SlideShare a Scribd company logo

Consider a two-state paramagnet with a very large number N of elemen.pdf

•
•
K
karymadelaneyrenne19

Consider a two-state paramagnet with a very large number N of elementary dipoles (N>>1) with the total energy fixed at zero so that exactly half of the dipoles point up and half point down. How many microstates are accessible to the system? Solution no of available microstates of the system in (N)C(N/2).

Education
1 of 1
Download to read offline
Consider a two-state paramagnet with a very large number N of elementary dipoles (N>>1) with the total energy fixed at zero so that exactly half of the dipoles point up and half point down. How many microstates are accessible to the system? Solution no of available microstates of the system in (N)C(N/2)

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 
Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfkarymadelaneyrenne19
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 
How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17Celine George
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 

More Related Content

More from karymadelaneyrenne19

Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfkarymadelaneyrenne19
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 

More from karymadelaneyrenne19 (20)

Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdf
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdf
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdf
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdf
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdf
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdf
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdf
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdf
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdf
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdf
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdf
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdf
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdf
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdf
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdf
 

Recently uploaded

How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17Celine George
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
Understanding Accommodations and Modifications
Understanding Accommodations and ModificationsUnderstanding Accommodations and Modifications
Understanding Accommodations and ModificationsMJDuyan
 
PROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPoojaSen20
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfAdmir Softic
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhikauryashika82
 
psychiatric nursing HISTORY COLLECTION .docx
psychiatric nursing HISTORY COLLECTION .docxpsychiatric nursing HISTORY COLLECTION .docx
psychiatric nursing HISTORY COLLECTION .docxPoojaSen20
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSCeline George
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...ZurliaSoop
 
Dyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxDyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxcallscotland1987
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 
ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701bronxfugly43
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxAreebaZafar22
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.MaryamAhmad92
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxDenish Jangid
 
This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.christianmathematics
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.pptRamjanShidvankar
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxAmanpreet Kaur
 

Recently uploaded (20)

How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Understanding Accommodations and Modifications
Understanding Accommodations and ModificationsUnderstanding Accommodations and Modifications
Understanding Accommodations and Modifications
 
PROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docxPROCESS RECORDING FORMAT.docx
PROCESS RECORDING FORMAT.docx
 
Key note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdfKey note speaker Neum_Admir Softic_ENG.pdf
Key note speaker Neum_Admir Softic_ENG.pdf
 
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in DelhiRussian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
Russian Escort Service in Delhi 11k Hotel Foreigner Russian Call Girls in Delhi
 
psychiatric nursing HISTORY COLLECTION .docx
psychiatric nursing HISTORY COLLECTION .docxpsychiatric nursing HISTORY COLLECTION .docx
psychiatric nursing HISTORY COLLECTION .docx
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
Jual Obat Aborsi Hongkong ( Asli No.1 ) 085657271886 Obat Penggugur Kandungan...
 
Dyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxDyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptx
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701
 
Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024Mehran University Newsletter Vol-X, Issue-I, 2024
Mehran University Newsletter Vol-X, Issue-I, 2024
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptxBasic Civil Engineering first year Notes- Chapter 4 Building.pptx
Basic Civil Engineering first year Notes- Chapter 4 Building.pptx
 
This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.This PowerPoint helps students to consider the concept of infinity.
This PowerPoint helps students to consider the concept of infinity.
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.ppt
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
 

Consider a two-state paramagnet with a very large number N of elemen.pdf

  • 1. Consider a two-state paramagnet with a very large number N of elementary dipoles (N>>1) with the total energy fixed at zero so that exactly half of the dipoles point up and half point down. How many microstates are accessible to the system? Solution no of available microstates of the system in (N)C(N/2)