controlling the farmers and managing the traffic. The agi- tating farmers and the police had skirmishes in Doiwala and Harrawala areas of the city. On the call given by the Sanyukt Kisan Morcha, farmers from different areas had planned to march to Raj Bhavan on Saturday. Doiwala town was the biggest centre of the agitation as hordes of farmers from nearby villages assembled there and started the march. Large numbers of tractors were also there in the march. The farmers were able to break the police barriers at Bhaniawala, Lachhiwala and Harrawala. At Lachhiwala, the farmers and police personnel were involved in skirmishes. At one point of the time it appeared that the things could go out of control. Panicked by the march of the farmers, the administration was able to stop farmers at Indian Institute of Petroleum (IIP) on Haridwar road. The police placed many dumpers on the road to block the trac- tors of the farmers. Later a five member delegation of the farmer leaders comprising of Tajendra Singh Taj, Balbir Singh, Umed Bora, Surendra Singh and Advocate Manohar Singh met ADM Kusum Chauhan, SP Rural Parmendra Dobhal and SP City Shewta Chauby. The farmer leaders submitted a memorandum directed to the governor to the officers. In the memorandum the farmer leaders demanded that the three farm laws should be rolled back without any further delay. They also demanded that no case should be regis- tered against them for their agi- tation on the day. The farmers marching from Roorkee to Dehradun were stopped at Biharigarh. Here additional police force had to be sent. The farmers coming from Sahaspur and Vikasnagar were stopped at Singniwala. In Dehradun the mem- bers of the Kisan Sabha assem- bled at Gandhi Park on the day. Their march to the Rajbhawan was stopped by the police at Hathibarkala. ?^[XRTP]S PSX]XbcaPcX^] WPSc^dVWcXT _aTeT]cX]VcWT PaRW 5PaTab´PaRWc^APY1WPfP]RaTPcTbRWP^bX]3^^] ?=BQ 27010 At a time when many resi- dents of cities tend to ignore the problems of stray cattle, the residents of the mountain town Chamba have elicited focus on the bond shared between people and bovines especially in the moun- tains. An injured stray cow called Radha by the locals died on Saturday after months of care by the locals. Following her demise, the cow was given a formal burial as per the Hindu rituals. A section of the locals also took out a funeral procession before the body of the cow was buried in the for- est area. A Peepal sapling was also planted on the burial site. An injured stray cow affec- tionately called Radha by the locals was lying at the Durga Mandir in Chamba for the past four months. Due to a spinal fracture, the cow was unable to stand. The locals also called veterinarians to check her condition but were told to shift her to a hospital in Dehradun or some other city for surgery. However, this could not be done in the absence of a vet- erinary ambulance. The locals feared the transporting the injured cow from Chamba to a city in a utility vehicle would worsen her condition. So, they took care of her for about four months, providing her fodder, water and medicines. After the cow expired on Saturday, the shopkeepers and residents around the temple decided to take out a funeral procession and give her a proper burial as per the Hindu rituals. The ward member Vikas Bahuguna, Ankit Tadyal and others were also present on the occasion. APSWdQdaXTSaXcdP[[hPUcTa^]cWb^URPaT CWTDccPaPZWP]ScPQ[TPd³:TSPaZWP]SPcAPY_PcWSdaX]VUd[[SaTbbaTWTPabP[^UcWTAT_dQ[XR3Ph?PaPSTX]cWT]PcX^]P[RP_XcP[^]BPcdaSPh ?X^]TTa_W^c^ ?=BQ 347A03D= The rank of Dehradun smart city project has risen from 16th last week to ninth while in state rankings, Uttarakhand has reached the first position. Officials of Dehradun Smart City Limited (DSCL) said this in the 16th meeting of the city level advisory forum on Saturday. The officials informed representatives attending the meeting about the status of water ATM, smart toilets, Parade Ground rede- velopment, Paltan Bazaar development and integrated command and control centre works being undertaken as part of the Dehradun smart city project. They informed that the construction work in the Parade Ground is complete and the site is ready for the Republic Day parade here. Regarding the green building to be constructed as part of the project, the officials informed that the building will have nine floors and that its design will be based on traditional architecture of Uttarakhand. The officials also made pre- sentations on other proposed and under-construction works as part of the smart city plan. The Dehradun mayor Sunil Uniyal ‘Gama’, MLAs Harbans Kapoor, Khajan Das, DSCL chief executive officer Ashish Kumar Srivastava and other members of the forum along with officials of the depart- ments concerned were also present in the meeting. 3TWaPSd]BPac2Xch Yd_bc^]X]cWaP]Z ?=BQ 347A03D= Glowing tributes were paid to Netaji Subhash Chandra Bose by the Congress party leaders and its workers on his 125th birth anniversary on Saturday. In a programme organised at the Rajiv Bhawan, the Congress leaders offered flowers on the portrait of Bose. Speaking on the occasion, the Vice President of Uttarakhand Congress Surya Kant Dhasmana said that Bose had a unique and magnetic per- sonality. He said that Bose was so popular that he defeated Pattabhi Sitaramayya who had full support of Mahatma Gandhi in the election for the post of the Congress presi- dent. Dhasmana said that Bose resigned from the post of Congress president when Gandhi ji publicly stated that it appears that Congress workers no longer have faith in him. The Congress leader said that Bose raised the Indian National Army (INA) which gave a jolt to the British empire. The Congress general sec- retary Rajendra Shah, Navin Joshi, spokesperson Garima Dassauni, Ajay Singh, Mahesh Joshi and other Congress leaders were present on the occasion. 2^]V_Phb caXQdcTbc^=TcPYX ^] !$cWQXacW P]]XeTabPah CWT^UUXRXP[b X]U^aTS aT_aTbT]cPcXeTb PccT]SX]VcWT TTcX]VPQ^dc cWTbcPcdb^U fPcTa0CbPac c^X[Tcb
- 4. 347A03D=kBD=30H k90=D0AH !#!! ]PcX^]# ?=BQ 270=3860A7 Farmers from Punjab and Haryana in several batches on Saturday drove in their trac- tor-trolleys and other vehicles to take part in the planned tractor parade on January 26 in Delhi. Carrying essential items like ration, mattresses etc. the cavalcades of tractors left for Delhi to press the Centre to accept their demands. Tractors carried the flags of the unions, some sported the tricolour, and also posters with slogans of ''Kisan Ekta Zindabad'', ''No Farmer, No Food'' and ''Kaale Kanoon Radd Karo''. Farmer unions protesting the Centre's three farm laws had said they would go ahead with their tractor parade in Delhi on Republic Day. They had announced to take out the tractor parade on the Outer Ring Road in Delhi. Farmer leaders said that the tractor parade would be peaceful. Over 30,000 tractors and trolleys today moved from Khanauri (in Sangrur, Punjab) and Dabwali (in Sirsa district, Haryana) to join the tractor parade in Delhi, said Bharti Kisan Union (Ekta-Ugrahan) general secretary Sukhdev Singh Kokrikalan on Saturday. Some farmers even mount- ed tractors on trailers and a few even towed their tractors in order to save diesel, said the farmer leaders. Some loaded their tractors in trailers and some even towed their vehicles in order to save fuel, said Kokrikalan. Similarly, a cavalcade of around 1,000 tractors left from Phagwara area and 150 tractors from Hoshiarpur in Punjab to become part of the parade, said the farmer leaders. A farmer leader in Barnala said they were getting a very good response to the call for joining the tractor parade. Youth and elders are going in their tractors towards Delhi in a peaceful manner, he said. A batch of tractors and other vehicles from Fatehabad in Haryana also left for Delhi to join the parade. Many farmers from Karnal and other districts would leave for the national capital on Sunday. Independent MLA from Dadri in Haryana, Sombir Sangwan, who recently with- drew his support to the Khattar government over farmers' issue, told reporters on Saturday that the Centre will have to agree to farmers' demands. Sangwan, who had gone to meet protest- ing farmers at the Haryana- Rajasthan border near Rewari, also told reporters that farmers should be freely allowed to take part in tractor parade on January 26. Kirpal Singh Moosapur, Vice-President, Bharati Kisan Union (Doaba) in Phagwara, Punjab, said, More farmers with tractors will leave tomor- row as well. We expect over 5,000 tractors from Doaba region (in Punjab) alone to reach Delhi for the parade. He slammed the Centre for not accepting farmers'' demands. Farmers have been agitating at Delhi borders for the last sev- eral weeks but the Modi gov- ernment has turned a deaf ear to their demands, he said. Before heading for Delhi, many farmers got their tractors inspected from mechanics for any fault so they can have a has- sle-free journey, said the farmer leaders. At many places in Punjab and Haryana, tractor marches were taken out on Saturday to mobilise more people for the tractor parade. Meanwhile, some women in Bathinda said they have asked their male members who are at the Delhi borders not to worry about homes. We are taking care of the farm and other works. We have told our male members to stay put until the demands are met, said an elderly woman in Bathinda. 7Rc^VcdR_UeYVZcecRTe`cdWc`^Af_[RS9RcjR_RdVe`feW`caRcRUV 50A4ABA30HCA02CA?0A034 ?=BQ 270=3860A7 In the wake of the farmers' ongoing agitation and their plan to hold a tractor rally on Republic Day, Haryana Police have sought 50 companies of central armed police forces from the Central Government to maintain law and order and peaceful conduct of Republic Day Celebrations in the State. Talking to The Pioneer over the phone, Haryana Director General Police (DGP) Manoj Yadava on Saturday said, ”We have sought additional forces of 50companiesofCAPFfromthe Centre Government. These forces are yet to arrive. We are mobilising maximum State resources to strengthen the security across the State. We are determined to ensure peaceful and uninterrupted Republic Day celebrations in the State.” Regardingsecurityarrange- ments, he said that a multi- prone strategy has been draft- ed. All the State resources will be utilised for peaceful conduct of Republic Day celebrations. Maximum forces have been mobilized at strategic locations. Intelligence officials have been put on alert. Additional police forces have been deployed at important locations across the State. The leave of police per- sonnel have been cancelled till further orders, he said, adding that all the Commissioners of Police and Superintendents of Police have been directed to ensure elaborate security cover in view of farmers’ tractor rally on Republic Day celebrations at all important installations in their jurisdictional limit. At the local level also, dis- trict DCP, SP and police offi- cers are in touch with farmers’ leaders and explaining to them that Republic Day is a nation- al festival. They should be above any agitation and any politics. Overall they are citi- zens of the country. Police are convincing them not to oppose any programmes but cooper- ate with the administration for peaceful Republic Day cele- brations. At the same time, no one will be allowed to take laws in their hands. Stringent action against anti-social elements has been ordered, he added. The District Deputy Commissioner of Police and SPs have also been instructed to intensify patrolling and checking drive in their juris- dictional limit.Security forces have been told to keep close tabs on unclaimed goods, vehi- cles as well as suspicious per- sons. Additional forces have also been deployed so that no untoward incident takes place and everything goes smooth- ly, he added. 9RcjR_RA`]ZTVdVVd!T`^aR_ZVd`W 4V_ecR]W`cTVdWc`^4V_ecVdRjd58A Chandigarh: The Aam Aadmi Party (AAP) took out motor- cycle rallies in several parts of Punjab on Saturday to mobilise people for 'Kisan Tractor Parade' announced by farmers in Delhi against Centre's agri- culture laws, on January 26. AAP's State president and MP Bhagwant Mann said the party workers have taken out motorcycle rallies across the state to mobilise people for the 'Kisan Tractor Parade' in the national Capital on Republic Day. All the party MLAs organ- ised motorcycle rallies with supporters and volunteers in their respective constituencies. MannsaidtheAAPworkers through the motorcycle rallies called on the people to join the 'Kisan Tractor Parade' to be held onJanuary26andconveyedsup- port to the farmer brothers and sisterswhoweresittinginprotest on the Delhi borders in severe cold.Thisrallyhasnotbeentaken outforanypoliticalpurpose,nor should it be seen as political. We allcomefromfarmerfamiliesand farming is in our blood. Our ancestors were farmers and still morethan80percentofthepeo- pleofPunjabareinvolvedinfarm- ing.Beingthesonofafarmer,we have organised this motorcycle rallytogiveoursupportin'Kisan Tractor Parade' to be held on January 26, said Mann. He added that the purpose of this rally was to appeal the people to participate in the 'Kisan Tractor Parade' on the occasion of Republic Day. 00?W^[Sb^c^aRhR[TaP[[XTbX] ?d]YPQc^^QX[XbT_T^_[TU^a_PaPST ?=BQ 347A03D= To commemorate the birth anniversary of Netaji Subhash Chandra Bose, Motherhood University, Roorkee in Uttarakhand today organised a programme at its Vivekanand Auditorium. Addressing the gathering, Motherhood University’s Director Administration Deepak Sharma referred to the day as Parakram Diwas asserting that there were no parallels to the sacrifice made by Netaji for the cause of India. He said the youth of today must take inspiration from the life of Netaji. Registrar R Kasturi also paid floral tributes to Netaji Subhash Chandra Bose. He said the level of com- mitment for the country of Netaji can be gauged from the fact that he despite qualifying the ICS refused to serve under the British. He also spoke about how Netaji formed Azad Hind Fauj on July 5, 1943. ^cWTaW^^SD]XeTabXchaTTQTab=TcPYX ?=BQ A0=278 Amidst his deteriorating health, Rashtriya Janata Dal (RJD) Supremo Lalu Prasad, convicted in multimil- lion fodder scam, was flown from Ranchi to New Delhi by Vistara plane on Saturday for better treatment. Prasad will be admitted in theAllIndiaInstituteofMedical Sciences (AIIMS) in the nation- al capital. He was referred to AIIMS after doctors held a brainstorming meeting at Rajendra Institute of Medical Science (RIMS). Prasad will get treatment facility for one month at AIIMS. Further decisions will be taken after looking at the reports of the doctors of AIIMS. A medical team from RIMS has accompanied Lalu to AIIMS. Due to a severe infection in the lung, it was decided to take Prasad from RIMS to AIIMS. An 8-member medical board was formed to shift him to another hospital. Lalu Prasad's entire family was in Ranchi since yesterday. Lalu's son Tejashwi Yadav said on Friday in order of inter- action with the media that there was a lot of swelling in his father's face. There is also a heavyfallinhisbodyweightand Prasad has become much weak- er than before, he added. Tejashwi said that all his health information has been received from doctors and he also reached on Saturday at the pay- ing ward of RIMS to meet his father. Lalu Prasad Yadav's wife Rabri Devi, daughter Misa Bharti and sons Tejashwi Yadav and Tej Pratap Yadav reached RIMS in Ranchi at around 1 am on Saturday. RJD leader Tejaswi said that his family wants a bet- ter treatment for Lalu, but it is all up to the doctors here to give their advice after looking at the report. Tejaswi said that his father's condition is critical. Minister of Agriculture, Animal Husbandry and CooperationoftheGovernment of Jharkhand, Badal, reached hotel Radisson Blu in the State Capital in the morning and met Tejashwi. From there he directly reached the Chief Minister's residence with Tejashwi. After meeting the Chief Minister, Hemant Soren he requested better treatment of Lalu. Badal said that Lalu is a leader of the poor and the Government of Jharkhand is veryseriousabouthistreatment. The Minister said that with Lalu, there are prayers of mil- lions of people with Prasad, and he will return soon. “There is no reason to deny him better treatment if he is unwellanddoctorshavereferred him to Delhi,” said Inspector General, Prisons, Birendra Bhushan. A CBI court on December 23, 2017 convicted Prasad in a fodder scam case related to fraudulent withdrawal of Rs.89 lakh from the Deoghar treasury from year 1991 to 1994 and sent himtojail.Amonthlater,hewas convicted in another fodder scam case and sentenced to five years of imprisonment. He was admitted in the cardiology wing of RIMS the next year after he complained of discomfortwhileservingimpris- onment in the Birsa Munda Central Jail in Ranchi. Qe@bQcQTQT]YddUTY^199=C A932WXTU;P[d?aPbPSHPSPeQTX]VbWXUcTSc^088BX]=Tf3T[WXUa^APYT]SaP 8]bcXcdcT^UTSXRP[BRXT]RTA8BPUcTaWXbWTP[cWSTcTaX^aPcTSX]AP]RWX^] BPcdaSPh EX]Phdadk?X^]TTa ?=BQ A0=278 In a bid to put a check on cyber crime in Jamtara and channelise the energy of the youth there, the government has started opening public libraries in villages of the dis- trict, which has won the infamy of being the cyber crime capi- tal of India, officials from the Jamtara district administration said on Sunday. Young boys and girls of the district, who fell prey to the lure of easy money and turned cyber frauds, will now read the best of books free of cost at the public libraries and help Jamtara drop thetagofbeingadistrictthathas bred several notorious cyber frauds, officials said. “The government has start- ed public libraries in several blocks of Jamtara. Some of the librarieshavebeensetupatpan- chayat bhawans in the district in order to provide easy access to books to the youth of the dis- trict,” said Jamtara deputy com- missioner,FaizAhmedMumtaz. Such public libraries have startedoperatinginat least33of 118 panchayats in the district, and the government aims to build at least one library in each ofthe118panchayatsinJamtara, officials said. The libraries already offer books like the Discovery of India, Indian Economy and India After Gandhi. By reading books, chil- dren will not only enhance their knowledge, but also develop the urge to contribute to the society and work for their coun- try, officials said. Jamtara is home to several gangsofteenagecybercriminals, whohavedupedseveralrichand educated people living in the metros, say police. Around 200 Kilometers north of Ranchi, Jamtara is said to be the Indian equivalent of the Romanian town of Ra^mnicu Va^lcea, dubbed Scamville, which is the global capital for cyber crimi- nals. Last year, Netflix released a web series on the cyber crim- inals of Jamtara and named it ‘Jamtara–SabkaNumberAyega’. According to police, cyber criminals in Jamtara are most dependent on phishing, a pro- cedure in which cyber frauds disguise as trustworthy repre- sentatives of banks and finance companies over phone calls and ask for personal banking details of their target. Teenagers in the district often learn phishing and minor cyber frauds from their older counterparts and this trend has gradually led to Jamtara becom- ing a hotbed of cyber crime, say localsources.Cybercrimegangs have also spread their reach to the neighbouring districts of Deoghar, Dumka, Giridih and Dhanbad, reveal records with the state police. Besides preventing youths from joining gangs of cyber criminals, the libraries are also expected to help children pre- pare for their class 10 and class 12 board exams this year, said the Jamtara DC. 9PcPaPc^UXVWc RhQTaRaXT cWa^dVWQ^^Zb
- 5. [P]SPaZ$ 347A03D=kBD=30H k90=D0AH !#!! A0:4B7:B8=67Q =4F34;78 Agroup of Jaish-e- Mohammad (JeM) is preparing for a Lethpora (February, 2019) type IED attack in Jammu and Kashmir in the run up to the Republic Day celebrations or in the subsequent period. Other groups like Lashkar-e-Tayyaba and Hizbul Mujahideen are sepa- rately fabricating IEDs to carry out hits in the Valley. A group of the LeT oper- ating in Hajin area have fabri- cated an IED and concealed it at an undisclosed location in Parray Mohalla, Hajin in Bandipore district of Jammu and Kashmir, according to an input with the security agen- cies. The IED is likely to be used in the Pattan-Baramulla highway stretch to target secu- rity forces in the near future, according to the input. An IED is being fabricat- ed in village Gundibagh under Kakapora police station in Pulwama) by the JeM opera- tives for the planned hit. Sameer Ahmad Dar, a local terrorist of JeM along with three to four other mili- tants are involved in this preparation, according to the inputs. Sameer Ahmad Dar is being assisted by Riyaz Ahmad Dar alias Khalid of LeT/The Resistance Front. Two bags of around 15-20 kg each of explo- sive material are in their pos- session for fabrication of the IED, the inputs have revealed. Sameer Ahmad Dar is cousin of Adil Ahmed Dar, who carried out the CRPF convoy attack on February 14, 2019 at Lethpora, Pulwama. Another group of Hizb-ul- Mujahideen militants is plan- ning an IED attack on securi- ty forces near Lethpora, Pulwama around January 26, 2021. An IED weighing around 15 kg, fabricated in a gas cylin- der, has been prepared. Security forces camps of CRPF and a nearby Army cam on National Highway-44 and a security force Naka (check post) near Ladhoo Crossing (NH-44), where a SF vehicle is routinly parked, are assessed to be likely targets. A recee of the area has already been carried out by the Hizbul operatives. µEVcc`cZdeda]R__Z_X:65 S]Rded`_C5RjZ_;¶ NEW DELHI: The Ministry of Home Affairs (MHA) has written a letter to all chief sec- retaries of Union Territories and States on protection of rights of transgender persons and also directed them to sen- sitise police and prison offi- cials in this regard. The Ministry has also said that all States are required to protect and rehabilitate trans- genders. “The law mandates ade- quate steps to be taken by the State Governments/Union Territories for not only pro- viding for welfare measures to be taken but steps to be taken for rescue, protection and rehabilitation of a transgender person,” read the MHA’s letter. The MHA has said that under section 18 of the Transgenders (Protection of Rights) Act, 2019, it is a pun- ishable offence in case anyone compels or entices a trans- gender person to indulge in the act of forced or bonded labour other than any com- pulsory service for public pur- poses imposed by the govern- ment. While giving details of the act, MHA said if someone denies a transgender person the right of passage to a pub- lic place or obstructs such person from using or having access to a public place to which other members have access to or a right to use, forces or causes a transgender person to leave the household, village or other place of resi- dence, it also falls under the category of punishable offence. The MHA highlighted that harming or injuring or endan- gering the life, safety, health or well-being, whether mental or physical, of a transgender person or tending to do acts including causing physical abuse, sexual abuse, verbal and emotional abuse and eco- nomic abuse is also a punish- able offence. “Rule 11 provides for ade- quate measures to be taken to prevent non-discrimination of transgender persons, including setting up of a Transgender Protection Cell under the charge of District Magistrate in each District and a State Level Cell under the Director General of Police, to monitor cases of offences against transgender persons and ensure timely registration, investigation and prosecution of such offences,” read the letter. “You are requested to ini- tiate necessary measures in terms of the Act immediately and undertake necessary sen- sitization programmes for the police and prison officials,” the MHA stated. ANI A094B7:D0AQ =4F34;78 Rabi crops sowing acreage has touched an all time high this season. According to data furnished by the Ministry of Agriculture, rabi crop sow- ing completed 675 lakh hectare this year, up from than 662 lakh hectare last year, an increase of 2.86 percent. This is an indi- cation that farmers have not boycotted the farming activities despite protests since October last year. The record rabi crops sow- ing acreage is the indication they participated in the protests in a planned manner. With a major- ity of farmers pitching in at Delhi borders in protest against the new central farm laws, their family members have been left taking care of standing wheat crop in the field and other allied activities back home. In absence of adult males, women have taken the charge of irri- gating fields, sprinkling fertilis- ers in them, tending cattle, milking cows and chopping fodder for them. In some vil- lages, committees have also been formed in several villages where fellow villagers irrigate crops of those who are at the protest site. The sowing in the current season is not over yet while their protest enters the 59th day. As per the data, all major rabi crops, barring a few coarse cereals,surpassedthearea plant- ed in the previous season, which was by far the best, already. With 345 lakh hectare acreage, the coverage of wheat has also touched the highest level 3.13% more than last year. Much of the increase in wheat planting was reported from Madhya Pradesh — which planted an additional area of 8.3 lakh hectare, Maharashtra 1.07 lakh hectare and Bihar 0.84 lakh hectare more. Punjab, Rajasthan, Gujarat and Uttarakhand among those states which planted less wheat this season. Madhya Pradesh has surpassed Punjab in wheat cul- tivation for the past two years. The paddy acreage has also gone up sharply by 15.24% from last year but significantly down by more than 28% as compared to average area dur- ing this time. Much of the increase in rice area came from Telangana which planted an additional 3.49 lakh hectare under rice. Gram and mustard are two other crops which have done exceedingly well in terms of cov- erage. Gram has been planted over nearly 111 lakh hectare, while mustard fields covered close to 74 lakh hectare. At the end of the previous rabi season, the area of gram and mustard was around 107 lakh hectare and 70 l akh hectare, respec- tively. However, there is a dip in area under coarse cereals. As compared to nearly 55 lha planted in the same week last year, coarse cereals covered only around 51 lha so far. Agriculture Minister Narendra Singh Tomar con- gratulated farmers in the coun- try for their tireless hard work. “Despite the corona epidemic, farmers have achieved record area coverage under rabi crops as well as in kharif season, which is remarkable,” Tomar said. According to summer crop campaign, a target of 51 lakh has been fixed to cover summer season with pulses, oil seeds and nutri-cereals crops this season. Further, as per 4th Advance Estimates (2019-20), total food grains production in the country is estimated at 296.65 million tonnes, and horticulture production 319.57 which will be an all time record in 2019-20. The pulses and oilseeds production is at 23.15 and 33.42 million tonnes, respec- tively. Production of cotton is being estimated at 354.91 lakh bales with which India is set to rise to the top producing coun- tries in the world. 0b_TacWTSPcP P[[PY^aaPQX Ra^_bQPaaX]VP UTfR^PabT RTaTP[b bda_PbbTScWT PaTP_[P]cTSX] cWT_aTeX^db bTPb^]fWXRW fPbQhUPacWT QTbcP[aTPSh APQXRa^_bb^fX]VPRaTPVT c^dRWTbP[[cXTWXVWcWXbbTPb^] ?=BQ =4F34;78 People with high blood sugar may have an increas- ing risk of Alzheimer’s than those with normal blood sugar—whether or not their blood-sugar level technically made them diabetic — scien- tists said on the basis of fol- lowing the health status of over 5,189 people for over 10 years. In other words, the high- er the blood sugar, the faster the cognitive decline, said their longitudinal study which has been published in the journal Diabetologia. Type 1 diabetes is an autoimmune disease needing intake of insulin injection, and type 2 diabetes is a chron- ic disease caused by diet. “Dementia is one of the most prevalent psychiatric conditions strongly associat- ed with poor quality of later life,” said the lead author, Wuxiang Xie at Imperial College London. “Currently, dementia is not curable, which makes it very important to study risk factors,” Melissa Schilling, a professor at New York University, performed her own review of studies con- necting diabetes to Alzheimer’s in 2016. She sought to reconcile two confusing trends. People who have type 2 diabetes are about twice as likely to get Alzheimer’s, and people who have diabetes and are treated with insulin are also more likely to get Alzheimer’s, sug- gesting elevated insulin plays a role in Alzheimer’s. In fact, many studies have found that elevated insulin, or “hyperinsulinemia,” signifi- cantly increases your risk of Alzheimer’s. On the other hand, people with type 1 dia- betes, who don’t make insulin at all, are also thought to have a higher risk of Alzheimer’s. How could these both be true? Schilling posits this hap- pens because of the insulin- degrading enzyme, a product of insulin that breaks down both insulin and amyloid pro- teins in the brain—the same proteins that clump up and lead to Alzheimer’s disease. People who don’t have enough insulin, like those whose bodies’ ability to pro- duce insulin has been tapped out by diabetes, aren’t going to make enough of this enzyme to break up those brain clumps. Meanwhile, in people who use insulin to treat their dia- betes and end up with a sur- plus of insulin, most of this enzyme gets used up breaking that insulin down, leaving not enough enzyme to address those amyloid brain clumps. According to Schilling, this can happen even in peo- ple who don’t have diabetes yet—who are in a state known as “prediabetes.” Diabetes can also weaken the blood vessels, which increases the likelihood that you’ll have mini-strokes in the brain, causing various forms of dementia. A high intake of simple sugars can make cells, includ- ing those in the brain, insulin resistant, which could cause the brain cells to die. The extra fat in obese peo- ple releases cytokines, or inflammatory proteins that can also contribute to cognitive deterioration, doctors say. Diabetes may also increase the risk of developing mild cognitive impairment (MCI), a condition in which people experience more thinking (cognitive) and memory prob- lems than are usually present in normal aging. ³7XVWQ[^^SbdVPaPhX]RaTPbTaXbZ^U0[iWTXTa´b´ ?C8Q 937?DA Eight Rafale aircraft have already arrived in India and three more are expected by the end of this month, Air Chief Marshal Rakesh Kumar Singh Bhadauria said here on Saturday. The IAF chief was speaking at a press conference after the conclusion of ‘Exercise Desert Knight-21’ held in Jodhpur by the air forces of India and France. He said IAF has initiated a fifth-generation fighter aircraft programme with the Defence Research Development Organisation (DRDO) and plans to incorporate some sixth-generation capabilities in it as well. “Our present vision is to incorporate all the latest technologies and sensors in our fifth-generation aircraft,” Bhadauria said. “We started work on fifth- generation aircraft a little late. So technologies and sensors contemporary to that period of development would be added into fifth-generation fighters,” he added. Bhadauria said when IAF received the Rafale aircraft, the first priority was to opera- tionalise it and integrate it with the existing combat fleet. “It has already been done, and the current exercise Desert Knight was the result of that,” he said. “We have some Indian pilots training in France and some in India itself. We have enough pilots to have a right pilot-cockpit ratio,” the Air Chief Marshal said, adding that the entire induction would be completed by next year. Earlier, Bhadauria con- gratulated both the air forces for successfully completing the exercise in just four days. Desert Knight-21 was sched- uled to be held over five days. “It is not in terms of inter- operability which has been learnt in this exercise, but employment of best practices, operational philosophies and mutual as well as professional interaction,” he said. Later, talking to the media, French Ambassador to India Emmanuel Lenain said bilat- eral cooperation between the two countries has been going on ever since the first French aircraft landed in India in 1953. “Now Rafale is the reflec- tion of this strengthened coop- eration and partnership,” Lenain said. He said this partnership has persisted through good and bad times. “When India faced diffi- culties during its atomic test in Pokran in 1998, we were at your side while other countries opposed and objected. And we were also by your side in cooperational manner when you had difficulties with one of your neighbours,” the ambassador said. He said this exercise would further help in building mutu- al trust and pave the way for more cooperation. ³4gTaRXbT3TbTac :]XVWc! ´WT[SQh0Xa 5^aRTb^U8]SXPP]S 5aP]RT 8]SXPWPbaTRTXeTS'APUP[TYTcb^aT Tg_TRcTSQh^]cWT]S)805RWXTU ?=BQ =4F34;78 The Indian Meteorological Department (IMD) has predicted cold wave to severe cold wave conditions in isolat- ed pockets of northwestern India starting Sunday till January 27. IMD has also issued orange alerts for Punjab, Haryana, Delhi, Chandigarh and Uttar Pradesh for Sunday. The warning for Delhi, Punjab, Chandigarh and Haryana are from Sunday to Monday to alert citizens for dense fog and cold weather conditions. The IMD said, cold wave to severe cold wave conditions likely to prevail over north Rajasthan during January 24- 27, 2021. While Punjab, Haryana, Chandigarh, Delhi and Uttar Pradesh can witness cold to severe cold waves dur- ing January 26-27. The IMD explained that the weather conditions were influenced by a western dis- turbance lying over Afghanistan and the presence of cyclonic circulation in lower levels over central Pakistan and Punjab northern Indian states including the Himalayas can likely witness rain, thun- derstorm and snow during the next few days. A cold day is declared when the minimum temperature is below 10°C and the maximum temperature is 4.4°C below the regional nor- mal. Dense to very dense fog in isolated pockets of northern plains of India comprising states like Punjab, Haryana, Chandigarh, Delhi, Uttar Pradesh, north Rajasthan, Bihar and north Madhya Pradesh has also been antici- pated during the next 2-3 days. “Dense to very dense Fog in isolated/some pockets very likely over Punjab, Haryana, Chandigarh and Delhi, UP, north Rajasthan, Assam and Meghalaya and Manipur and Tripura during next 4-5 days; over Bihar, north Madhya Pradesh, West Bengal and Sikkim and Odisha during next 2-3 days,” the IMD said. BTeTaTR^[S [XZT[hc^_aTePX[ X]]^acWfTbcTa] 8]SXPcX[[9P]! ?C8Q =4F34;78 The Enforcement Directorate Saturday said a money laundering chargesheet has been filed against a Haryana-based company and its directors accused of cheat- ing about 31 lakh investors by way of a Ponzi or fraud multi- level marketing scheme. It said a prosecution com- plaint or chargesheet has been filed against Hisar-based Future Maker Lifecare Pvt Ltd and its two directors Radhe Shyam and Bansi Lal under various sections of the Prevention of Money Laundering Act (PMLA). The chargesheet has been filed before a special PMLA court in Panchkula “with a prayer for awarding punish- ment to the accused persons and confiscation of attached assets to the tune of C261.35 crore”. According to an ED state- ment Radhe Shyam and Bansi Lal, both residents of Haryana, floated companies in the name of Future Maker Life Care Pvt Ltd and FMLC Global mar- keting Pvt Ltd. “Through these compa- nies they have duped innocent persons in guise of a multi-level marketing (MLM) scheme that promoted various Ponzi schemes in many parts of the country,” the Enforcement Directorate alleged in the state- ment issued here. An MLM scheme works in a pyramidal structure where the persons at the top gain at the behest of the loss borne by the persons at the base of the pyramid. The ED’s money launder- ing case against the accused was filed after taking congni- sance of multiple Haryana and Telangana police FIRs regis- tered against the accused for “cheating lakhs of investors”. The Haryana Police had slapped charges of cheating and conspiracy under various sections of the IPC and those under the prize chit and money circulation banning Act of 1978 read with Haryana protection of interest of deposits in Financial Establishment Act of 2013 against the accused, the central probe agency said. The ED said its probe found that “around 31 lakh investors lost their money by making investments in the schemes floated by the accused”. “In this scheme, the initial investors were paid high returns to attract more investors and entice current ones to invest more money. When other investors begin to participate, a cascading effect begins,” it said. The schemer pays a “return” to initial investors from the investments of new participants rather than from genuine profits, it said, describ- ing the modus operandi allegedly deployed by the “Radhey Shyam used to lure innocent persons through speeches in fancy seminars conducted across India promising high returns of up to 5-8 times of the investment in two years.” “Bansi Lal was the finan- cial mastermind whose role was layering and laundering of the tainted money collected from the investors in various paper concerns,” the ED claimed. 43UX[TbRWPaVTbWTTcPVPX]bc7PahP]PUXaSXaTRc^abU^aSd_X]V ;X]eTbc^ab 7^TX]XbcTa0XcBWPW[Pd]RWTb0hdbWP]20?5U^a_PaPX[XcPahX]0bbP ?C8 ?C8Q =4F34;78 There is an urgent need for reforming legal education in the country as its quality is being affected due to the “mushrooming” of law col- leges, two Supreme Court judges said on Saturday. “I do believe we are churn- ing out too many lawyers with- out any analysis of the number of lawyers required,” Justice S K Kaul said. He said the quality of legal education has suffered as a result of a large number of “not so great law colleges” and the “crying need of the hour” was to see how legal education can be improved. Similar issues were also raised by senior advocate Abhishek Manu Singhvi. Referring to the concerns raised by Justice Kaul and Singhvi, Justice N V Ramanna said, “I wel- come this thought-provoking discussion and I agree with what they have expressed. It (legal education) requires urgent and immediate reform.” “I hope something can be done and we can take up this issue in the coming days,” he added. The remarks by the two apex court judges came during an event for the release of the book — The Law of Emergency Power— authored by Singhvi and professor Khagesh Gautam, who teaches law at Jindal Global Law School, on a legal and constitutional study of emergency powers. Speaking at the event, which was conducted virtually, Singhvi lamented upon the “glaring absence of genuine legal research in large parts of India”. “Part of this is due to the manyfactoriesoflegaleducation we produce with hardly any quality control. The negative impactofthestratificationoflaw colleges must be urgently addressed. “Central universities set up by Parliament operate their law facultyaslawschools,whilestate universities act mostly as affili- atinguniversitieswhichareaffil- iating colleges set up by private trusts and societies,” he said. ;TVP[TSdRPcX^]X]cWTR^d]cah ]TTSbdaVT]caTU^ab)B2YdSVTb BX]VWeX[PT]cTS d_^]cWTV[PaX]V PQbT]RT^U VT]dX]T [TVP[ aTbTPaRWX][PaVT _Pacb^U8]SXP 3URWHFWWUDQVJHQGHUV¶ ULJKWVVHQVLWLVHSROLFH 87V6WDWHVWROG
- 6. f^a[S% 347A03D=kBD=30H k90=D0AH !#!! Washington: The United State Senate has confirmed the nom- ination of General (retired) Lloyd Austin to serve as secre- tary of the defence depart- ment, making him the first ever African American to occupy the top Pentagon position. The nomination was con- firmed in an overwhelming 93-2 vote. Soon he was sworn in by Tom Muir, acting director of Washington Headquarters Services. Thereafter, Austin received an intelligence briefing. Vice President Kamala Harris would administer the ceremonial oath to Austin next week. President Joe Biden thanked the senate for con- firming Austin and working to get his cabinet in place. “It’s an honour and a priv- ilege to serve as our country’s 28th secretary of defence, and I’m especially proud to be the first African American to hold the position. Let’s get to work,” Austin tweeted. A day earlier, the House of Representatives voted 326-78 to pass a waiver exempting Austin from the seven-year ‘cooling off period’ for retired generals tak- ing over as defence secretary. The senate approved the waiv- er by 69-27 votes. This is the third time that Congress has given such a waiver to a retired general. The previous one being of General (retired) James Matin who was appointed as defence secretary by former President Donald Trump in January 2017 and George Marshall in 1947. Austin had retired as a four-star Army general in 2016. “I am honoured to have this chance to serve again and to do so alongside you and your fam- ilies. My wife, Charlene, and I know all too well the sacrifices you make to keep this country safe. That safety is job one, and I promise to work as hard as you do at it,” Austin said in his message to the defence forces soon thereafter. According to new Pentagon spokesperson John Kirby, the president called Austin in the afternoon, shortly after his arrival at the pentagon. “The president congratu- lated the secretary on his swift confirmation and thanked the secretary for agreeing to serve the country again. Secretary Austin expressed his gratitude to the president for his trust and confidence and for his support during the confirmation process,” Kirby said. Later in the day, Austin spoke to NATO Secretary General Jens Stoltenberg over phone. The call was his first to a foreign leader as the defence secretary, and reinforces the importance of the NATO alliance to the US, Kirby said. “The two leaders discussed the importance of our shared values, the current secu- rity environment including maintaining a strong NATO deterrence and defence pos- ture, and the ongoing missions in Afghanistan and Iraq. They alsobrieflyreviewedtheupcom- ing NATO Defence Ministerial and agreed to discuss it again in more detail in the coming weeks,” Kirby said. PTI London: Senior medics are at odds in the UK over the opti- mum gap between the two doses of vaccines being admin- istered for protection against COVID-19. The two vaccines current- ly being injected among the country’s priority groups, Pfizer/BioNTech and Oxford/AstraZeneca, both require a booster shot a few weeks later. Initial advice for the sec- ond dose to be delivered with- in 21 days was modified by the UK government scientists to up to 12 weeks apart, with the aim of vaccinating larger num- bers with at least one jab to inject some level of immediate protection. The Government’s Joint Committee on Vaccination and Immunisation (JCVI) claims unpublished data sug- gest that the Oxford- AstraZeneca vaccine is still effective with doses 12 weeks apart. But American pharma major Pfizer has said it has tested its vaccine’s efficacy only when the two doses were given up to 21 days apart, cre- ating some doubt over its effi- cacy with a larger time gap. The World Health Organization (WHO) recom- mends a gap of four weeks between doses, to be extended only in exceptional circum- stances to six weeks. Speaking alongside UK Prime Minister Boris Johnson at a 10 Downing Street briefing in London on Friday, England’s Chief Medical Officer (CMO) Professor Chris Whitty reiter- ated that increasing the gap between doses to a maximum of 12 weeks would allow “many more people to be vaccinated much more quickly”. In a letter to Prof. Whitty, the British Medical Association (BMA) has said it agreed that the vaccine should be rolled out “as quickly as possible” – but called for an urgent review and for the gap to be reduced. Dr Chaand Nagpaul, chair of the BMA Council, told the BBC there were “growing con- cerns” that the vaccine could become less effective with doses 12 weeks apart. “Obviously the protection will not vanish after six weeks, but what we do not know is what level of protection will be offered [after that point]. We should not be extrapolating data when we don’t have it,” he said. The debate is playing out as Johnson confirmed 5.4 mil- lion people across the UK have now received their first dose of the vaccine against COVID-19, with a record 400,000 vaccinations between Thursday and Friday. “In England one in 10 of all adults have received their first dose, including 71 per cent of over-80s and two thirds of elderly care home residents… There is much more to do, and the target remains very stretch- ing indeed, but we remain on track to reach our goal of offering a first dose to every- one in the top four priority groups by the middle of February,” said Johnson. PTI 6i8V_2fdeZ_e`SV WZcde3]RT5VWDVTj 0?Q C08?48 Eight Chinese bomber planes and four fighter jets entered the southwestern cor- ner of Taiwan’s air defence identification zone on Saturday, and Taiwan’s air force deployed missiles to “monitor” the incursion, the island’s Defence Ministry said. China, which claims Taiwan as its own territory, has conducted almost daily flights over the waters between the southern part of Taiwan and the Taiwan-controlled Pratas Islands in the South China Sea in recent months. However they have gener- ally consisted of just one or two reconnaissance aircraft. The presence of so many Chinese combat aircraft on this mission - Taiwan said it was made up of eight nuclear-capa- ble H-6K bombers and four J- 16 fighter jets - is unusual. A map provided by Taiwan’s Defence Ministry showed that the Chinese air- craft, which also included a Y- 8 anti-submarine aircraft, flew over the same waters where the most recent Chinese missions have been taking place near the Pratas Islands, though still well away from mainland Taiwan. Taiwan’s air force warned away the Chinese aircraft and deployed missiles to monitor them, the ministry added, using standard wording for how it responds to such activ- ities. “Airborne alert sorties had been tasked, radio warnings issued and air defence missile systems deployed to monitor the activity,” it said in a brief statement. There was no immediate comment from China. In the past China has said it has been carrying out exercises to defend the country’s sover- eignty and security. Beijing has watched with growing concern increasing US support for democratic Taiwan, especially during Donald Trump’s administra- tion which left office on Wednesday. Last year during visits by senior US officials to Taipei Chinese aircraft briefly crossed the median line of the Taiwan Strait, which normally serves as an unofficial buffer. The flight by the Chinese bombers and fighters on Saturday came just days after Joe Biden assumed the US presidency. CPXfP]R[PXb'2WX]TbT Q^QTa_[P]Tb#UXVWcTa YTcbT]cTaPXab_PRT 8.'HEDWHUDJHVRYHUZHHN JDSEHWZHHQRYLGYDFFLQHGRVHV Hong Kong: Hong Kong’s Government locked down an area of Kowloon peninsula on Saturday after an outbreak of the novel coronavirus, saying 10,000 residents must stay home until they have been tested and the results largely determined. The first such measure the city has taken since the pan- demic began has occurred in the densely populated neigh- bourhoods of Jordan that is home to many ageing, subdi- vided flats in which the virus could spread more easily. The Government said there are 70 buildings in the restricted area, which is close to the International Commerce Centre (ICC), and it aims to finish the process within about 48 hours, so that people can start to return to work on Monday. Hong Kong leader Carrie Lam said 50 makeshift testing points had been set up and 3,000 civil servants were assist- ing. “We are doing this also to dispel worries of the residents because there was talk that this is an epidemic area and it affected the life, psychology and business of the people here,” Lam said at a briefing close to the cordoned-off area. By 1 pm (0500 GMT) local time on Saturday, the govern- ment said about 3,000 people had been tested in the restrict- ed area. AP 0?Q ?0A8B French doctors have new advice to slow the spread of the virus: stop talking on pub- lic transport. The French Academy of Doctors issued guidance Friday saying people should “avoid talking or making phone calls” in subways, buses or anywhere in public where social distanc- ing isn’t possible. Masks have been required since May, but travellers often loosen or remove them to talk on the phone. Other French experts are urging more dramatic mea- sures – notably a third lock- down. France’s hospitals now hold more COVID patients than in October, when President Emmanuel Macron imposed a second lockdown.Viruspatients occupy more than half of the country’s intensive care beds. Infections in France are gradually rising this month, at more than 20,000 per day. France currently has the longest virus curfew in Europe, from 6 pm to 6 am, and restaurants and tourist sites have been closed since October. The Government has so far sought to avoid a full new lock- down. Protests are expected around France on Saturday against virus-related layoffs and to support those arrested for holding a techno rave party despite virus restrictions. France has seen 72,647 virus-related deaths. )UHQFKGRFWRUV 'RQ¶WWDONRQ SXEOLFWUDQVSRUW Wuhan: A year ago, a notice sent to smartphones in Wuhan at 2 am announced the world’s first coronavirus lockdown that would last 76 days. Early Saturday morning, residents in the central Chinese city where the virus was first detected were jogging and practicing tai chi in a fog- shrouded park beside the mighty Yangtze River. Life has largely returned to normal in the city of 11 mil- lion, even as the rest of the world grapples with the spread of the virus’ more contagious variants. Efforts to vaccinate people for Covid-19 have been frus- trated by disarray and limited supplies in some places. The scourge has killed over 2 mil- lion people worldwide. Traffic was light in Wuhan but there was no sign of the barriers that a year ago isolat- ed neighborhoods, prevented movement around the city and confined people to their hous- ing compounds and even apartments. AP :XKDQUHWXUQVWRQRUPDODV ZRUOGVWLOOEDWWOLQJSDQGHPLF 0f^P]TPcbPTP[bcP]SX]VPb^cWTaaTbXST]cb[X]Td_PcP_^_d[PaTPcTahX] FdWP]X]RT]caP[2WX]P´b7dQTX_a^eX]RT^]BPcdaSPh 0? Moscow: Protests erupted in over 60 Russian cities on Saturday to demand the release of opposition leader Alexei Navalny, the Kremlin’s most prominent foe. Russian police arrested more than 850 protesters, some of whom took to the streets in temperatures as frigid as minus- 50 Celsuis (minus-58 Fahrenheit). In Moscow, about 5,000 demonstrators filled Pushkin Square in the city centre, where clashes with police broke out and demonstrators were rough- ly dragged off by helmeted riot officers to police buses and detention trucks. Navalny’s wife Yulia was among those arrest- ed. The protests stretched across Russia’s vast territory, from the island city of Yuzhno- Sakhalinsk north of Japan and the eastern Siberian city of Yakutsk, where temperatures plunged to minus-50 Celsius, to the Russia’s more populous European cities. The range demonstrated how Navalny and his anti-cor- ruption campaign have built an extensive network of support despite official government repression and being routinely ignored by state media. The OVD-Info group that monitors political arrests said at least 191 people were detained in Moscow on Saturday and more than 100 at another large demonstration in St. Petersburg. Overall, it said 863 people had been arrested by late afternoon in Moscow. Navalny was arrested on Jan. 17 when he returned to Moscow from Germany, where he had spent five months recov- ering from a severe nerve-agent poisoning that he blames on the Kremlin and which Russian authorities deny. Authorities say his stay in Germany violat- ed terms of a suspended sen- tence in a 2014 criminal con- viction, while Navalny says the conviction was for made-up charges. The 44-year-old activist is well known nationally for his reports on the corruption that has flourished under President Vladimir Putin’s government. His wide support puts the Kremlin in a strategic bind — risking more protests and crit- icism from the West if it keeps him in custody but apparently unwilling to back down by let- ting him go free. Navalny faces a court hear- ing in early February to deter- mine whether his sentence in the criminal case for fraud and money-laundering — which Navalny says was politically motivated — is converted to 3 1/2 years behind bars. Moscow police on Thursday arrested three top Navalny associates, two of whom were later jailed for peri- ods of nine and 10 days. AP @gVc)!RccVdeVU ?a^cTbcbPRa^bbAdbbXPSTP]S=PeP[]h´baT[TPbT ?T^_[TR[PbWfXcW_^[XRTSdaX]VP_a^cTbcPVPX]bccWTYPX[X]V^U__^bXcX^][TPSTa0[TgTX=PeP[]hX]Bc?TcTabQdaVAdbbXP^] BPcdaSPh 0? Cairo: Tribal clashes in Sudan’s Darfur region have killed at least 250 people and displaced more than 100,000 people since erupting earlier this month, the UN refugee agency said. The violence in the provinces of West Darfur and South Darfur has posed a sig- nificant challenge to the coun- try’s transitional government. Among those displaced were some 3,500 people, most- ly women and children, who fled into neighboring Chad, according to Boris Cheshirkov, a spokesman for the UNHCR said Friday. Those fleeing the violence into eastern Chad’s Ouaddai province have been overwhelmingly forced to seek shelter — often nothing more than a tree — in remote places that lack basic services or pub- lic infrastructure, the spokesman added. AP F?+GZ`]V_TVZ_ DfUR_¶d5RcWfc Z]]VU#! UZda]RTVU= Los Angeles: Larry King, the suspenders-sporting everyman whosebroadcastinterviewswith world leaders, movie stars and ordinary Joes helped define American conversation for a half-century, died Saturday. He was 87. King died at Cedars-Sinai Medical Center in Los Angeles, Ora Media, the studio and net- work he co-founded, tweeted. Nocauseofdeathwasgiven, but CNN reported on January 2 that King had been hospitalised for more than a week with COVID-19. His son Chance also confirmed King’s death, CNN reported. A longtime nationally syn- dicated radio host, from 1985 through 2010 he was a nightly fixture on CNN, where he won many honours, including two Peabody awards. With his celebrity inter- views, political debates and top- ical discussions, King wasn’t just an enduring on-air person- ality. He also set himself apart with the curiosity be brought to every interview, whether ques- tioningtheassaultvictimknown astheCentralParkjoggerorbil- lionaire industrialist Ross Perot, who in 1992 rocked the presi- dential contest by announcing his candidacy on King’s show. In its early years, “Larry King Live” was based in Washington, which gave the show an air of gravitas. Likewise King. He was the plainspoken go-between through whom Beltway bigwigs could reach their public, and they did, earn- ing the show prestige as a place where things happened, where news was made. King conducted an esti- mated 50,000 on-air interviews. In 1995 he presided over a Middle East peace summit with PLO Chairman Yasser Arafat, King Hussein of Jordan and Israeli Prime Minister Yitzhak Rabin. He welcomed everyone from the Dalai Lama to Elizabeth Taylor, from Mikhail Gorbachev to Barack Obama, Bill Gates to Lady Gaga. Especially after he relocated to Los Angeles, his shows were frequently in the thick of break- ing celebrity news, including Paris Hilton talking about her stint in jail in 2007 and Michael Jackson’s friends and family memberstalkingabouthisdeath in 2009. AP ;Paah:X]VQa^PSRPbcX]VVXP]cU^aWP[URT]cdahSXTbPc' Johannesburg: South Africa has welcomed the United Nations’ Treaty on Prohibition of Nuclear Weapons (TPNW), which entered into force on Friday to ban nuclear weapons from the world. The treaty was approved by the UN General Assembly in 2017. It got its 50th ratification on October 24, triggering a 90- day period before its entry into force on January 22, 2021. “Today marks a turning point in humanity’s endeavour to rid the world of nuclear weapons,” International Relations and Cooperation Minister Dr Naledi Pandor said in a statement. “It is the culmination of that very first UN General Assembly resolution in 1946 which sought to deal with the elimination of nuclear weapons and other weapons adaptable to mass destruction. “It cannot be over empha- sised that the TPNW is not the final word on nuclear weapons, but a critical step in the evolu- tion of the regime that would be required to achieve and eventually maintain a world without nuclear weapons,” Pandor said. PTI B^dcW0UaXRPfT[R^TbD=´bCaTPch ^]?a^WXQXcX^]^U=dR[TPaFTP_^]b ?C8Q :0C70=3D Nepal on Saturday brought back the bodies of 18 migrant workers from Malaysia which is one of the major labour destinations for Nepali workers. The country’s national flag- carrier Nepal Airlines Corporation (NAC) brought the 18 bodies and mortal remains of one Nepali in its wide-body A330 aircraft as part of its corporate social responsibility, according to officials. The bodies of those who died in Malaysia in the past couple of months could not be brought back to their homeland due to the COVID-19 pan- demic. Most of the people died due to heart attacks while some of them committed suicide. There are 37 more bodies waiting to be sent back to Nepal, the NAC said, adding that necessary preparations were underway to bring back the remaining ones. =T_P[QaX]VbQPRZQ^SXTb^U 'XVaP]cbUa^P[PhbXP 7:[^RZbS^f] :U^a P]SPc^ah2^eXScTbcX]V