The Truth about mRNA Vaccines, by Raffaele AnsoviniGuy Boulianne
The document summarizes the key claims of an article arguing that mRNA vaccines do not work as advertised. It argues that for mRNA to produce spike proteins as claimed: 1) the mRNA must incorporate into the host cell genome to avoid destruction, and 2) must alter the cell's redox state and activate nucleus factors to trigger protein synthesis, which mRNA alone cannot do. The conclusion is that vaccine manufacturers are lying by claiming mRNA can produce spike proteins without integrating into the genome and then being destroyed, and that pandemics cannot be stopped through such scientific untruths.
mRNA vaccines against emerging infectious diseases; A challenging approach of...AI Publications
This document summarizes a research article about mRNA vaccines against emerging infectious diseases. It discusses how mRNA vaccines work by introducing mRNA instructions into cells that cause the cells to produce antigens and trigger an immune response. Two major benefits of mRNA vaccines are their ability to be rapidly designed and manufactured. The document reviews the development of mRNA vaccines for SARS-CoV-2 and their approval for use in humans. It also discusses challenges in mRNA vaccine delivery and development, as well as the immune responses and advantages of mRNA vaccines.
1) There are various COVID-19 vaccine candidates that target different parts of the SARS-CoV-2 spike protein, including the full-length spike protein and the receptor-binding domain (RBD).
2) Some research suggests the RBD may be a better target than the full-length spike protein due to concerns that the full protein could potentially cause immune pathology.
3) However, vaccines using the full-length spike protein aim to better mimic the natural infection and induce antibodies and T-cell responses against multiple epitopes on the spike protein.
This slide tries to explain and introduce you to the mRNA Vaccine Technology, describes mRNA Vaccines, Mechanism , Delivery, some research and case study of pandemic and advantages disadvantages & application see for yourself in detail.
Vaccines based on messenger RNA (mRNA) have attracted worldwide attention as Pfizer and Moderna vaccines have been authorized for emergency use by the U.S. Food and Drug Administration (FDA) and similar agencies around the world. This is the first time an mRNA-based vaccine has been approved for use in healthy people, marking an important milestone in the achievements of science and public health.
Paxlovid and Molnupiravir What Are The Differences.pdfDoriaFang
On November 4, 2021, the Medicines and Healthcare Products Regulatory Agency (MHRA) granted marketing approval for Molnupiravir (trade name: Lagevrio), an oral COVID-19 drug co-developed by Merck and Ridgeback, for the treatment of patients with mild to moderate COVID-19. This is the first oral antiviral drug approved globally for the treatment of mild to moderate COVID-19 in adults.
The Truth about mRNA Vaccines, by Raffaele AnsoviniGuy Boulianne
The document summarizes the key claims of an article arguing that mRNA vaccines do not work as advertised. It argues that for mRNA to produce spike proteins as claimed: 1) the mRNA must incorporate into the host cell genome to avoid destruction, and 2) must alter the cell's redox state and activate nucleus factors to trigger protein synthesis, which mRNA alone cannot do. The conclusion is that vaccine manufacturers are lying by claiming mRNA can produce spike proteins without integrating into the genome and then being destroyed, and that pandemics cannot be stopped through such scientific untruths.
mRNA vaccines against emerging infectious diseases; A challenging approach of...AI Publications
This document summarizes a research article about mRNA vaccines against emerging infectious diseases. It discusses how mRNA vaccines work by introducing mRNA instructions into cells that cause the cells to produce antigens and trigger an immune response. Two major benefits of mRNA vaccines are their ability to be rapidly designed and manufactured. The document reviews the development of mRNA vaccines for SARS-CoV-2 and their approval for use in humans. It also discusses challenges in mRNA vaccine delivery and development, as well as the immune responses and advantages of mRNA vaccines.
1) There are various COVID-19 vaccine candidates that target different parts of the SARS-CoV-2 spike protein, including the full-length spike protein and the receptor-binding domain (RBD).
2) Some research suggests the RBD may be a better target than the full-length spike protein due to concerns that the full protein could potentially cause immune pathology.
3) However, vaccines using the full-length spike protein aim to better mimic the natural infection and induce antibodies and T-cell responses against multiple epitopes on the spike protein.
This slide tries to explain and introduce you to the mRNA Vaccine Technology, describes mRNA Vaccines, Mechanism , Delivery, some research and case study of pandemic and advantages disadvantages & application see for yourself in detail.
Vaccines based on messenger RNA (mRNA) have attracted worldwide attention as Pfizer and Moderna vaccines have been authorized for emergency use by the U.S. Food and Drug Administration (FDA) and similar agencies around the world. This is the first time an mRNA-based vaccine has been approved for use in healthy people, marking an important milestone in the achievements of science and public health.
Paxlovid and Molnupiravir What Are The Differences.pdfDoriaFang
On November 4, 2021, the Medicines and Healthcare Products Regulatory Agency (MHRA) granted marketing approval for Molnupiravir (trade name: Lagevrio), an oral COVID-19 drug co-developed by Merck and Ridgeback, for the treatment of patients with mild to moderate COVID-19. This is the first oral antiviral drug approved globally for the treatment of mild to moderate COVID-19 in adults.
This document discusses the potential relationship between the SARS-CoV-2 spike protein and increased risk of thrombosis (blood clots). It summarizes several studies that found:
1) The spike protein can directly activate platelets and promote blood clotting.
2) TNF, which is increased during viral infections, provides a procoagulant stimulus that may contribute to hypercoagulable states.
3) Some COVID-19 patients have developed rare cerebral venous sinus thrombosis, and the spike protein may interact with integrins to enhance viral entry and induce a procoagulant state.
SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination I...Guy Boulianne
This document summarizes a research study that investigated how the SARS-CoV-2 spike protein affects DNA damage repair and adaptive immunity. The main findings are:
1) The SARS-CoV-2 spike protein significantly inhibited DNA damage repair in in vitro cell line experiments by impeding the recruitment of key DNA repair proteins like BRCA1 and 53BP1 to damage sites.
2) DNA damage repair is required for effective V(D)J recombination, which generates antibody diversity in B cells and T cell receptors in T cells. Inhibiting DNA damage repair could therefore impair adaptive immunity.
3) The spike protein was found to localize in the cell nucleus, where it could interfere with DNA repair
Les dossiers d’expertise du Dr Hervé Seligmann, du Prof. Luc Montagnier et du...Guy Boulianne
- 13 of the 38 Covid-19 vaccine candidates in clinical trials produce the viral protein using transgenic cells. Another uses plant cells to produce virus-like particles (VLPs).
- The remaining 18 candidates introduce viral genetic material (RNA or DNA) into human cells using lipid nanoparticles, plasmids, or genetically modified viruses.
- All vaccine types carry risks. Inactivated vaccines require adjuvants that can be toxic and may increase infection risk. Transgenic cell produced proteins may fold incorrectly and cause toxicity. Introducing genetic material brings risks of unintended effects from foreign DNA/RNA in human cells. Precautions are needed given the novelty of SARS-CoV-2.
The document summarizes the development of three types of LAB-based (lactic acid bacteria-based) vaccines described in a Ph.D. thesis. It describes (1) the development of a safer plasmid DNA vaccine using L. lactis that obtained comparable antibody responses to an E. coli vector but lower CD8+ T cell activation, (2) the production of the peanut allergen Ara h 2 in L. lactis and its authenticity, and (3) the use of LAB for antigen delivery by presenting antigens on their surface and through adhesion mechanisms aided by molecules like the mannose-binding adhesin.
This ppts is based upon the recent adavancement and methodology about mitochondrial transformation. What is organellar transformation and what is the importance in contemporary time.
This document provides information about COVID-19 and SARS-CoV-2. It discusses that SARS-CoV-2 is the virus that causes COVID-19, was first identified in Wuhan, China in December 2019, and has since caused a global pandemic. It is transmitted through respiratory droplets and can spread from people who are contagious even if they don't have symptoms. The document also summarizes the virus's structure, genome, replication process, symptoms, risk factors, testing methods, and treatment approaches.
This document discusses various topics related to bacterial genetics including DNA structure, transcription, translation, and methods of gene transfer. It begins with an introduction to basic principles of molecular biology like the central dogma. It then describes DNA and RNA structure, explaining the double helix model and base pairing. Later sections cover genetic variation and mechanisms that lead to changes in bacterial genotypes, including mutation, transformation, transduction, and lysogenic conversion. The document contains diagrams and explanations of these concepts.
Bacterial genetics 2015 December Second MBBS students MicrobiologySOMESHWARAN R
The document discusses various topics related to bacterial genetics including DNA structure, transcription, translation, and gene transfer mechanisms. It provides an overview of the central dogma of molecular biology, DNA and RNA structure, transcription and translation processes, bacterial chromosome, plasmids, and different types of mutations. Furthermore, it explains the key mechanisms of genetic recombination in bacteria namely transformation, transduction, and conjugation.
DNA vaccines work by injecting genetically engineered DNA that causes host cells to produce antigens, which stimulate the immune system. They have several advantages over traditional vaccines, including lower risk and ability to induce both antibody and T cell responses. DNA vaccines are made by inserting antigen-encoding genes into bacterial plasmids, amplifying the plasmids in bacteria, purifying the DNA, and then injecting it intramuscularly or using a gene gun. The DNA is taken up by host cells and expressed as antigens, which are processed and presented to induce cytotoxic T cells and antibody production against the target pathogen. Future improvements may enhance DNA uptake and expression to improve immune responses.
New coronavirus inhibitor exhibits antiviral activity Harm Kiezebrink
Searching for inhibitors of coronaviruses, an international team of scientists led by Edward Trybala, from the University of Gothenburg, Sweden, and Volker Thiel, from the University of Berne, Switzerland, identified a compound called K22.
They initially discovered that K22 had antiviral activity against a relatively harmless coronavirus that causes mild cold-like symptoms in humans.
Follow-up experiments showed that the compound was effective against all other coronaviruses tested, including the SARS and MERS coronaviruses.
The researchers also demonstrated efficient inhibition of virus in cells that line the human airways and are the natural port of entry for respiratory viruses.
A pneumonia of unknown cause detected in Wuhan, China was first reported to the WHO
Country Office in China on 31 December 2019.In the last Nine months, almost Ten lakhs of
lives have already been Death, around three billion of people are in quarantine, and global
economies have been decreased. The outbreak of pandemic Covid-19 all over the world has
broken down the political, social, economic, religious and financial structures of the whole
world. The World’s top economies country such as the Australia, USA, India China, UK,
Germany, France, Italy, Japan and many others. The Stock Markets around the world have
been broken down and oil prices have fallen off a cliff. A report was published on BBC where
they describe every single week 3.3 million Americans have been unemployment and a week
later another 6.6 million people started searching for new jobs. The novel coronavirus is a
microscopic organism that has become an epidemic over time around the world. The United
States, Europe, Britain, Italy, Spain and France have already been hit by the virus. These
countries have already become mortal by Corona virus.
This document provides information on the phenotype and genotype of COVID-19. It discusses that coronaviruses are RNA viruses that cause respiratory infections in humans. COVID-19 is caused by a novel betacoronavirus. The virus particle is spherical with spikes and enters cells by binding to the ACE2 receptor. It contains a positive-sense RNA genome that is translated and replicated via a replicase-transcriptase complex to make structural proteins and more virus particles.
The document discusses the manufacturing process for mRNA-lipid nanoparticles (mRNA-LNPs) as a drug product. It describes the five key steps in manufacturing as: 1) DNA template manufacturing, 2) mRNA drug substance synthesis and purification, 3) mRNA-LNP formulation and purification, 4) fill/finish operations, and 5) analytical testing. It then examines some of the challenges and considerations for the manufacturing process and facilities, focusing on mRNA synthesis, capping strategies, mRNA-LNP formulation, and formulation considerations during final processing steps.
Viruses infect plants through wounds or insect vectors and use host cell machinery to replicate their genomes and produce proteins. They move between cells via plasmodesmata or transport streams. Pathogenesis involves implantation, local replication, spread to target organs, and shedding from the plant. Strategies to control plant viruses include eliminating sources and infected plants, controlling vectors, breeding resistance, and using cross-protection methods like satellite RNAs or transgenic expression of antiviral genes. RNA interference is now a primary tool for inducing virus resistance by degrading viral genomes.
This document provides an overview of gene expression systems and vectors used for gene transfer. It discusses the key phases of gene expression including transcription, post-transcriptional modifications, RNA transport, translation, and protein binding. It describes the two major categories of gene therapy - somatic and germline - and the three types of delivery - ex vivo, in situ, and in vitro. Finally, it summarizes the major viral vectors including retroviruses, adenoviruses, lentiviruses, and adeno-associated viruses, as well as various non-viral physical methods like electroporation and chemical methods using inorganic particles and biodegradable polymers.
This document summarizes a study on two genome editing tools: CRISPR/Cas9 and RNAi. CRISPR/Cas9 originated from the adaptive immune system of bacteria and allows for easy editing of DNA at specific locations using an RNA guide and Cas9 enzyme. RNAi utilizes small interfering RNAs to degrade mRNA and silence genes. The document discusses the mechanisms, applications in agriculture, disease modeling and gene therapy, and compares the advantages of CRISPR/Cas9 over RNAi.
The document discusses the relationship between COVID-19 vaccines that target the full-length spike protein versus just the receptor-binding domain (RBD), and their potential relationship to procoagulant effects and rare blood clotting issues. Some key points:
- Vaccines like AstraZeneca use the full-length spike protein in viral vectors, while others just target the RBD region.
- The spike protein plays a role in viral entry and interacts with host cell receptors like ACE2. It also has glycans that help disguise the virus.
- Studies found the AstraZeneca vaccine induces cell spikes similar to SARS-CoV-2, eliciting an immune response.
-
This document provides information about COVID-19, including its definition, epidemiology, etiology, structure, pathophysiology, transmission, symptoms, testing, treatment research, and vaccine research. It defines COVID-19 as a respiratory illness caused by a newly discovered coronavirus. It discusses the outbreak originating in Wuhan, China and the global spread of the disease. It also summarizes the virus's structure and life cycle within the body.
The document discusses gene therapy, including:
1. Defining genes and discussing early milestones in gene isolation and engineering.
2. Explaining the goal of gene therapy to introduce normal genes to compensate for defective genes.
3. Describing various methods of gene delivery including viral and non-viral vectors.
4. Discussing challenges in targeting specific cells/tissues and ensuring safe expression levels.
This document discusses the potential relationship between the SARS-CoV-2 spike protein and increased risk of thrombosis (blood clots). It summarizes several studies that found:
1) The spike protein can directly activate platelets and promote blood clotting.
2) TNF, which is increased during viral infections, provides a procoagulant stimulus that may contribute to hypercoagulable states.
3) Some COVID-19 patients have developed rare cerebral venous sinus thrombosis, and the spike protein may interact with integrins to enhance viral entry and induce a procoagulant state.
SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination I...Guy Boulianne
This document summarizes a research study that investigated how the SARS-CoV-2 spike protein affects DNA damage repair and adaptive immunity. The main findings are:
1) The SARS-CoV-2 spike protein significantly inhibited DNA damage repair in in vitro cell line experiments by impeding the recruitment of key DNA repair proteins like BRCA1 and 53BP1 to damage sites.
2) DNA damage repair is required for effective V(D)J recombination, which generates antibody diversity in B cells and T cell receptors in T cells. Inhibiting DNA damage repair could therefore impair adaptive immunity.
3) The spike protein was found to localize in the cell nucleus, where it could interfere with DNA repair
Les dossiers d’expertise du Dr Hervé Seligmann, du Prof. Luc Montagnier et du...Guy Boulianne
- 13 of the 38 Covid-19 vaccine candidates in clinical trials produce the viral protein using transgenic cells. Another uses plant cells to produce virus-like particles (VLPs).
- The remaining 18 candidates introduce viral genetic material (RNA or DNA) into human cells using lipid nanoparticles, plasmids, or genetically modified viruses.
- All vaccine types carry risks. Inactivated vaccines require adjuvants that can be toxic and may increase infection risk. Transgenic cell produced proteins may fold incorrectly and cause toxicity. Introducing genetic material brings risks of unintended effects from foreign DNA/RNA in human cells. Precautions are needed given the novelty of SARS-CoV-2.
The document summarizes the development of three types of LAB-based (lactic acid bacteria-based) vaccines described in a Ph.D. thesis. It describes (1) the development of a safer plasmid DNA vaccine using L. lactis that obtained comparable antibody responses to an E. coli vector but lower CD8+ T cell activation, (2) the production of the peanut allergen Ara h 2 in L. lactis and its authenticity, and (3) the use of LAB for antigen delivery by presenting antigens on their surface and through adhesion mechanisms aided by molecules like the mannose-binding adhesin.
This ppts is based upon the recent adavancement and methodology about mitochondrial transformation. What is organellar transformation and what is the importance in contemporary time.
This document provides information about COVID-19 and SARS-CoV-2. It discusses that SARS-CoV-2 is the virus that causes COVID-19, was first identified in Wuhan, China in December 2019, and has since caused a global pandemic. It is transmitted through respiratory droplets and can spread from people who are contagious even if they don't have symptoms. The document also summarizes the virus's structure, genome, replication process, symptoms, risk factors, testing methods, and treatment approaches.
This document discusses various topics related to bacterial genetics including DNA structure, transcription, translation, and methods of gene transfer. It begins with an introduction to basic principles of molecular biology like the central dogma. It then describes DNA and RNA structure, explaining the double helix model and base pairing. Later sections cover genetic variation and mechanisms that lead to changes in bacterial genotypes, including mutation, transformation, transduction, and lysogenic conversion. The document contains diagrams and explanations of these concepts.
Bacterial genetics 2015 December Second MBBS students MicrobiologySOMESHWARAN R
The document discusses various topics related to bacterial genetics including DNA structure, transcription, translation, and gene transfer mechanisms. It provides an overview of the central dogma of molecular biology, DNA and RNA structure, transcription and translation processes, bacterial chromosome, plasmids, and different types of mutations. Furthermore, it explains the key mechanisms of genetic recombination in bacteria namely transformation, transduction, and conjugation.
DNA vaccines work by injecting genetically engineered DNA that causes host cells to produce antigens, which stimulate the immune system. They have several advantages over traditional vaccines, including lower risk and ability to induce both antibody and T cell responses. DNA vaccines are made by inserting antigen-encoding genes into bacterial plasmids, amplifying the plasmids in bacteria, purifying the DNA, and then injecting it intramuscularly or using a gene gun. The DNA is taken up by host cells and expressed as antigens, which are processed and presented to induce cytotoxic T cells and antibody production against the target pathogen. Future improvements may enhance DNA uptake and expression to improve immune responses.
New coronavirus inhibitor exhibits antiviral activity Harm Kiezebrink
Searching for inhibitors of coronaviruses, an international team of scientists led by Edward Trybala, from the University of Gothenburg, Sweden, and Volker Thiel, from the University of Berne, Switzerland, identified a compound called K22.
They initially discovered that K22 had antiviral activity against a relatively harmless coronavirus that causes mild cold-like symptoms in humans.
Follow-up experiments showed that the compound was effective against all other coronaviruses tested, including the SARS and MERS coronaviruses.
The researchers also demonstrated efficient inhibition of virus in cells that line the human airways and are the natural port of entry for respiratory viruses.
A pneumonia of unknown cause detected in Wuhan, China was first reported to the WHO
Country Office in China on 31 December 2019.In the last Nine months, almost Ten lakhs of
lives have already been Death, around three billion of people are in quarantine, and global
economies have been decreased. The outbreak of pandemic Covid-19 all over the world has
broken down the political, social, economic, religious and financial structures of the whole
world. The World’s top economies country such as the Australia, USA, India China, UK,
Germany, France, Italy, Japan and many others. The Stock Markets around the world have
been broken down and oil prices have fallen off a cliff. A report was published on BBC where
they describe every single week 3.3 million Americans have been unemployment and a week
later another 6.6 million people started searching for new jobs. The novel coronavirus is a
microscopic organism that has become an epidemic over time around the world. The United
States, Europe, Britain, Italy, Spain and France have already been hit by the virus. These
countries have already become mortal by Corona virus.
This document provides information on the phenotype and genotype of COVID-19. It discusses that coronaviruses are RNA viruses that cause respiratory infections in humans. COVID-19 is caused by a novel betacoronavirus. The virus particle is spherical with spikes and enters cells by binding to the ACE2 receptor. It contains a positive-sense RNA genome that is translated and replicated via a replicase-transcriptase complex to make structural proteins and more virus particles.
The document discusses the manufacturing process for mRNA-lipid nanoparticles (mRNA-LNPs) as a drug product. It describes the five key steps in manufacturing as: 1) DNA template manufacturing, 2) mRNA drug substance synthesis and purification, 3) mRNA-LNP formulation and purification, 4) fill/finish operations, and 5) analytical testing. It then examines some of the challenges and considerations for the manufacturing process and facilities, focusing on mRNA synthesis, capping strategies, mRNA-LNP formulation, and formulation considerations during final processing steps.
Viruses infect plants through wounds or insect vectors and use host cell machinery to replicate their genomes and produce proteins. They move between cells via plasmodesmata or transport streams. Pathogenesis involves implantation, local replication, spread to target organs, and shedding from the plant. Strategies to control plant viruses include eliminating sources and infected plants, controlling vectors, breeding resistance, and using cross-protection methods like satellite RNAs or transgenic expression of antiviral genes. RNA interference is now a primary tool for inducing virus resistance by degrading viral genomes.
This document provides an overview of gene expression systems and vectors used for gene transfer. It discusses the key phases of gene expression including transcription, post-transcriptional modifications, RNA transport, translation, and protein binding. It describes the two major categories of gene therapy - somatic and germline - and the three types of delivery - ex vivo, in situ, and in vitro. Finally, it summarizes the major viral vectors including retroviruses, adenoviruses, lentiviruses, and adeno-associated viruses, as well as various non-viral physical methods like electroporation and chemical methods using inorganic particles and biodegradable polymers.
This document summarizes a study on two genome editing tools: CRISPR/Cas9 and RNAi. CRISPR/Cas9 originated from the adaptive immune system of bacteria and allows for easy editing of DNA at specific locations using an RNA guide and Cas9 enzyme. RNAi utilizes small interfering RNAs to degrade mRNA and silence genes. The document discusses the mechanisms, applications in agriculture, disease modeling and gene therapy, and compares the advantages of CRISPR/Cas9 over RNAi.
The document discusses the relationship between COVID-19 vaccines that target the full-length spike protein versus just the receptor-binding domain (RBD), and their potential relationship to procoagulant effects and rare blood clotting issues. Some key points:
- Vaccines like AstraZeneca use the full-length spike protein in viral vectors, while others just target the RBD region.
- The spike protein plays a role in viral entry and interacts with host cell receptors like ACE2. It also has glycans that help disguise the virus.
- Studies found the AstraZeneca vaccine induces cell spikes similar to SARS-CoV-2, eliciting an immune response.
-
This document provides information about COVID-19, including its definition, epidemiology, etiology, structure, pathophysiology, transmission, symptoms, testing, treatment research, and vaccine research. It defines COVID-19 as a respiratory illness caused by a newly discovered coronavirus. It discusses the outbreak originating in Wuhan, China and the global spread of the disease. It also summarizes the virus's structure and life cycle within the body.
The document discusses gene therapy, including:
1. Defining genes and discussing early milestones in gene isolation and engineering.
2. Explaining the goal of gene therapy to introduce normal genes to compensate for defective genes.
3. Describing various methods of gene delivery including viral and non-viral vectors.
4. Discussing challenges in targeting specific cells/tissues and ensuring safe expression levels.
Similar to Functionality and Clinical Effects of Anti-Cov2 Vaccines (Aka Mrna) And Integration on Mitochondrial DNA (20)
This document provides background information on Krakivski visti, a Ukrainian newspaper published during World War 2 under Nazi occupation. In spring/summer 1943, the German authorities demanded the newspaper publish a series of anti-Jewish articles. While the editors did not initiate this series, they saw it as an opportunity to promote Ukrainian interests. The series began with an article by Oleksander Mokh on the alleged harmful influence of Jews. However, the sources available provide an incomplete picture and leave many aspects unclear.
DEFCON-21 - How to Hack Your Mini Cooper, by Jason StaggsGuy Boulianne
This document discusses hacking a Mini Cooper by reverse engineering its Controller Area Network (CAN) messages. The presenter, Jason Staggs, captured CAN traffic from a Mini Cooper during a crash test. By plotting the data values over time, he was able to identify the message IDs corresponding to the speedometer and tachometer. He then built a proof-of-concept "CAN clock" by sending manipulated CAN messages from an Arduino to control the instrument cluster display. The document warns that lack of authentication on CAN messages leaves vehicles vulnerable and discusses the need for better access control and security on automotive networks.
How to Hack Your Mini Cooper. Reverse Engineering CAN Messages on Passenger A...Guy Boulianne
This document discusses reverse engineering CAN messages on passenger vehicles to manipulate vehicle systems. It presents a methodology for identifying proprietary CAN message IDs through analyzing logged CAN data from a staged crash of a Mini Cooper. The methodology is demonstrated by transforming the Mini Cooper's instrument cluster into a clock controlled by spoofed CAN messages from an Arduino. Wires from the instrument cluster are connected to a small CAN network along with the Arduino. The Arduino sends customized CAN messages to display the time on the instrument cluster gauges.
Conspirators Hierarchy: The Story of the Committee of 300, by John ColemanGuy Boulianne
This document provides an overview of a secret upper-level parallel government that controls the governments of Britain and the United States. It identifies the Committee of 300 as the ultimate power behind this secret government. It argues that this secret government operates in plain sight through public institutions like the White House and Congress, rather than in secret underground chambers. It claims this secret government is responsible for orchestrating wars, economic crises, and depopulation efforts as part of a conspiracy for a one world government.
COVID-Period Mass Vaccination Campaign and Public Health Disaster in the USAGuy Boulianne
This document analyzes all-cause mortality data in the United States from 1999-2022 to assess the impact of the COVID-19 vaccination campaign. It finds:
1) Excess all-cause mortality during the COVID period (March 2020-February 2022) was not reduced by vaccination and remained high irrespective of vaccinations. No deaths were averted due to vaccination.
2) Excess mortality risk was relatively uniform across age groups during the COVID period, inconsistent with COVID-19 risk which increases strongly with age. This implies COVID-19 was not a dominant cause of excess deaths.
3) Excess mortality correlated strongly with poverty levels by state but not elderly population fractions, further suggesting COVID-19
Memorandum of conversation between Mikhail Gorbachev and James Baker in MoscowGuy Boulianne
The National Security Archive is located at Suite 701 of Gelman Library at The George Washington University. It is located at 2130 H Street NW in Washington D.C. with a phone number of 202/994-7000 and fax number of 202/994-7005.
This document provides an introduction to the concept of MindWar and proposes its development as a new branch of the US Army focused on psychological operations. It begins with a preface discussing the historical reliance on physical warfare (PhysWar) despite its limited effectiveness in resolving disputes. The concept of MindWar is presented as a holistic alternative approach for resolving problems through emerging scientific methodologies focused on the information and cognitive domains. The document is divided into three parts that outline the concept of MindWar, how it could be organized as new branches within the Army, and a proposed multi-phase model for conducting a MindWar campaign.
The binding of cosmological structures by massless topological defectsSérgio Sacani
Assuming spherical symmetry and weak field, it is shown that if one solves the Poisson equation or the Einstein field
equations sourced by a topological defect, i.e. a singularity of a very specific form, the result is a localized gravitational
field capable of driving flat rotation (i.e. Keplerian circular orbits at a constant speed for all radii) of test masses on a thin
spherical shell without any underlying mass. Moreover, a large-scale structure which exploits this solution by assembling
concentrically a number of such topological defects can establish a flat stellar or galactic rotation curve, and can also deflect
light in the same manner as an equipotential (isothermal) sphere. Thus, the need for dark matter or modified gravity theory is
mitigated, at least in part.
Or: Beyond linear.
Abstract: Equivariant neural networks are neural networks that incorporate symmetries. The nonlinear activation functions in these networks result in interesting nonlinear equivariant maps between simple representations, and motivate the key player of this talk: piecewise linear representation theory.
Disclaimer: No one is perfect, so please mind that there might be mistakes and typos.
dtubbenhauer@gmail.com
Corrected slides: dtubbenhauer.com/talks.html
The technology uses reclaimed CO₂ as the dyeing medium in a closed loop process. When pressurized, CO₂ becomes supercritical (SC-CO₂). In this state CO₂ has a very high solvent power, allowing the dye to dissolve easily.
Unlocking the mysteries of reproduction: Exploring fecundity and gonadosomati...AbdullaAlAsif1
The pygmy halfbeak Dermogenys colletei, is known for its viviparous nature, this presents an intriguing case of relatively low fecundity, raising questions about potential compensatory reproductive strategies employed by this species. Our study delves into the examination of fecundity and the Gonadosomatic Index (GSI) in the Pygmy Halfbeak, D. colletei (Meisner, 2001), an intriguing viviparous fish indigenous to Sarawak, Borneo. We hypothesize that the Pygmy halfbeak, D. colletei, may exhibit unique reproductive adaptations to offset its low fecundity, thus enhancing its survival and fitness. To address this, we conducted a comprehensive study utilizing 28 mature female specimens of D. colletei, carefully measuring fecundity and GSI to shed light on the reproductive adaptations of this species. Our findings reveal that D. colletei indeed exhibits low fecundity, with a mean of 16.76 ± 2.01, and a mean GSI of 12.83 ± 1.27, providing crucial insights into the reproductive mechanisms at play in this species. These results underscore the existence of unique reproductive strategies in D. colletei, enabling its adaptation and persistence in Borneo's diverse aquatic ecosystems, and call for further ecological research to elucidate these mechanisms. This study lends to a better understanding of viviparous fish in Borneo and contributes to the broader field of aquatic ecology, enhancing our knowledge of species adaptations to unique ecological challenges.
Authoring a personal GPT for your research and practice: How we created the Q...Leonel Morgado
Thematic analysis in qualitative research is a time-consuming and systematic task, typically done using teams. Team members must ground their activities on common understandings of the major concepts underlying the thematic analysis, and define criteria for its development. However, conceptual misunderstandings, equivocations, and lack of adherence to criteria are challenges to the quality and speed of this process. Given the distributed and uncertain nature of this process, we wondered if the tasks in thematic analysis could be supported by readily available artificial intelligence chatbots. Our early efforts point to potential benefits: not just saving time in the coding process but better adherence to criteria and grounding, by increasing triangulation between humans and artificial intelligence. This tutorial will provide a description and demonstration of the process we followed, as two academic researchers, to develop a custom ChatGPT to assist with qualitative coding in the thematic data analysis process of immersive learning accounts in a survey of the academic literature: QUAL-E Immersive Learning Thematic Analysis Helper. In the hands-on time, participants will try out QUAL-E and develop their ideas for their own qualitative coding ChatGPT. Participants that have the paid ChatGPT Plus subscription can create a draft of their assistants. The organizers will provide course materials and slide deck that participants will be able to utilize to continue development of their custom GPT. The paid subscription to ChatGPT Plus is not required to participate in this workshop, just for trying out personal GPTs during it.
The debris of the ‘last major merger’ is dynamically youngSérgio Sacani
The Milky Way’s (MW) inner stellar halo contains an [Fe/H]-rich component with highly eccentric orbits, often referred to as the
‘last major merger.’ Hypotheses for the origin of this component include Gaia-Sausage/Enceladus (GSE), where the progenitor
collided with the MW proto-disc 8–11 Gyr ago, and the Virgo Radial Merger (VRM), where the progenitor collided with the
MW disc within the last 3 Gyr. These two scenarios make different predictions about observable structure in local phase space,
because the morphology of debris depends on how long it has had to phase mix. The recently identified phase-space folds in Gaia
DR3 have positive caustic velocities, making them fundamentally different than the phase-mixed chevrons found in simulations
at late times. Roughly 20 per cent of the stars in the prograde local stellar halo are associated with the observed caustics. Based
on a simple phase-mixing model, the observed number of caustics are consistent with a merger that occurred 1–2 Gyr ago.
We also compare the observed phase-space distribution to FIRE-2 Latte simulations of GSE-like mergers, using a quantitative
measurement of phase mixing (2D causticality). The observed local phase-space distribution best matches the simulated data
1–2 Gyr after collision, and certainly not later than 3 Gyr. This is further evidence that the progenitor of the ‘last major merger’
did not collide with the MW proto-disc at early times, as is thought for the GSE, but instead collided with the MW disc within
the last few Gyr, consistent with the body of work surrounding the VRM.
ESPP presentation to EU Waste Water Network, 4th June 2024 “EU policies driving nutrient removal and recycling
and the revised UWWTD (Urban Waste Water Treatment Directive)”
Describing and Interpreting an Immersive Learning Case with the Immersion Cub...Leonel Morgado
Current descriptions of immersive learning cases are often difficult or impossible to compare. This is due to a myriad of different options on what details to include, which aspects are relevant, and on the descriptive approaches employed. Also, these aspects often combine very specific details with more general guidelines or indicate intents and rationales without clarifying their implementation. In this paper we provide a method to describe immersive learning cases that is structured to enable comparisons, yet flexible enough to allow researchers and practitioners to decide which aspects to include. This method leverages a taxonomy that classifies educational aspects at three levels (uses, practices, and strategies) and then utilizes two frameworks, the Immersive Learning Brain and the Immersion Cube, to enable a structured description and interpretation of immersive learning cases. The method is then demonstrated on a published immersive learning case on training for wind turbine maintenance using virtual reality. Applying the method results in a structured artifact, the Immersive Learning Case Sheet, that tags the case with its proximal uses, practices, and strategies, and refines the free text case description to ensure that matching details are included. This contribution is thus a case description method in support of future comparative research of immersive learning cases. We then discuss how the resulting description and interpretation can be leveraged to change immersion learning cases, by enriching them (considering low-effort changes or additions) or innovating (exploring more challenging avenues of transformation). The method holds significant promise to support better-grounded research in immersive learning.
Remote Sensing and Computational, Evolutionary, Supercomputing, and Intellige...University of Maribor
Slides from talk:
Aleš Zamuda: Remote Sensing and Computational, Evolutionary, Supercomputing, and Intelligent Systems.
11th International Conference on Electrical, Electronics and Computer Engineering (IcETRAN), Niš, 3-6 June 2024
Inter-Society Networking Panel GRSS/MTT-S/CIS Panel Session: Promoting Connection and Cooperation
https://www.etran.rs/2024/en/home-english/
Remote Sensing and Computational, Evolutionary, Supercomputing, and Intellige...
Functionality and Clinical Effects of Anti-Cov2 Vaccines (Aka Mrna) And Integration on Mitochondrial DNA
1. Volume 1 | Issue 1 | 84
Functionality and Clinical Effects of Anti-Cov2 Vaccines (Aka Mrna) And
Integration on Mitochondrial DNA
Editor Note
Raffaele Ansovini researcher freelancer and inventor of
Ansovini Technology, Italy
Raffaele Ansovini
*
Corresponding author
Raffaele Ansovini, Raffaele Ansovini researcher freelancer and inventor of
Ansovini Technology, Italy
Submitted: 30 Jun 2022; Accepted: 05 Jul 2022; Published: 07 Jul 2022
World Journal of Clinical & Medical Images
World J Clin Med Img, 2022 www.opastonline.com
Abstract
1. This issue would require many pages, but it is briefly described here for easier understanding
2. The writer refers to the Molecular Biology Experts and to reading the copious literature on the proteins/
enzymes found in mRNA vaccines using the BLASTP approach (Appendix 1)
3. The reference literature, apart from being written in English, is also worded in an extremely technical style
4. They are given a specific functional sequence, aimed at the incorporation and expression of vaccine mRNA
into the genome of the mitochondria (mtDNA)
5. The vaccine mRNA does not refer to the segment relating to the Spike protein, but to the entire viral genome
6. Therefore, the Ribosomes are not the final destination of the vaccine mRNA; instead, the Mitochondria are
actually the seat of a DNA, accommodating the SARS-Cov2 genome in the same way as it does in the nuclear
genome.
7. Both the Mitochondria and Ribosomes are located in the Ergastoplasm and are separated from the cytosol by
an oxidation/reduction barrier 'in mV' (= one thousand times) three times higher than that of the cytosol.
8. Article from Science: Oxidized Redox State of Glutothiane in the Endoplasmic reticulum - 11 September 1992
volume 257, page 1496:15026
9. Thus only an mRNA that exits from both the nuclear and mitochondrial genomes has the enzyme support that
allows it to reach the ribosomes, overcoming the resistance of the oxidation/reduction barrier
10. If this were not the case, RNA viruses would not lengthen the pathway, integrating before the genome and
then reaching the ribosomes again as mRNA (it must be said that, in an RNA virus, the genomic RNA is the same
as the RNA coming out of the nucleus), but would immediately aim to reach the ribosomes, as RNA vaccines are
said to do.
11. Nano technologies are said to be the architects of this miraculous and rapid rush to the ribosomes of vaccine
mRNA
12. These nano-technologies are nothing more than a sequence of proteins/enzymes - undeclared - which are now
described here in their function in the main patterns
13. a) ryanodine receptor-
by managing the Ca++ ion flux channels, it first depolarises the mitochondrial membrane, which is the first step
for mRNA entry and then it lowers the oxidative/reductive level of the ergastoplasm, activating an osmotic "Δ"
(= delta-difference) around the mitochondria, releasing the protonated ions (=H + ) present in the virtual space
of the two sheets forming the mitochondrial membrane into the area.
14. b) ABC transporter - ATP - binding protein
By binding to ATP, it allows vaccine RNA to enter the mitochondria
15. c) Epical complex lysine methyltran spherase
By providing mobility for the entering mRNA, it allows to reach the stretch of mitochondrial DNA most suitable
for integration
16. d) DDLS - Typ - integrase/transpasase
It simultaneously does the work performed before by reverse transcriptase and integrase, and then inserts a viral
genome RNA, similar to the genomic RNA in RNA viruses, into the mitochondrial genome.
17. e) Pullulanase
The hydrolysis of the (1 → 6) X - D glucoside bonds of mitochondrial DNA paves the way for the action of the
Citation: Raffaele Ansovini (2022). Functionality and Clinical Effects of Anti-Cov2 Vaccines (Aka Mrna) And Integration on Mi-
tochondrial DNA, World J Clin Med Img, 1(1), 01-13.
2. Volume 1 | Issue 1 | 02
World J Clin Med Img, 2022 www.opastonline.com
18. f) DNA Helicase
which by copying the inserted DNA - DNA from the mRNA vaccine - makes it more permanently stored in the
mitochondrial genome
19. - Note -
The presence of DNA Helicase in mRNA vaccines is further proof that integration does not take place in the
core genome. It is impossible for the nuclear genome to simultaneously absorb and copy a viral genome when,
due to the 'restitutio ad integrum' acquired during evolutionary times, it tends to shed the viral genome after
the infection is past. If this were not the case, the 'Spanish flu' contracted by our grandparents could reappear
today through genetics.
20. g) DNA J homolog subfamily B
completes the job, aiding the release of the new mRNA and providing it with support to reach ribosomes as is
the case for all mRNAs of both nuclear and mitochondrial origin.
21. A larval infection of low-intensity SARS Cov2 has thus occurred at the mitochondrial site
22. This infection is evidenced by the presence of biochemical patterns associated with the existence of a viral
cycle in the blood of multi-vaccinated with SARS vaccine- Cov2
They are:
1. Fatty acid synthase
2. Interlenkui 17 F
3. ATP defendent RNA Helicase DH X 58
4. TIR domain containing aslapter Molecule 1
5. Vam 6/Vps39-litie protein
6. NACHT, LRR aust PY D damains containing protein 1
7. Replicase paly protein 1a
8. Basigm
9. Spike glycoprotein
and the list goes on.
23. The picture described is not devoid of secondary clinical events, commonly referred to as 'adverse events'.
(a) Weakness asthenia. Mitochondria are the seat of ATP production - the human energy source. The new role
given by vaccines to mitochondria reduces their ATP production ability.
(b) Cardiac arrhythmias and arrests due to the action of the ryanodine receptor, which eliminates Ca++ ions not
only in skeletal muscles, but also in the myocardium, resulting in altered and impaired ventricular contractility
(c) 5-7 months following the third dose of the mRNA vaccine, a loss of CD+19 can be observed. A new form of
immunodeficiency is arising that has yet to be fully understood.
24. To date, no serious effects from SARS-Cov2 on a massive scale are recorded, not because the vaccines under
consideration have promoted an effective immune action, with a corresponding memory for future defence, but
because a fact has occurred that in nature is a real stretch: the larval SARS-Cov2 infection at the mitochondrial
site is opposed by another infection at the nuclear site, thus creating an opposition similar to that which occurs
between two algebraic numbers of opposite sign. They decrease in value.
25. Antic-Covid19 mRNA vaccines are dangerous.
Side note
Considering that, at the onset of Covid 19 infection, a marked
asthenia with abnormal and paradoxical albumin consumption
was observed in infected patients, whereas fat reserves were not
mobilised via the usual beta-oxidation of fatty acids, it can there-
fore be assumed, unlikely as it may sound, that SARS-Cov2, af-
ter manipulation, from its reductive oxide, may have a dual inte-
gration site - the nuclear genome and the mitochondrial genome.
This results in the disruption of ATP production and the organic
energy disorders noted and, possibly, even the most severe forms
of the disease. Hence the need for mitochondrial integration that
antagonises the virus embedded in the nucleus by the vaccine
mRNA, as described in the previous pages.
PRIMARY SOURCES
1. Ansovini Technology Patent US8852582B2.
2. Ansovini R. Determination of an Antiviral Activity of a
Composition Comprising Glutathione Reductase (GSSG-R)
and Oxidized Glutathione (GSSG) for Pharmaceutical use:
Experiments In vitro and In vivo. J Biomed Res Environ
Sci. 2020 Jun 17; 1(2): 029-038. doi: 10.37871/jels1117,
Article ID: jels1117.
3. Ansovini R, Compagnucci L. The Hypothetical Role of
Erythrocytes in COVID-19: Immediate Clinical Therapy. J
Biomed Res Environ Sci. 2020 Jul 02; 1(3): 048-050. doi:
10.37871/jels1119, Article ID: JELS1119.
4. Ansovini R, Compagnucci L. Use of Polio Vaccine Salk vs
SARS- CoV-2E and HIV-1E 2, both as Therapeutic Drug
and Effective Vaccine to Make Memory-Cells Able to Stop
Reinfections. J Biomed Res Environ Sci. 2020 Nov 18; 1(7):
311-312. doi: 10.37871/jbres1160, Article ID: JBRES1160.
5. Ansovini R. The Truth about mRNA Vaccines. J Biomed
Res Environ Sci. 2022 Jan 29; 3(1): 094-095. doi: 10.37871/
jbres1406, Article ID: jbres1406.
6. Hwang C, Sinskey AJ, Lodish HF. Oxidized redox state of
glutathione in the endoplasmic reticulum. Science. 1992 Sep
11;257 (5076):1496-502. doi: 10.1126/science.1523409.
PMID: 1523409.
Appendix 1
3. Volume 1 | Issue 1 | 03
World J Clin Med Img, 2022 www.opastonline.com
BLASTP search results
BLASTP 2.0MP-WashU [04-May-2006] [linux26-x64-I32L-
PF64 2006-05-10T17:22:28]
Copyright (C) 1996-2006 Washington University, Saint Louis,
Missouri USA. All Rights Reserved.
Suplimentary code is mentioned in below of the reference sec-
tion
References
1. Gish, W. (1996-2006) http://blast.wustl.edu
2. Shevchenko, A., Sunyaev, S., Loboda, A., Shevchenko, A.,
Bork, P., Ens, W., & Standing, K. G. (2001). Charting the
proteomes of organisms with unsequenced genomes by
MALDI-quadrupole time-of-flight mass spectrometry and
BLAST homology searching. Analytical chemistry, 73(9),
1917-1926. Abstract
Query= query_sequence
(203 letters)
Echofilter:
>Unfiltered+0
PTGGHDRNSGNYLRGLSSWARGATAYSREHTRPTRGFT-
VTHRTSASAYRHPSNTHRGAGA
VRRSDGDNMRSAPLTHRHVFDDRRVYDQYYRVFSDVM-
REGLHMSKLTHSPGRVDLAMMRD
GVDVHRLSGLAMRAHSHHTRVGPDHTRMASECHRDT-
GLLERSAWWELRSSRLYCKLANLL LRLMALRRRDDG-
NYLRASQLLLR
Database: NCBI nr95 (MS-BLAST) 144,844,843 sequences;
49,010,334,033 total letters.
Searching....10....20....30....40....50....60....70....80....90....100%
done
Color Key: red = positive hit; green = borderline hit; black =
negative result
High Total
Sequences producing High-scoring Segment Pairs: Score Score
/:CUE79935.1 inositol 1,4,5-trisphosphate/ryanodine recep... 64
189
/:WP_151079925.1 MULTISPECIES: hypothetical protein
[uncl... 40 183
/:XP_029901852.1 F-box DNA helicase 1 [Myripristis murd-
jan]/ 56 180
/:ADG75409.1 alpha-1,6-glucosidase, pullulanase-type [Cel...
57 179
/:XP_019169829.1 PREDICTED: probable serine/thre-
onine-pro... 53 173
/:XP_029218919.1 apical complex lysine methyltransferase ...
52 168
/:QAA76796.1 Transketolase [Candidatus Bipolaricaulis sib...
60 168
/:XP_025997073.1 dnaJ homolog subfamily B member
6-B-like... 59 168
/:WP_068254241.1 hypothetical protein [Janibacter coralli... 53
167
/:XP_011265016.1 dnaJ homolog subfamily B member 6-B
isof... 59 164
/:WP_084032530.1 DDE-type integrase/transposase/recombi-
na... 51 163
/:WP_019146189.1 deoxyguanosinetriphosphate triphospho-
hyd... 49 161
/:WP_003931701.1 hypothetical protein [Mycolicibacterium ...
47 159
/:XP_023095958.1 basic proline-rich protein-like [Felis c... 46
159
/:XP_001707494.1 Hypothetical protein GL50803_32673
[Giar... 46 154
/:NBB68986.1 phosphoenolpyruvate carboxylase [Alphapro-
teo... 59 145
/:HFE44551.1 hypothetical protein [Nannocystis exedens]/ 53
144 /:WP_153398479.1 penicillin-binding protein 2 [Ornithin-
ic... 51 143
/:WP_102647918.1 alpha,alpha-trehalose-phosphate synthase...
74 142
/:TAM50426.1 alpha,alpha-trehalose-phosphate synthase (UD...
74 142
/:WP_074578074.1 DUF2169 domain-containing protein [Po-
lar... 53 141
/:XP_011702985.1 PREDICTED: dnaJ homolog subfamily B
memb... 59 141
/:RLS30951.1 hypothetical protein DWH78_13845 [Plancto-
myc... 51 140
/:KZS03838.1 Uncharacterized protein APZ42_033339 [Daph-
ni... 61 139
/:WP_057246641.1 hypothetical protein [Duganella sp. Root...
49 139
/:WP_113617232.1 hypothetical protein [Chitinophaga flava...
64 139
/:WP_102069824.1 alpha,alpha-trehalose-phosphate synthase...
68 138
/:XP_012255663.1 dnaJ homolog subfamily B member 6-like
i... 59 138
/:WP_094301623.1 cobalamin biosynthesis protein [Azospiri...
48 137
/:WP_131518914.1 glycerophosphodiester phosphodiesterase ...
49 137
/:NDC61331.1 bifunctional diaminohydroxyphosphoribosyla-
mi... 55 136
/:TMF77358.1 hypothetical protein E6I15_04945 [Chloroflex...
49 136
/:WP_115533291.1 alpha,alpha-trehalose-phosphate synthase...
68 136
/:XP_012135622.1 PREDICTED: dnaJ homolog subfamily B
memb... 59 136
/:XP_012522221.1 dnaJ homolog subfamily B member 6 iso-
for... 59 135
/:HEG86595.1 murein biosynthesis integral membrane protei...
55 134
/:WP_069321809.1 CatB-related O-acetyltransferase [Sphing...
47 134
/:WP_156384232.1 hypothetical protein [Marmoricola sp. Le...
53 134
/:WP_051399855.1 ABC transporter ATP-binding protein
[Amy... 63 134