SlideShare a Scribd company logo

Why do you need proteins to allow ions to cross the cell membrane an.pdf

•
•
K
karymadelaneyrenne19

Why do you need proteins to allow ions to cross the cell membrane and enter the muscle cell? Solution The transfer of ions are required for the conductance of muscle impulse. The proteins are attached to, or associated with the membrane of a cell or an organelle. Facilitated diffusion is the spontaneous passage of molecules or ions across a biological membrane passing through specific transmembrane integral proteins. The use of proteins along with different proteins used in the transport of ions are listed below:.

Education
1 of 1
Download to read offline
Why do you need proteins to allow ions to cross the cell membrane and enter the muscle cell? Solution The transfer of ions are required for the conductance of muscle impulse. The proteins are attached to, or associated with the membrane of a cell or an organelle. Facilitated diffusion is the spontaneous passage of molecules or ions across a biological membrane passing through specific transmembrane integral proteins. The use of proteins along with different proteins used in the transport of ions are listed below:

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 
Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfkarymadelaneyrenne19
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...Nguyen Thanh Tu Collection
 

More Related Content

More from karymadelaneyrenne19

Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfkarymadelaneyrenne19
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 

More from karymadelaneyrenne19 (20)

Describe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdfDescribe the various types of computer-based information systems in .pdf
Describe the various types of computer-based information systems in .pdf
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdf
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdf
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdf
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdf
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdf
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdf
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdf
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdf
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdf
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdf
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdf
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdf
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdf
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdf
 

Recently uploaded

Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...Nguyen Thanh Tu Collection
 
How to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxHow to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxCeline George
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 
Graduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - EnglishGraduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - Englishneillewis46
 
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfUnit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfDr Vijay Vishwakarma
 
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Pooja Bhuva
 
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptx
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptxHMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptx
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptxmarlenawright1
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomFostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomPooky Knightsmith
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibitjbellavia9
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024Elizabeth Walsh
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxDr. Sarita Anand
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxAreebaZafar22
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsMebane Rash
 
Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Jisc
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.MaryamAhmad92
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsKarakKing
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxEsquimalt MFRC
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentationcamerronhm
 

Recently uploaded (20)

Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
TỔNG ÔN TẬP THI VÀO LỚP 10 MÔN TIẾNG ANH NĂM HỌC 2023 - 2024 CÓ ĐÁP ÁN (NGỮ Â...
 
How to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptxHow to setup Pycharm environment for Odoo 17.pptx
How to setup Pycharm environment for Odoo 17.pptx
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
Graduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - EnglishGraduate Outcomes Presentation Slides - English
Graduate Outcomes Presentation Slides - English
 
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdfUnit 3 Emotional Intelligence and Spiritual Intelligence.pdf
Unit 3 Emotional Intelligence and Spiritual Intelligence.pdf
 
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
Beyond_Borders_Understanding_Anime_and_Manga_Fandom_A_Comprehensive_Audience_...
 
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptx
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptxHMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptx
HMCS Vancouver Pre-Deployment Brief - May 2024 (Web Version).pptx
 
Fostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds in the ClassroomFostering Friendships - Enhancing Social Bonds in the Classroom
Fostering Friendships - Enhancing Social Bonds in the Classroom
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
Sociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning ExhibitSociology 101 Demonstration of Learning Exhibit
Sociology 101 Demonstration of Learning Exhibit
 
FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024FSB Advising Checklist - Orientation 2024
FSB Advising Checklist - Orientation 2024
 
Google Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptxGoogle Gemini An AI Revolution in Education.pptx
Google Gemini An AI Revolution in Education.pptx
 
ICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptxICT Role in 21st Century Education & its Challenges.pptx
ICT Role in 21st Century Education & its Challenges.pptx
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan Fellows
 
Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)Accessible Digital Futures project (20/03/2024)
Accessible Digital Futures project (20/03/2024)
 
ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.ICT role in 21st century education and it's challenges.
ICT role in 21st century education and it's challenges.
 
Salient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functionsSalient Features of India constitution especially power and functions
Salient Features of India constitution especially power and functions
 
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptxHMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
HMCS Max Bernays Pre-Deployment Brief (May 2024).pptx
 
SOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning PresentationSOC 101 Demonstration of Learning Presentation
SOC 101 Demonstration of Learning Presentation
 

Why do you need proteins to allow ions to cross the cell membrane an.pdf

  • 1. Why do you need proteins to allow ions to cross the cell membrane and enter the muscle cell? Solution The transfer of ions are required for the conductance of muscle impulse. The proteins are attached to, or associated with the membrane of a cell or an organelle. Facilitated diffusion is the spontaneous passage of molecules or ions across a biological membrane passing through specific transmembrane integral proteins. The use of proteins along with different proteins used in the transport of ions are listed below: